THO complex subunit 1

Overview
NameTHO complex subunit 1
Smed IDSMED30006429
Length (bp)2062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of THO complex subunit 1 (SMED30006429) t-SNE clustered cells

Violin plots show distribution of expression levels for THO complex subunit 1 (SMED30006429) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of THO complex subunit 1 (SMED30006429) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for THO complex subunit 1 (SMED30006429) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006429SMESG000031324.1 SmedASXL_011471SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006429SMESG000031324.1 SmedASXL_011471SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006429SMESG000031324.1 dd_Smed_v4_2035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006429SMESG000031324.1 dd_Smed_v4_2035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006429SMESG000031324.1 dd_Smed_v4_2035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006429SMESG000031324.1 dd_Smed_v4_2035_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of THO complex subunit 1 vs. Ensembl Human
Match: THOC1 (THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070])

HSP 1 Score: 352.443 bits (903), Expect = 1.329e-111
Identity = 225/630 (35.71%), Postives = 337/630 (53.49%), Query Frame = 3
Query:  165 LNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTDETIPDENDLTS-AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            L+Q FR         I E+ + N  S   E V   + L+     + +   + PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ +  + DE   T+ +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK+RT+ T     +   KR         G        NEELTRLWN+CPDN+ AC+   R + P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP T              I+  A  +G+  K +   L+   +++  +   S+D K   K +L  W   +  +  +  N+I A ++ G++D+   +
Sbjct:   51 LDQAFRG--------ILEEEIINHSS--CENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPT--RIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KPVTGE-----------QIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATPENLINALNKSGLSDLAESL 649          
BLAST of THO complex subunit 1 vs. Ensembl Human
Match: THOC1 (THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070])

HSP 1 Score: 351.673 bits (901), Expect = 2.237e-111
Identity = 225/630 (35.71%), Postives = 336/630 (53.33%), Query Frame = 3
Query:  165 LNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTDETIPDENDLTS-AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            L+Q FR         I E+ + N  S   E V   + L+     + +   + PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ +  + DE   T+ +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK RT+ T     +   KR         G        NEELTRLWN+CPDN+ AC+   R + P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP T              I+  A  +G+  K +   L+   +++  +   S+D K   K +L  W   +  +  +  N+I A ++ G++D+   +
Sbjct:   51 LDQAFRG--------ILEEEIINHSS--CENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKDRTSDTKPT--RIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KPVTGE-----------QIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATPENLINALNKSGLSDLAESL 649          
BLAST of THO complex subunit 1 vs. Ensembl Human
Match: THOC1 (THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070])

HSP 1 Score: 230.335 bits (586), Expect = 1.171e-68
Identity = 136/338 (40.24%), Postives = 197/338 (58.28%), Query Frame = 3
Query:  165 LNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTDETIPDENDLTS-AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFAD 1157
            L+Q FR         I E+ + N  S   E V   + L+     + +   + PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ +  + DE   T+ +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE      + ++Q  S+  +P  +
Sbjct:   34 LDQAFRG--------ILEEEIINHSS--CENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTT---KSVYQVSSTRNKPMIE 356          
BLAST of THO complex subunit 1 vs. Ensembl Human
Match: THOC1 (THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070])

HSP 1 Score: 178.718 bits (452), Expect = 1.279e-50
Identity = 93/236 (39.41%), Postives = 136/236 (57.63%), Query Frame = 3
Query:  921 FTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKS-----GRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII 1613
            F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK+      +        R +R +         G        NEELTRLWN+CPDN+ AC+   R + P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++
Sbjct:   29 FAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKESVCFVHDRTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMV 264          
BLAST of THO complex subunit 1 vs. Ensembl Human
Match: THOC1 (THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070])

HSP 1 Score: 128.642 bits (322), Expect = 9.088e-33
Identity = 77/187 (41.18%), Postives = 109/187 (58.29%), Query Frame = 3
Query:  165 LNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTDETIPDENDLTSAI 707
            L+Q FR         I E+ + N  S   E V   + L+     + +   + PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ +  + DE   T+ I
Sbjct:   51 LDQAFRG--------ILEEEIINHSS--CENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTWI 227          
BLAST of THO complex subunit 1 vs. Ensembl Celegans
Match: thoc-1 (THO Complex (Transcription factor/nuclear export) subunit [Source:UniProtKB/TrEMBL;Acc:Q9N5E3])

HSP 1 Score: 241.121 bits (614), Expect = 6.287e-70
Identity = 156/455 (34.29%), Postives = 230/455 (50.55%), Query Frame = 3
Query:  252 EKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVE--LDDDSSIDLTDETIPD------ENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKAD----WSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFK--TQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNE------ELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHF 1556
            E  + +       S+  L ++  P     D+L   +I+ C+  FS +EE + + K      +++  +LR CNDLLRRLS++  T FCG+I  FLSR  PL EKSG+N MGHFNT N+T ++ES+T  E  L   SS     E   D      E D +  I+V    Y++FW LQ F  N    Y++ KF TF T +  VL   +  ++   S + E    +        S+ D+ FTKYLTS KL  LQL D +FRR  L+Q  + FQYL +  +FK   +  VL EDQ K++ + + +  +L          F   +  ++ RE   + WKN  C  F +K     +   +K               RQ + F+ N       ELT+LW   PD L AC+  KR + P L ++  +   E+DPE++VEE+Y+ IND  + W++ RLL  KS  +
Sbjct:   55 ELARRHFHFVMNCSKLGLCSKNTPLSTLQDLLEMSSIEECKQIFSIVEENMNEFKQPGFIETAQNNILRFCNDLLRRLSRTAETSFCGRIMFFLSRFLPLTEKSGVNFMGHFNTLNVTNYDESETDGEALLAATSSAPTPTEGAEDMETGEIEEDNSKEIQVTPEMYRQFWSLQKFMSNPNSIYEKEKFLTFKTDLTAVLTLMTSNKLEKLSSEEEEALENRQKKQQKGSSNDVFFTKYLTSPKLLALQLNDSSFRRYFLMQAIIIFQYLTAESRFKPPAKKMVLNEDQAKYVSECEDKCYRLLADTMPRGTAFVAGLKRIMLREQEWNTWKNANCADFSEKADKGAMQMYKK---------------RQRIPFNPNSLDLGTPELTKLWTNEPDVLKACKSDKRKFIPKLPDFIRDPIDEMDPEQQVEEQYKQINDSAFQWRAARLLMHKSPGY 494          
BLAST of THO complex subunit 1 vs. Ensembl Fly
Match: Hpr1 (gene:FBgn0037382 transcript:FBtr0078667)

HSP 1 Score: 318.161 bits (814), Expect = 2.213e-98
Identity = 208/639 (32.55%), Postives = 331/639 (51.80%), Query Frame = 3
Query:  243 KDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRV-NLDSCKNE-------ALKAD--------WSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVK-KRTALTLNALEKDCDKRKVRIKVDK---SGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNL---QPR--------SNEDEVG---NDVGEVQDQDSTTTTTRGEVDED----DSCSPKPETTANDIESMSIILL--HIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKA---MLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME 2030
            +D+ ++   ++LS E +R ++ +  +P VL  D  + +T+  C+  F F+E+ +   K+   F S +  +LR+CNDLLRRLS++QNTVFCG+IQ+FLS+ FP  E+SGLN++  FN +N T +       +  D+  ++ T E IP        +K++   Y KFW LQDFFRN  QCY++ ++  F    D +L  FS F++ ++    NE       A+  D         SS   A+  F K+LT+ KL  LQL D NFRR VLVQ  + FQYL   +KFK+  Q L  DQ  +I++ ++ + KL +      + F+  V+ +L+RE   +NWKNEGC  F K +   L+    +   +KR  R   D    + R    +  N+ LTRLWN  PDNL AC+  +RN+ P L  Y         P EKV+  ++        W++LRLL+R++ HF+T+ + P   I  YL  + K  +   +P+        S+E+  G   N+V    +QD+T     GE ++D    D+     E          +++   HI+E+A LIG+   +VG+ + F  ++L     ++ T N A   ML  W+    + T  + N     + + MN     +++ +E
Sbjct:   74 EDVSRIGELVRLSVEATRAEIVSNTIPVVLLIDTFDVVTLDKCQKIFQFVEDMVEVWKEEIFFSSCKNNILRMCNDLLRRLSRTQNTVFCGRIQLFLSKFFPFSERSGLNIVSEFNLDNFTEYGLDSKDHDESDNKELEDTAEDIP--------LKIDYDLYCKFWSLQDFFRNPNQCYNKPQWKMFQMHADNILQSFSSFKLEDVRQSSNENASGTDQAMDVDEEAVDTTAVSSVIKANHFFAKFLTNPKLLALQLSDANFRRAVLVQFLILFQYLQVSVKFKSDTQTLTADQADFIKETESRVYKLLEETPPYGKRFSRTVYHMLAREEMWNNWKNEGCKEFKKPEEPTLSEEDSKPTPNKRPRRPLGDALRDASRSGKFYLGNDNLTRLWNYSPDNLQACKSEQRNFLPLLETYLET------PHEKVDPAFE--------WRALRLLARQTPHFFTSLSQPSSKISDYLEQVRKRLIRDKEPKPAALLSNNSSENNFGLSVNNVHTEGEQDATVALQDGEPEQDLEVEDNEPVVEEVDEVPAHEKPLMVTKEHIEEVAPLIGEPWMKVGKKIGFTNDELLFFQMEHPTANVACVKMLTNWISDDDDAT--LENWAYMLEGLEMNKAAEAVKAIIE 688          
BLAST of THO complex subunit 1 vs. Ensembl Zebrafish
Match: thoc1 (THO complex 1 [Source:ZFIN;Acc:ZDB-GENE-030826-9])

HSP 1 Score: 348.977 bits (894), Expect = 1.569e-110
Identity = 211/575 (36.70%), Postives = 319/575 (55.48%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDD------DSSIDLTDETIPDEN-DLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNAD-MTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQ--PRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIV 2006
            PF+L  DVL+ L +  C+  FSF+EE +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN +N+T FN+++    L        +  +D+ +  + DE+    S+I ++   Y+KFW LQD+FRN VQCYD+  + TF    DE LA F  F+  LD  +    K +    S+ D + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+   VL +DQ  WIE     + +L + +  D + F  +V  +L+ E + ++WKNEGCPSFVK+R A T     +   KR+        G        N+ELTRLWN+ PDN+ AC+   R + P L ++F  A  + DP   VE++Y+ + +  + W++LRLLSR+S HF+       +S+  YL  ++    +  P+    EV    GE  D ++     +   D +DS S         I+S ++    +DEIA  +G   K + + L+ +  ++  +   S+D     K +L  W   +     ++ +++ A +  G N+I 
Sbjct:   93 PFLLLGDVLDCLPLDQCDKIFSFVEENVSTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLDNITVFNKNEQDSTLGQQHTEVKEEGMDVEEGEMGDEDAPAPSSIPIDYNLYRKFWTLQDYFRNPVQCYDKFSWMTFIKYSDEALAVFKSFK--LDDMQASKKKLEEMRTSSGDHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSSCVLNDDQSLWIEDTTKLVYQLLKEIPPDGDKFGSMVEHILNTEENWNSWKNEGCPSFVKERPAETKPI--RPSRKRQAPEDFLGKGPDRKILMGNDELTRLWNLNPDNMEACKSENREFMPSLEDFFEEAIEQADPANMVEDEYKVVRNSNYGWRALRLLSRRSPHFFQPTNQQFKSLADYLENMVIKLAKELPKDIPSEVIK-TGEEDDDENGDNLLK---DSNDSPS---------IQSKAVTNSQMDEIAAKLGSQWKTLADHLEMSDKEIRVIESDSEDVDLQAKMLLVAW-QDREGSQATMESLVTALNAAGFNNIA 649          
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Match: THOC1 (THO complex 1 protein [Source:NCBI gene;Acc:733546])

HSP 1 Score: 348.206 bits (892), Expect = 1.511e-110
Identity = 212/584 (36.30%), Postives = 317/584 (54.28%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN-------------ESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C+  F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN             E D G+E+++    ++ D+  P+    +S+I ++   Y+KFW LQDFFRN VQCYD++ + TF    DEVL  F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +LVQ  + FQYL   +KFK+ + +L ++Q  WIE     + +L        E F+  V  +L+ E + + WKNEGCPSFVK+R   T    +K   KR +  +    G        N+ELTRLWN+CPDN+ ACR   R + P L ++F  A  + DPE  V+ +Y+ +N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S          E++  D         + ++++ SP  E     + SMS     I+  A  +G+  K +   L     D+  +   ++D K   K +L  W   +     ++ N+I+A +  G+N++   I
Sbjct:   46 PFVLLGDVLDCLPLAYCDKIFTFVEKNVGTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNANEQESTLGQKVEEKDDGMEIEEG---EMGDDDAPN----SSSIPIDYNLYRKFWTLQDFFRNPVQCYDKNSWKTFLKFSDEVLTVFKSYK--LDDTQASRKKIEELKSGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILVQYLILFQYLKGQVKFKSSNYILLDEQSLWIEDTTKLVHQLLSETPPVGEKFSKTVEHILNTEENWNAWKNEGCPSFVKERPTET--KPQKMAKKRPLPEEFLGKGSNKKMSMGNDELTRLWNLCPDNMEACRSESREFMPSLEQFFEEAIEQADPENMVDNEYKVVNNANYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSE---------EIKTVDEDEDEDNESLLKENNESPA-EVQQQKL-SMSE---QIESFANKLGEHWKTLAPHLDMKEMDIKVIESDTEDAKMRAKLLLLAWQEREGGHA-NLENLISALNSAGLNELAESI 603          
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Match: THOC1 (THO complex 1 protein [Source:NCBI gene;Acc:733546])

HSP 1 Score: 348.206 bits (892), Expect = 2.738e-110
Identity = 212/584 (36.30%), Postives = 317/584 (54.28%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN-------------ESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C+  F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN             E D G+E+++    ++ D+  P+    +S+I ++   Y+KFW LQDFFRN VQCYD++ + TF    DEVL  F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +LVQ  + FQYL   +KFK+ + +L ++Q  WIE     + +L        E F+  V  +L+ E + + WKNEGCPSFVK+R   T    +K   KR +  +    G        N+ELTRLWN+CPDN+ ACR   R + P L ++F  A  + DPE  V+ +Y+ +N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S          E++  D         + ++++ SP  E     + SMS     I+  A  +G+  K +   L     D+  +   ++D K   K +L  W   +     ++ N+I+A +  G+N++   I
Sbjct:   68 PFVLLGDVLDCLPLAYCDKIFTFVEKNVGTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNANEQESTLGQKVEEKDDGMEIEEG---EMGDDDAPN----SSSIPIDYNLYRKFWTLQDFFRNPVQCYDKNSWKTFLKFSDEVLTVFKSYK--LDDTQASRKKIEELKSGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILVQYLILFQYLKGQVKFKSSNYILLDEQSLWIEDTTKLVHQLLSETPPVGEKFSKTVEHILNTEENWNAWKNEGCPSFVKERPTET--KPQKMAKKRPLPEEFLGKGSNKKMSMGNDELTRLWNLCPDNMEACRSESREFMPSLEQFFEEAIEQADPENMVDNEYKVVNNANYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSE---------EIKTVDEDEDEDNESLLKENNESPA-EVQQQKL-SMSE---QIESFANKLGEHWKTLAPHLDMKEMDIKVIESDTEDAKMRAKLLLLAW-QEREGGHANLENLISALNSAGLNELAESI 625          
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Match: THOC1 (THO complex 1 protein [Source:NCBI gene;Acc:733546])

HSP 1 Score: 348.206 bits (892), Expect = 3.654e-110
Identity = 212/584 (36.30%), Postives = 317/584 (54.28%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN-------------ESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C+  F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN             E D G+E+++    ++ D+  P+    +S+I ++   Y+KFW LQDFFRN VQCYD++ + TF    DEVL  F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +LVQ  + FQYL   +KFK+ + +L ++Q  WIE     + +L        E F+  V  +L+ E + + WKNEGCPSFVK+R   T    +K   KR +  +    G        N+ELTRLWN+CPDN+ ACR   R + P L ++F  A  + DPE  V+ +Y+ +N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S          E++  D         + ++++ SP  E     + SMS     I+  A  +G+  K +   L     D+  +   ++D K   K +L  W   +     ++ N+I+A +  G+N++   I
Sbjct:   81 PFVLLGDVLDCLPLAYCDKIFTFVEKNVGTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNANEQESTLGQKVEEKDDGMEIEEG---EMGDDDAPN----SSSIPIDYNLYRKFWTLQDFFRNPVQCYDKNSWKTFLKFSDEVLTVFKSYK--LDDTQASRKKIEELKSGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILVQYLILFQYLKGQVKFKSSNYILLDEQSLWIEDTTKLVHQLLSETPPVGEKFSKTVEHILNTEENWNAWKNEGCPSFVKERPTET--KPQKMAKKRPLPEEFLGKGSNKKMSMGNDELTRLWNLCPDNMEACRSESREFMPSLEQFFEEAIEQADPENMVDNEYKVVNNANYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSE---------EIKTVDEDEDEDNESLLKENNESPA-EVQQQKL-SMS---EQIESFANKLGEHWKTLAPHLDMKEMDIKVIESDTEDAKMRAKLLLLAWQEREGGHA-NLENLISALNSAGLNELAESI 638          
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Match: THOC1 (THO complex 1 protein [Source:NCBI gene;Acc:733546])

HSP 1 Score: 347.821 bits (891), Expect = 5.303e-110
Identity = 212/584 (36.30%), Postives = 317/584 (54.28%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN-------------ESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C+  F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN             E D G+E+++    ++ D+  P+    +S+I ++   Y+KFW LQDFFRN VQCYD++ + TF    DEVL  F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +LVQ  + FQYL   +KFK+ + +L ++Q  WIE     + +L        E F+  V  +L+ E + + WKNEGCPSFVK+R   T    +K   KR +  +    G        N+ELTRLWN+CPDN+ ACR   R + P L ++F  A  + DPE  V+ +Y+ +N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S          E++  D         + ++++ SP  E     + SMS     I+  A  +G+  K +   L     D+  +   ++D K   K +L  W   +     ++ N+I+A +  G+N++   I
Sbjct:   83 PFVLLGDVLDCLPLAYCDKIFTFVEKNVGTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNANEQESTLGQKVEEKDDGMEIEEG---EMGDDDAPN----SSSIPIDYNLYRKFWTLQDFFRNPVQCYDKNSWKTFLKFSDEVLTVFKSYK--LDDTQASRKKIEELKSGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILVQYLILFQYLKGQVKFKSSNYILLDEQSLWIEDTTKLVHQLLSETPPVGEKFSKTVEHILNTEENWNAWKNEGCPSFVKERPTET--KPQKMAKKRPLPEEFLGKGSNKKMSMGNDELTRLWNLCPDNMEACRSESREFMPSLEQFFEEAIEQADPENMVDNEYKVVNNANYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSE---------EIKTVDEDEDEDNESLLKENNESPA-EVQQQKL-SMS---EQIESFANKLGEHWKTLAPHLDMKEMDIKVIESDTEDAKMRAKLLLLAW-QEREGGHANLENLISALNSAGLNELAESI 640          
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Match: THOC1 (THO complex 1 protein [Source:NCBI gene;Acc:733546])

HSP 1 Score: 348.206 bits (892), Expect = 6.605e-110
Identity = 212/584 (36.30%), Postives = 317/584 (54.28%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN-------------ESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C+  F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN             E D G+E+++    ++ D+  P+    +S+I ++   Y+KFW LQDFFRN VQCYD++ + TF    DEVL  F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +LVQ  + FQYL   +KFK+ + +L ++Q  WIE     + +L        E F+  V  +L+ E + + WKNEGCPSFVK+R   T    +K   KR +  +    G        N+ELTRLWN+CPDN+ ACR   R + P L ++F  A  + DPE  V+ +Y+ +N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S          E++  D         + ++++ SP  E     + SMS     I+  A  +G+  K +   L     D+  +   ++D K   K +L  W   +     ++ N+I+A +  G+N++   I
Sbjct:  106 PFVLLGDVLDCLPLAYCDKIFTFVEKNVGTWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNANEQESTLGQKVEEKDDGMEIEEG---EMGDDDAPN----SSSIPIDYNLYRKFWTLQDFFRNPVQCYDKNSWKTFLKFSDEVLTVFKSYK--LDDTQASRKKIEELKSGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILVQYLILFQYLKGQVKFKSSNYILLDEQSLWIEDTTKLVHQLLSETPPVGEKFSKTVEHILNTEENWNAWKNEGCPSFVKERPTET--KPQKMAKKRPLPEEFLGKGSNKKMSMGNDELTRLWNLCPDNMEACRSESREFMPSLEQFFEEAIEQADPENMVDNEYKVVNNANYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSE---------EIKTVDEDEDEDNESLLKENNESPA-EVQQQKL-SMS---EQIESFANKLGEHWKTLAPHLDMKEMDIKVIESDTEDAKMRAKLLLLAWQEREGGHA-NLENLISALNSAGLNELAESI 663          
BLAST of THO complex subunit 1 vs. Ensembl Mouse
Match: Thoc1 (THO complex 1 [Source:MGI Symbol;Acc:MGI:1919668])

HSP 1 Score: 356.681 bits (914), Expect = 2.282e-113
Identity = 218/578 (37.72%), Postives = 318/578 (55.02%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTD-ETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ + E   DE   T +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK+R + T     +   KR         G        NEELTRLWN+CPDN+ AC+   R Y P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP  T   IES           A  +G+  K +   L+   +D+  +   S+D K   K +L  W   +  +  +  N+I+A ++ G++D+   +
Sbjct:   93 PFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERASDTKPT--RVVRKRAAPEDFLGKGPNKKILIGNEELTRLWNLCPDNMEACKSETREYMPTLEEFFEEAIEQADPENMVESEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KP-ITGEQIES----------FANKLGEQWKILAPYLEIKDSDIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATTDNLISALNKSGLSDLAESL 649          
BLAST of THO complex subunit 1 vs. Ensembl Mouse
Match: Thoc1 (THO complex 1 [Source:MGI Symbol;Acc:MGI:1919668])

HSP 1 Score: 105.916 bits (263), Expect = 5.346e-24
Identity = 57/137 (41.61%), Postives = 80/137 (58.39%), Query Frame = 3
Query:  639 DDDSSIDLTD-ETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFK 1046
            D +  +D+ + E   DE   T +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK
Sbjct:    4 DREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFK 138          

HSP 2 Score: 70.0922 bits (170), Expect = 3.146e-12
Identity = 59/216 (27.31%), Postives = 98/216 (45.37%), Query Frame = 3
Query: 1377 NLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIV 2006
            NL       R Y P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP  T   IES           A  +G+  K +   L+   +D+  +   S+D K   K +L  W   +  +  +  N+I+A ++ G++D+ 
Sbjct:  176 NLTVYFTMTREYMPTLEEFFEEAIEQADPENMVESEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KP-ITGEQIES----------FANKLGEQWKILAPYLEIKDSDIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATTDNLISALNKSGLSDLA 374          
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q8R3N6|THOC1_MOUSE (THO complex subunit 1 OS=Mus musculus OX=10090 GN=Thoc1 PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.596e-112
Identity = 218/578 (37.72%), Postives = 318/578 (55.02%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTD-ETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ + E   DE   T +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK+R + T     +   KR         G        NEELTRLWN+CPDN+ AC+   R Y P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP  T   IES           A  +G+  K +   L+   +D+  +   S+D K   K +L  W   +  +  +  N+I+A ++ G++D+   +
Sbjct:   93 PFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDDEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERASDTKPT--RVVRKRAAPEDFLGKGPNKKILIGNEELTRLWNLCPDNMEACKSETREYMPTLEEFFEEAIEQADPENMVESEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KP-ITGEQIES----------FANKLGEQWKILAPYLEIKDSDIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATTDNLISALNKSGLSDLAESL 649          
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q96FV9|THOC1_HUMAN (THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1)

HSP 1 Score: 352.443 bits (903), Expect = 6.383e-111
Identity = 225/630 (35.71%), Postives = 337/630 (53.49%), Query Frame = 3
Query:  165 LNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFN----ESDTGVELDDD--SSIDLTDETIPDENDLTS-AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            L+Q FR         I E+ + N  S   E V   + L+     + +   + PFVL  DVL+ L +  C++ F+F+E+ +   K  + + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN    ES  G +  +D    +D+ +  + DE   T+ +I ++   Y+KFW LQD+FRN VQCY++  + TF    +EVLA F  ++  LD  +    K +        + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL ++Q  WIE     + +L      D E F+ +V  +L+ E + ++WKNEGCPSFVK+RT+ T     +   KR         G        NEELTRLWN+CPDN+ AC+   R + P L E+F  A  + DPE  VE +Y+++N+  + W++LRLL+R+S HF+       +S+  YL  ++      L P S E + G D  E  +          +V  D     KP T              I+  A  +G+  K +   L+   +++  +   S+D K   K +L  W   +  +  +  N+I A ++ G++D+   +
Sbjct:   51 LDQAFRG--------ILEEEIINHSS--CENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYK--LDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPT--RIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRD-----KPVTGE-----------QIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAW-QDQEGVHATPENLINALNKSGLSDLAESL 649          
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q93VM9|THOC1_ARATH (THO complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=THO1 PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.755e-53
Identity = 147/523 (28.11%), Postives = 246/523 (47.04%), Query Frame = 3
Query:  255 KVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDES-KFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLK-WIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRT-ALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTN---PGQSIKSYLTTIIKHNLQPRSNE---------------DEVGNDVGEVQDQDSTTTTTRGEVD--EDDSCS--PKPE 1748
            ++ + L +   L  K+     + F L  D+    T++ C+  F ++E     L    +F   + ++LR CN LLRRLSK+ + VFCG+I +FL+  FPL E+S +N+ G FNT N T +                        E D    I V+  FYK FW LQ++F N       S K+  FS+S+  VL  F    ++ +  +  +L+ + ++F+       KYLTS KL  L+L D +FRR +L+Q  + F YL +P K    D+ L  + +K  ++  +  ++KL +      + F   V  +L RE +   WK +GCP F K+     + NA +K   KR+ R ++            N+EL++LW     N  A  D++R   PD+ +Y+     ++DP   +E++Y   N+  +CW+ LR  +R+    ++ +T     G      L   ++   Q + NE               +  GN +G V + ++     RG+ +  E D+ +  P PE
Sbjct:   83 QIPHLLDVVLYLCEKEHVEGGMIFQLLEDLTEMSTMKNCKDVFGYIESKQDILGKQELFARGKLVMLRTCNQLLRRLSKANDVVFCGRILMFLAHFFPLSERSAVNIKGVFNTSNETKY------------------------EKDPPKGISVDFNFYKTFWSLQEYFCNPASLTSASTKWQKFSSSLAVVLNTFDAQPLSEEEGEANSLEEEAATFN------IKYLTSSKLMGLELKDSSFRRHILLQCLIMFDYLRAPGK---NDKDLPSETMKEELKSCEDRVKKLLEITPPKGKEFLRAVEHILEREKNWVWWKRDGCPPFEKQPIDKKSPNAGQK---KRRQRWRLG-----------NKELSQLWRWADQNPNALTDSQRVRTPDIADYWKPLAEDMDPSAGIEDEYHHKNNRVYCWKGLRFTARQDLEGFSRFTEMGIEGVVPVELLPPEVRSKYQAKPNEKAKRAKKEETKGGSHETEGNQIG-VSNSEAEAEGGRGDAETMESDAIADTPTPE 557          
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Match: sp|Q9URT2|YJU3_SCHPO (Uncharacterized protein P25A2.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCP25A2.03 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 3.345e-23
Identity = 92/332 (27.71%), Postives = 145/332 (43.67%), Query Frame = 3
Query:  309 NQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVN--LDSCKNEALKADWSS-----FSNADMTF-TKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLK---------------EDQLKWIEKQQAELEKLFQA-LSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVK 1232
            +  LPF++  ++++  T+  C   + + E     +K          +LLRI N+LLRRLS+ +N+ FCG+I I LS+ FP +E+SG NL G +NT +      S   VEL   S+       I D  DL+   K+N   +  +W LQ    N  +         F  +    +  F     N   +   N  +  + SS     +   D  F +KY+ S  LF+ QL D +FR   ++QL + F +L+   K + + + L+               ED  K  E  +     L  A   S +    +I+H+    E +   WK  GCPS  K
Sbjct:   98 DHLLPFLILEELMDIHTVNECAKLYEYFETRPSLMKGIVSNRGRGPVLLRISNELLRRLSRQENSSFCGRIDILLSKAFPPEERSGANLRGDYNTVH------SFGKVELSPPST------PISDRTDLSYHKKLNT-LFTAYWDLQCMCSNPPKLLASDTLPKFIDAAGSAIQAFESILQNTFFNGKSNPTIDPNSSSLLSEKYITLDKGFPSKYIYSRSLFEYQLSDEDFRLQAILQLIIIFDFLLDHSKERIERRTLEKWTNKAVIPIVILSDEDTSKLNELSKEAYSFLHTARCGSVQRTIKEIIHI----EGNWKLWKGLGCPSLEK 412          
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Match: sp|P59924|THOC1_RAT (THO complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Thoc1 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.079e-18
Identity = 67/232 (28.88%), Postives = 111/232 (47.84%), Query Frame = 3
Query: 1338 NEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKI 2015
            NEELTRLWN+CPDN+ AC+   R Y P L E+F  A  + D E  VE +Y++IN+  + W +LR L+ +S HF+       +++  YL  ++      L P S E + G D  E  +          +V +D     KP  T   IES++            + +  K +   L+   +D+  +   S+D K   K +L  W   +  +  +  N+I A ++ G++D+   +
Sbjct:  113 NEELTRLWNLCPDNMEACKLETREYMPILEEFFEEAIEQADAENMVESEYKAINNSNYGWSTLRFLAWRSPHFFQPTNQQFKNMTEYLENMVIKLAKELPPHSEEIKTGEDEDEEDNDALLKENESPDVRQD-----KP-ITGERIESLT----------NKLDEQWKILAPYLEIKDSDIRQIECYSEDMKKRAKQLLVAW-KDQEGVHETTDNLIGALNKSGLSDLAESL 327          
BLAST of THO complex subunit 1 vs. TrEMBL
Match: A0A4S2MBK8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002538 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 3.273e-148
Identity = 232/508 (45.67%), Postives = 327/508 (64.37%), Query Frame = 3
Query:  174 QFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTS---AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDR-------EPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVG 1667
            Q +D K V+D   R ++L  L S  +++VK+ LK+    +  ++ +   PF+LFSDV N+  I  C+  F FMEE I  LKD  +F S R  LLR+CNDLLRRLSKSQNTVFCG+IQ+FLSRLFPLDEKSGLNLM +FN +  TP+N++          S+D + E  PDE +  +   +++V+   Y KFW LQDFF+    CYD++K+ TF ++++ VL  FS  ++   S  NE   ++ S  S     F+KYLTSEKL DLQLMD +FRR ++VQ+ V FQYL++P KFKT DQVL E+Q +W+ +++   E +   LS +R       + FA  +  +L RE+H ++WKNEGCPSFV+      +     +  KR+    +D++G ++  F  N+ L +LWN+CPDNL ACRD +R + P+L  YF +A  ELDP EKVEE+Y+SIN E+WCW+SLR L+R+S HFY NW  PG+ + +YLTTI+   +Q   + + V  D G
Sbjct:   31 QLKDTKPVIDVAFRSRMLELLSSHSLDEVKSLLKVGVAAALANICSAPTPFLLFSDVFNTKPISVCQELFGFMEETITTLKDVPLFASGRNTLLRMCNDLLRRLSKSQNTVFCGQIQLFLSRLFPLDEKSGLNLMSNFNLDKETPYNKTPDPSVFKHQLSMDSSTED-PDEGETAAHPKSLEVDANLYVKFWSLQDFFKVPTSCYDKAKWVTFRSNIETVLEIFSSIKL---SGSNEGDASNTSGSSK----FSKYLTSEKLLDLQLMDSSFRRYIMVQILVVFQYLITPTKFKTPDQVLSEEQTEWLNRKR---ELILSLLSGNRKTDSQHTDSFASTIGRILERETHWNSWKNEGCPSFVRPPEKSPV-----ETRKRRTNPLIDRAGAKIYRFG-NKNLDKLWNVCPDNLAACRDERRLFRPNLQSYFQDAILELDPAEKVEEEYKSINKEEWCWRSLRCLARRSPHFYINWNPPGKPVTAYLTTILTEKMQAEYSTEPVDYDPG 521          
BLAST of THO complex subunit 1 vs. TrEMBL
Match: A0A4S2M5L2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002538 PE=4 SV=1)

HSP 1 Score: 454.521 bits (1168), Expect = 3.290e-148
Identity = 234/510 (45.88%), Postives = 329/510 (64.51%), Query Frame = 3
Query:  174 QFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTS---AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDR-------EPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEV 1673
            Q +D K V+D   R ++L  L S  +++VK+ LK+    +  ++ +   PF+LFSDV N+  I  C+  F FMEE I  LKD  +F S R  LLR+CNDLLRRLSKSQNTVFCG+IQ+FLSRLFPLDEKSGLNLM +FN +  TP+N++          S+D + E  PDE +  +   +++V+   Y KFW LQDFF+    CYD++K+ TF ++++ VL  FS  ++   S  NE   ++ S  S     F+KYLTSEKL DLQLMD +FRR ++VQ+ V FQYL++P KFKT DQVL E+Q +W+ +++   E +   LS +R       + FA  +  +L RE+H ++WKNEGCPSFV+      +     +  KR+    +D++G ++  F  N+ L +LWN+CPDNL ACRD +R + P+L  YF +A  ELDP EKVEE+Y+SIN E+WCW+SLR L+R+S HFY NW  PG+ + +YLTTI+   +Q  + ED+ G    EV
Sbjct:   31 QLKDTKPVIDVAFRSRMLELLSSHSLDEVKSLLKVGVAAALANICSAPTPFLLFSDVFNTKPISVCQELFGFMEETITTLKDVPLFASGRNTLLRMCNDLLRRLSKSQNTVFCGQIQLFLSRLFPLDEKSGLNLMSNFNLDKETPYNKTPDPSVFKHQLSMDSSTED-PDEGETAAHPKSLEVDANLYVKFWSLQDFFKVPTSCYDKAKWVTFRSNIETVLEIFSSIKL---SGSNEGDASNTSGSSK----FSKYLTSEKLLDLQLMDSSFRRYIMVQILVVFQYLITPTKFKTPDQVLSEEQTEWLNRKR---ELILSLLSGNRKTDSQHTDSFASTIGRILERETHWNSWKNEGCPSFVRPPEKSPV-----ETRKRRTNPLIDRAGAKIYRFG-NKNLDKLWNVCPDNLAACRDERRLFRPNLQSYFQDAILELDPAEKVEEEYKSINKEEWCWRSLRCLARRSPHFYINWNPPGKPVTAYLTTILTEKMQ--AEEDKKGAHPTEV 521          
BLAST of THO complex subunit 1 vs. TrEMBL
Match: A0A4S2MA21 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002538 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 3.604e-148
Identity = 232/508 (45.67%), Postives = 327/508 (64.37%), Query Frame = 3
Query:  174 QFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTS---AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDR-------EPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVG 1667
            Q +D K V+D   R ++L  L S  +++VK+ LK+    +  ++ +   PF+LFSDV N+  I  C+  F FMEE I  LKD  +F S R  LLR+CNDLLRRLSKSQNTVFCG+IQ+FLSRLFPLDEKSGLNLM +FN +  TP+N++          S+D + E  PDE +  +   +++V+   Y KFW LQDFF+    CYD++K+ TF ++++ VL  FS  ++   S  NE   ++ S  S     F+KYLTSEKL DLQLMD +FRR ++VQ+ V FQYL++P KFKT DQVL E+Q +W+ +++   E +   LS +R       + FA  +  +L RE+H ++WKNEGCPSFV+      +     +  KR+    +D++G ++  F  N+ L +LWN+CPDNL ACRD +R + P+L  YF +A  ELDP EKVEE+Y+SIN E+WCW+SLR L+R+S HFY NW  PG+ + +YLTTI+   +Q   + + V  D G
Sbjct:   31 QLKDTKPVIDVAFRSRMLELLSSHSLDEVKSLLKVGVAAALANICSAPTPFLLFSDVFNTKPISVCQELFGFMEETITTLKDVPLFASGRNTLLRMCNDLLRRLSKSQNTVFCGQIQLFLSRLFPLDEKSGLNLMSNFNLDKETPYNKTPDPSVFKHQLSMDSSTED-PDEGETAAHPKSLEVDANLYVKFWSLQDFFKVPTSCYDKAKWVTFRSNIETVLEIFSSIKL---SGSNEGDASNTSGSSK----FSKYLTSEKLLDLQLMDSSFRRYIMVQILVVFQYLITPTKFKTPDQVLSEEQTEWLNRKR---ELILSLLSGNRKTDSQHTDSFASTIGRILERETHWNSWKNEGCPSFVRPPEKSPV-----ETRKRRTNPLIDRAGAKIYRFG-NKNLDKLWNVCPDNLAACRDERRLFRPNLQSYFQDAILELDPAEKVEEEYKSINKEEWCWRSLRCLARRSPHFYINWNPPGKPVTAYLTTILTEKMQAEYSTEPVDYDPG 521          
BLAST of THO complex subunit 1 vs. TrEMBL
Match: A0A4S2M5I9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002538 PE=4 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.803e-147
Identity = 232/508 (45.67%), Postives = 327/508 (64.37%), Query Frame = 3
Query:  174 QFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTS---AIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDR-------EPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVG 1667
            Q +D K V+D   R ++L  L S  +++VK+ LK+    +  ++ +   PF+LFSDV N+  I  C+  F FMEE I  LKD  +F S R  LLR+CNDLLRRLSKSQNTVFCG+IQ+FLSRLFPLDEKSGLNLM +FN +  TP+N++          S+D + E  PDE +  +   +++V+   Y KFW LQDFF+    CYD++K+ TF ++++ VL  FS  ++   S  NE   ++ S  S     F+KYLTSEKL DLQLMD +FRR ++VQ+ V FQYL++P KFKT DQVL E+Q +W+ +++   E +   LS +R       + FA  +  +L RE+H ++WKNEGCPSFV+      +     +  KR+    +D++G ++  F  N+ L +LWN+CPDNL ACRD +R + P+L  YF +A  ELDP EKVEE+Y+SIN E+WCW+SLR L+R+S HFY NW  PG+ + +YLTTI+   +Q   + + V  D G
Sbjct:   91 QLKDTKPVIDVAFRSRMLELLSSHSLDEVKSLLKVGVAAALANICSAPTPFLLFSDVFNTKPISVCQELFGFMEETITTLKDVPLFASGRNTLLRMCNDLLRRLSKSQNTVFCGQIQLFLSRLFPLDEKSGLNLMSNFNLDKETPYNKTPDPSVFKHQLSMDSSTED-PDEGETAAHPKSLEVDANLYVKFWSLQDFFKVPTSCYDKAKWVTFRSNIETVLEIFSSIKL---SGSNEGDASNTSGSSK----FSKYLTSEKLLDLQLMDSSFRRYIMVQILVVFQYLITPTKFKTPDQVLSEEQTEWLNRKR---ELILSLLSGNRKTDSQHTDSFASTIGRILERETHWNSWKNEGCPSFVRPPEKSPV-----ETRKRRTNPLIDRAGAKIYRFG-NKNLDKLWNVCPDNLAACRDERRLFRPNLQSYFQDAILELDPAEKVEEEYKSINKEEWCWRSLRCLARRSPHFYINWNPPGKPVTAYLTTILTEKMQAEYSTEPVDYDPG 581          
BLAST of THO complex subunit 1 vs. TrEMBL
Match: A0A3Q0KRB2 (Putative nuclear matrix protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 3.706e-140
Identity = 231/518 (44.59%), Postives = 325/518 (62.74%), Query Frame = 3
Query:  174 QFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLT---SAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDRE---PFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVG-----NDVGEVQDQDSTT 1694
            + +D KS++D  +R ++L  L S  ++ VK  LK+    +  +L +   PF+LF+DV N+  I  CE  F FMEE I+ LKD  +F S R  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPLDEKSGLN M +FN+E    +N++          S D T + + +E ++T   + ++V+ G Y KFW LQ+FF++   CY+++K+  F++S D VL  FS       S K  A++       ++  TF+KYLTSEKL DLQLMDP+FRR ++VQL + FQYL + +KFKT DQVL EDQ  W+ ++   + +L  + S +      F   V  +L RES+ + WKN+GCPSF++      L+       KR +   V ++G++V  F  N EL +LWN+CPDNL ACRD +R +NPDL  YF +A  E+DP EKVEE+Y+SIN ++W W++LR LSRK  HFY NW  PG+ +K YL+ I+   +Q  S ED+ G     ND    +  D TT
Sbjct:   38 ELKDKKSLIDVALRGRMLRLLASDSMDDVKTLLKMGVAAALANLCSAPTPFLLFADVFNTKPISLCEEMFGFMEETIITLKDVPLFASGRNTLLRMCNDLLRRLSKSQNTVFCGQIQLFLTRLFPLDEKSGLNFMSNFNSEKDILYNKNPDPSAFKHQVSHDHTSDDL-EEGEMTDSSTPLEVDAGLYVKFWSLQEFFKSPALCYEKAKWLRFTSSTDTVLDVFS-------SIKLMAIEEGDICSQSSSGTFSKYLTSEKLLDLQLMDPSFRRYIIVQLLILFQYLTTTVKFKTIDQVLSEDQRSWVNQRHEVVLRLLSSNSPNNSSGGTFVSTVERILERESYWNRWKNDGCPSFIRTPEKSRLSV-----RKRHINPLVTRTGQKVYRFG-NRELDKLWNVCPDNLAACRDKRRVFNPDLHSYFQDAIMEMDPAEKVEEEYKSINKDEWSWRALRFLSRKCPHFYINWNPPGRPVKDYLSVILTEKIQ--SEEDKKGSTNNVNDCDNRRGSDGTT 539          
BLAST of THO complex subunit 1 vs. Ensembl Cavefish
Match: thoc1 (THO complex 1 [Source:ZFIN;Acc:ZDB-GENE-030826-9])

HSP 1 Score: 331.257 bits (848), Expect = 3.138e-104
Identity = 203/576 (35.24%), Postives = 309/576 (53.65%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTI-QTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSS------IDLTDETIPDEN-DLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTII---KHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIV 2006
            PF+L  DVL+ L + Q  +S  S+           S + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN +N+T FN+++    L   SS      +++ +  + DE+     +I ++   Y+KFW LQD+FRN VQCYD+  + TF    DE LA F  ++++        L+ +  +     + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+ + VL +DQ  W+E     + +L +    D + FA +V  +L+ E + ++WKNEGCPSFVK+R A T         KR         G +      NEELTRLWN+ PDN+ AC+   R + P L ++F  A  + DP   VE++Y+ + +  + W++LRLLSR+S HF+       +S+  YL  ++      L      +E+    GE +D++  +    G          KP T +            +DEIA  +GDG + + + ++  A+++  +   S+D     K +L  W   + N   ++ ++I A +  G   I 
Sbjct:   48 PFLLLGDVLDCLPLDQLLKSSPSWRRMFPRGNLCNSFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLDNITVFNKNEQESTLGQQSSEVKEDGMEVEEGEMGDEDAPAPCSIPIDYNLYRKFWTLQDYFRNPVQCYDKFSWMTFVKFSDETLAVFKSYKLDDTQASKRKLE-EMRTAGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLRGQVKFKSSNCVLNDDQTAWMEDTTKLVYQLLRETPPDGDKFAGMVEHILNTEENWNSWKNEGCPSFVKERPAET-KPTRPSSRKRAAPEDFLGKGPERKILMGNEELTRLWNLNPDNMEACKSDSREFMPSLEDFFEEAIEQADPANMVEDEYKVVRNSNYGWRALRLLSRRSPHFFQPTNQQFKSLDEYLENMVIKLAKELPKDLPSEEI--KTGEEEDENGVSLLKTGSDSLQAGLQNKPVTNS-----------QMDEIAGKLGDGWRLLADQMEMKASEVREIESDSEDVDLQAKMLLVAWQDREGNQA-TMESLITALNAAGFTAIA 607          
BLAST of THO complex subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004034.1 (pep scaffold:Pmarinus_7.0:GL480061:43190:47873:1 gene:ENSPMAG00000003689.1 transcript:ENSPMAT00000004034.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 3.035e-22
Identity = 59/164 (35.98%), Postives = 100/164 (60.98%), Query Frame = 3
Query:   81 KPNSNIQSISTELESAKDLKYKL--CEI*CLNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSG 566
            +P S++ S ++  ES K+    +       LN    + +S +D  + ++++  ++  D + V   + LS +     + + + PF+L  D+L+ L +  C+  F+F+E+ +   K ++ + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSG
Sbjct:   12 RPQSSLPSQTSAWESLKNKSTDVIVAAFGQLNGSELEKRSALDQAVLKELI--VRQSDCKDVLAVISLSIDSVTAGVCSASTPFLLLGDLLDGLPLDQCDHIFTFVEQNVGTWKASTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSG 173          
BLAST of THO complex subunit 1 vs. Ensembl Nematostella
Match: EDO31333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY90])

HSP 1 Score: 160.999 bits (406), Expect = 3.922e-43
Identity = 92/218 (42.20%), Postives = 131/218 (60.09%), Query Frame = 3
Query:  168 NQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDE 821
            +Q FRDL       ++E +L     +D+E  K+ + L+ + +     +  LP +L SDV +++T+  C+S F+F+EE +        F S + LLLR+CNDLLRRLS SQNTVFCG+IQ+FL+RLFPL EKSGLNLM  FN +N+T    + T  E D  + ++  D T   E   ++   V+   Y+KFW LQD+FRN  QCY    + TFS  + E
Sbjct:   50 DQSFRDL-------VKESLL---SDEDVETQKHLITLAIKAAAHGTCSTTLPVILLSDVFDTITLDRCDSLFTFVEEQVSTWTMPIFFSSGKNLLLRMCNDLLRRLSASQNTVFCGRIQLFLARLFPLSEKSGLNLMSQFNLDNVT--TYATTTEEEDSVNDMETGDGTEAGELVQSNLTPVDYNLYRKFWALQDYFRNPTQCYTTVGWKTFSKHILE 255          

HSP 2 Score: 105.531 bits (262), Expect = 3.458e-24
Identity = 56/160 (35.00%), Postives = 93/160 (58.13%), Query Frame = 3
Query: 1170 VLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNE-------ELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQ 1628
            +L RE +  +WKNEGC SF+K++     + ++     ++ R K    G ++ +  +++       ELTRLWN+C DNL AC   KR + P L E+F  A  + DP+  VE++Y+ I    + W++LRLL+R+SQHF+   +NP + +  YL +++    Q
Sbjct:  253 ILEREENWISWKNEGCLSFIKEKEKEAHDVVKGPKAPKRKRTK--SIGEEINAEWQSKKLQMGSSELTRLWNLCSDNLEACSAEKRVFLPSLEEFFEEAIEQADPDGMVEDEYKLIKKSNFGWRALRLLARRSQHFFQPSSNPFKPLPDYLESVVSQLAQ 410          
BLAST of THO complex subunit 1 vs. Ensembl Medaka
Match: thoc1 (THO complex 1 [Source:NCBI gene;Acc:101157731])

HSP 1 Score: 343.584 bits (880), Expect = 1.645e-108
Identity = 210/592 (35.47%), Postives = 323/592 (54.56%), Query Frame = 3
Query:  270 LKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSS-------IDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNAD-MTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVG--EVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIV 2006
            + LS +   + + +   PFVL  DVL+ L +  C+  FSF+EE +   K  S + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN+++    L   S+            E   ++    S+I ++   Y+KFW LQD+FRN VQCYD+  + TF    DE LA F  ++  LD  +    K D    S+ + + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+   VL +DQ  WIE+    + +L + +  D + FA +V  +L  E + ++WKNEGCPSFVK+RT    +  ++   KR+        G     F  N+ELTRLWN+  DN+ AC+   R + P L E+F  A  + DP   VE++Y+ + +  + W++LRLLSR+S HF+       +S+  YL +++    +      E+  D+   E++  +         + ++ + SP        I+S ++    +D+IA  +G   K +   L+  A +L  +   S+D +   K +L  W   +     ++ +++ A +  G + I 
Sbjct:   75 IYLSIDAVTEGICSATTPFVLLGDVLDCLPLDLCDKIFSFVEENVSTWKSNSFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNKNELESTLGQKSTNEKEEGMEVEEGEMGEEDAPAQSSIPIDYNLYRKFWTLQDYFRNPVQCYDKFLWMTFLKFSDETLAVFKSYK--LDDMQASKRKLDELRGSDGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSSCVLNDDQTTWIEETTKLVYQLLKEIPPDGDKFASMVEHILDTEENWNSWKNEGCPSFVKERT--VDDKPKRPTRKRQAPEDFLGKGPDRKIFMGNDELTRLWNLNSDNMEACKSDSREFMPSLDEFFAEAIEQADPVNMVEDEYKVVRNPNYGWRALRLLSRRSPHFFQPTNQKFKSLADYLDSMVSKLAK------ELPKDIPSEEIKTGEEDDDDNGDNLLKESNDSPS-------IQSKAVTNQQMDDIAAKLGARWKMLASHLEMKAAELREIETDSEDVEMQAKLLLVAW-QDREGTQATVESLVTALNAAGFSQIA 648          
BLAST of THO complex subunit 1 vs. Ensembl Medaka
Match: thoc1 (THO complex 1 [Source:NCBI gene;Acc:101157731])

HSP 1 Score: 342.043 bits (876), Expect = 4.434e-108
Identity = 206/573 (35.95%), Postives = 317/573 (55.32%), Query Frame = 3
Query:  321 PFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSS-------IDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNAD-MTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANL---SDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIV 2006
            PFVL  DVL+ L +  C+  FSF+EE +   K  S + + +  LLR+CNDLLRRLSKSQNTVFCG+IQ+FL+RLFPL EKSGLNL   FN EN+T FN+++    L   S+            E   ++    S+I ++   Y+KFW LQD+FRN VQCYD+  + TF    DE LA F  ++  LD  +    K D    S+ + + F K+LTSEKL DLQL D NFRR +L+Q  + FQYL   +KFK+   VL +DQ  WIE+    + +L + +  D + FA +V  +L  E + ++WKNEGCPSFVK+RT    +  ++   KR+        G     F  N+ELTRLWN+  DN+ AC+   R++ P L E+F  A  + DP   VE++Y+ + +  + W++LRLLSR+S HF+       +S+  YL +++           ++  ++ ++  ++    T   + D++     K    +  I+S ++    +D+IA  +G   K +   L+  A +L  +   S+D +   K +L  W   +     ++ +++ A +  G + I 
Sbjct:   86 PFVLLGDVLDCLPLDLCDKIFSFVEENVSTWKSNSFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNKNELESTLGQKSTNEKEEGMEVEEGEMGEEDAPAQSSIPIDYNLYRKFWTLQDYFRNPVQCYDKFLWMTFLKFSDETLAVFKSYK--LDDMQASKRKLDELRGSDGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSSCVLNDDQTTWIEETTKLVYQLLKEIPPDGDKFASMVEHILDTEENWNSWKNEGCPSFVKERT--VDDKPKRPTRKRQAPEDFLGKGPDRKIFMGNDELTRLWNLNSDNMEACKSDSRSFMPSLDEFFAEAIEQADPVNMVEDEYKVVRNPNYGWRALRLLSRRSPHFFQPTNQKFKSLADYLDSMV----------SKLAKELPDIPSEE--IKTGEEDDDDNGDNLLKESNDSPSIQSKAVTNQQMDDIAAKLGARWKMLASHLEMKAAELREIETDSEDVEMQAKLLLVAW-QDREGTQATVESLVTALNAAGFSQIA 641          
BLAST of THO complex subunit 1 vs. Planmine SMEST
Match: SMESG000031324.1 (SMESG000031324.1)

HSP 1 Score: 1328.15 bits (3436), Expect = 0.000e+0
Identity = 656/670 (97.91%), Postives = 656/670 (97.91%), Query Frame = 3
Query:   21 MNDLFSDKSKVFCKIKDIILKPNSNIQSISTELESAKDLKYKLCEI*CLNQQFRDLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME 2030
            MNDLFSDKSKVFCKIKDIILKPNSNIQSISTELESAKDLK              DLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME
Sbjct:    1 MNDLFSDKSKVFCKIKDIILKPNSNIQSISTELESAKDLK--------------DLKSVVDFLIREQVLFNLKSKDIEKVKNYLKLSAELSRKDLSNQALPFVLFSDVLNSLTIQTCESFFSFMEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME 656          
BLAST of THO complex subunit 1 vs. Planmine SMEST
Match: SMESG000031324.1 (SMESG000031324.1)

HSP 1 Score: 1127.46 bits (2915), Expect = 0.000e+0
Identity = 547/547 (100.00%), Postives = 547/547 (100.00%), Query Frame = 3
Query:  390 MEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME 2030
            MEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME
Sbjct:    1 MEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSRLFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDENDLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFSKFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRCVLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSDREPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKVRIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFTNARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSIKSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSPKPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDDYKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME 547          
The following BLAST results are available for this feature:
BLAST of THO complex subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THOC11.329e-11135.71THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070][more]
THOC12.237e-11135.71THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070][more]
THOC11.171e-6840.24THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070][more]
THOC11.279e-5039.41THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070][more]
THOC19.088e-3341.18THO complex 1 [Source:HGNC Symbol;Acc:HGNC:19070][more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc-16.287e-7034.29THO Complex (Transcription factor/nuclear export) ... [more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hpr12.213e-9832.55gene:FBgn0037382 transcript:FBtr0078667[more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc11.569e-11036.70THO complex 1 [Source:ZFIN;Acc:ZDB-GENE-030826-9][more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
THOC11.511e-11036.30THO complex 1 protein [Source:NCBI gene;Acc:733546... [more]
THOC12.738e-11036.30THO complex 1 protein [Source:NCBI gene;Acc:733546... [more]
THOC13.654e-11036.30THO complex 1 protein [Source:NCBI gene;Acc:733546... [more]
THOC15.303e-11036.30THO complex 1 protein [Source:NCBI gene;Acc:733546... [more]
THOC16.605e-11036.30THO complex 1 protein [Source:NCBI gene;Acc:733546... [more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Thoc12.282e-11337.72THO complex 1 [Source:MGI Symbol;Acc:MGI:1919668][more]
Thoc15.346e-2441.61THO complex 1 [Source:MGI Symbol;Acc:MGI:1919668][more]
back to top
BLAST of THO complex subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R3N6|THOC1_MOUSE1.596e-11237.72THO complex subunit 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q96FV9|THOC1_HUMAN6.383e-11135.71THO complex subunit 1 OS=Homo sapiens OX=9606 GN=T... [more]
sp|Q93VM9|THOC1_ARATH2.755e-5328.11THO complex subunit 1 OS=Arabidopsis thaliana OX=3... [more]
sp|Q9URT2|YJU3_SCHPO3.345e-2327.71Uncharacterized protein P25A2.03 OS=Schizosaccharo... [more]
sp|P59924|THOC1_RAT6.079e-1828.88THO complex subunit 1 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of THO complex subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MBK83.273e-14845.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M5L23.290e-14845.88Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MA213.604e-14845.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M5I91.803e-14745.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3Q0KRB23.706e-14044.59Putative nuclear matrix protein OS=Schistosoma man... [more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc13.138e-10435.24THO complex 1 [Source:ZFIN;Acc:ZDB-GENE-030826-9][more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004034.13.035e-2235.98pep scaffold:Pmarinus_7.0:GL480061:43190:47873:1 g... [more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of THO complex subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO313333.922e-4342.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of THO complex subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thoc11.645e-10835.47THO complex 1 [Source:NCBI gene;Acc:101157731][more]
thoc14.434e-10835.95THO complex 1 [Source:NCBI gene;Acc:101157731][more]
back to top
BLAST of THO complex subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000031324.10.000e+097.91SMESG000031324.1[more]
SMESG000031324.10.000e+0100.00SMESG000031324.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006429 ID=SMED30006429|Name=THO complex subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2062bp
AACGCTTGATATTTTCCAAAATGAATGATTTATTCAGTGATAAATCCAAA
GTTTTTTGTAAAATTAAAGATATAATTTTGAAGCCAAATTCAAATATACA
ATCAATTTCAACTGAATTAGAATCGGCAAAGGATTTGAAGTACAAGCTAT
GTGAAATTTAATGCCTTAATCAGCAATTTAGGGATTTGAAATCTGTAGTA
GATTTTTTAATTCGAGAACAAGTTTTATTCAATTTAAAATCTAAAGACAT
TGAAAAAGTTAAAAACTACTTAAAATTATCTGCTGAATTGTCTAGGAAAG
ATCTCTCCAATCAGGCATTACCTTTTGTTTTATTTAGTGATGTATTGAAT
TCTCTTACTATTCAAACATGTGAAAGTTTTTTTTCATTTATGGAAGAATG
TATTTTAAAATTGAAAGATACGTCTGTGTTTCTATCAAGTAGAGCACTGC
TTCTTCGAATTTGCAATGACCTGCTTCGGCGATTATCAAAATCTCAAAAT
ACAGTTTTCTGTGGTAAAATCCAGATTTTTCTATCTCGTCTATTTCCACT
CGACGAGAAATCTGGATTGAATTTAATGGGACATTTCAATACAGAAAACC
TGACTCCGTTTAATGAATCTGATACCGGGGTTGAGTTAGATGACGATTCA
TCGATTGACTTGACCGACGAAACCATTCCCGATGAAAATGATCTTACTAG
TGCCATTAAGGTCAATAAAGGATTTTATAAAAAGTTCTGGATTCTACAAG
ACTTCTTTCGTAATTCTGTCCAGTGTTACGATGAATCGAAGTTTGCAACA
TTCTCCACTAGTGTAGATGAAGTTCTAGCGTTTTTTTCAAAATTTCGAGT
AAATCTTGACAGTTGCAAGAATGAAGCATTGAAAGCTGATTGGTCATCAT
TTTCCAATGCCGACATGACGTTTACCAAGTATCTGACAAGCGAAAAATTA
TTTGATCTGCAATTGATGGATCCTAATTTTCGCCGGTGTGTTCTTGTTCA
ACTAGCTGTCACATTTCAGTATCTAGTTTCACCGATCAAATTTAAAACCC
AAGATCAGGTGCTAAAAGAAGACCAACTGAAATGGATAGAGAAACAGCAA
GCAGAACTGGAGAAACTATTCCAGGCGTTGTCTAGTGACCGTGAACCGTT
TGCCGATATTGTCCACCTGGTTCTGAGTCGGGAATCCCACAAGAGCAATT
GGAAAAACGAAGGCTGTCCATCATTCGTTAAGAAAAGAACTGCATTGACA
TTAAATGCACTGGAAAAAGATTGTGATAAGAGAAAAGTTCGAATAAAAGT
CGACAAATCCGGCAGACAAGTGGTTTCATTCGACAGAAACGAGGAATTGA
CTCGACTGTGGAATATCTGTCCCGATAATTTGCTTGCGTGCCGGGACACA
AAACGCAACTACAATCCAGATCTCACGGAATATTTTACGAACGCTCGAAC
GGAACTGGATCCCGAAGAGAAAGTCGAAGAGAAATATCAATCGATTAACG
ATGAGAAATGGTGTTGGCAGTCGCTGAGATTGCTGTCGAGAAAGAGCCAG
CATTTCTACACCAATTGGACGAATCCTGGCCAGTCCATCAAATCCTATTT
GACCACAATTATAAAGCATAATCTCCAACCGCGTTCAAATGAGGACGAAG
TCGGCAATGATGTCGGAGAGGTGCAGGATCAGGATTCCACCACAACCACT
ACTCGGGGGGAGGTCGATGAGGATGACAGTTGCAGCCCGAAACCGGAAAC
AACCGCCAATGATATCGAGTCGATGTCGATTATTCTATTGCACATCGATG
AGATTGCGCAACTGATTGGGGATGGCGGTAAACGGGTCGGAGAGGCTCTG
CAGTTCAATGCGAATGATCTTGCCAATCTCAGTGATGACTACAAAACATT
CAACAAGGCAATGCTTAATCTCTGGCTAGTAGGAAAGTCCAATATGACAC
CATCGATTGCCAACATGATTGCAGCATTTGATGAGGTCGGAATGAATGAT
ATCGTTACGAAGATTAGATCCTGGATGGAATGATTATATGTGTCGTATCA
ATCAGTTTTGTG
back to top

protein sequence of SMED30006429-orf-1

>SMED30006429-orf-1 ID=SMED30006429-orf-1|Name=SMED30006429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MEECILKLKDTSVFLSSRALLLRICNDLLRRLSKSQNTVFCGKIQIFLSR
LFPLDEKSGLNLMGHFNTENLTPFNESDTGVELDDDSSIDLTDETIPDEN
DLTSAIKVNKGFYKKFWILQDFFRNSVQCYDESKFATFSTSVDEVLAFFS
KFRVNLDSCKNEALKADWSSFSNADMTFTKYLTSEKLFDLQLMDPNFRRC
VLVQLAVTFQYLVSPIKFKTQDQVLKEDQLKWIEKQQAELEKLFQALSSD
REPFADIVHLVLSRESHKSNWKNEGCPSFVKKRTALTLNALEKDCDKRKV
RIKVDKSGRQVVSFDRNEELTRLWNICPDNLLACRDTKRNYNPDLTEYFT
NARTELDPEEKVEEKYQSINDEKWCWQSLRLLSRKSQHFYTNWTNPGQSI
KSYLTTIIKHNLQPRSNEDEVGNDVGEVQDQDSTTTTTRGEVDEDDSCSP
KPETTANDIESMSIILLHIDEIAQLIGDGGKRVGEALQFNANDLANLSDD
YKTFNKAMLNLWLVGKSNMTPSIANMIAAFDEVGMNDIVTKIRSWME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR011029DEATH-like_dom_sf
IPR021861THO_THOC1
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021861THO complex, subunit THOC1PFAMPF11957efThoc1coord: 18..395
e-value: 8.6E-84
score: 282.0
IPR021861THO complex, subunit THOC1PANTHERPTHR13265THO COMPLEX SUBUNIT 1coord: 5..541
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 456..547
e-value: 4.7E-6
score: 28.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 437..451
NoneNo IPR availablePANTHERPTHR13265:SF2THO COMPLEX SUBUNIT 1coord: 5..541
NoneNo IPR availableCDDcd01670Deathcoord: 468..543
e-value: 2.66762E-6
score: 43.4245
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 467..546