Short transient receptor potential channel 4

Overview
NameShort transient receptor potential channel 4
Smed IDSMED30006424
Length (bp)5280
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Short transient receptor potential channel 4 (SMED30006424) t-SNE clustered cells

Violin plots show distribution of expression levels for Short transient receptor potential channel 4 (SMED30006424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Short transient receptor potential channel 4 (SMED30006424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Short transient receptor potential channel 4 (SMED30006424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30006424SMESG000039904.1 dd_Smed_v4_15627_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30006424SMESG000039904.1 dd_Smed_v4_15627_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006424SMESG000039904.1 dd_Smed_v4_15627_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006424SMESG000039904.1 dd_Smed_v6_15627_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30006424SMESG000039904.1 Contig27259newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006424SMESG000039904.1 Contig27259newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30006424SMESG000039904.1 Contig27259uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006424SMESG000039904.1 Contig27259uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 308.916 bits (790), Expect = 0.000e+0
Identity = 157/321 (48.91%), Postives = 216/321 (67.29%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNE--------MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  TC   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++ +  S   I  +              +YQ+VM NL+ RY+    + A+  EG+TE++  E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH-LCKKKMRR-KPESFGTIGVRTQHRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLS 765          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 313.538 bits (802), Expect = 0.000e+0
Identity = 156/315 (49.52%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  TC   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+    + A+  EG+TE++  E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLS 760          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC5 (transient receptor potential cation channel subfamily C member 5 [Source:HGNC Symbol;Acc:HGNC:12337])

HSP 1 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 231/438 (52.74%), Postives = 313/438 (71.46%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FL AVE+ D A++K+ L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ +   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ ++ K+     I  +FPML+  YLI PRS     +KKPFIKFICH++SY+ FL +L+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD--HSEELDPQK------YHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLH---VQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 293.508 bits (750), Expect = 0.000e+0
Identity = 152/314 (48.41%), Postives = 213/314 (67.83%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKS--RWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  + ++  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+  YL  WF  N  C  +      R  +++    +  +     Q YQ+V+ NL+ RY+    + ++ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIR---------------CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFN-NTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGN 763          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 377.096 bits (967), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 312.768 bits (800), Expect = 0.000e+0
Identity = 156/315 (49.52%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  TC   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+    + A+  EG+TE++  E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLS 760          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Match: TRPC4 (transient receptor potential cation channel subfamily C member 4 [Source:HGNC Symbol;Acc:HGNC:12336])

HSP 1 Score: 376.711 bits (966), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 281.567 bits (719), Expect = 0.000e+0
Identity = 140/273 (51.28%), Postives = 188/273 (68.86%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYL 2499
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  TC   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYV 718          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 377.096 bits (967), Expect = 4.682e-112
Identity = 235/469 (50.11%), Postives = 323/469 (68.87%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLS--SSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAM--FPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEY--NHLENDDY-----RGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISWAGRNGIPTTQHL 1720
            E+QFLL+ ER DI S+++ L       FNINC DPLGRNA+LIAIE E+IE++ELLL ++++ GDA+L+AI EEN EAVEII+   +E  D+  S      ++  S+FTPDITPI+LA+H+DNYE IKL LD+   +P PHD+RC+C  C  ++++DSLR S+SRINAY+AL SPSLI LS++DPIL AFELSWELKRL  +ENEF+ +YE LS KC+ F   +L+Q RGS+EL ++LNH+  ++ + T     + +  +   LARLKLAI+ +QK FVAHP+CQQLL  +WYEG+   R   F+YK  +IF I  M  FP+ + +YL+ P S+     KKPFIKF+ HS SY+ FL+LLI+A+ R+    N L  DD      RG  PT+IE  + +++ G IW E+K+LWE G+  Y  ++WN+LDF TNSLY+ T +LR VAY +   E + +    N +   +HL
Sbjct:   34 EKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIETGDAILYAIGEENVEAVEIIVE-HLEKMDKFDSERQGVEITEHSAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVT-----SANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYK--LIFYILGMLSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRA----NSVHIARHL 490          

HSP 2 Score: 276.174 bits (705), Expect = 1.394e-77
Identity = 136/268 (50.75%), Postives = 190/268 (70.90%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYY-LFFWFKMNCLCKSKGKKSRWHSIK--KIVSKVNEMEQRYQKVM 2475
            + R  WD++DPTL+SEC FA ANIFS+LKLV+IFTV+P+LGPL+ISLGRM+ DI+KFF++Y LVL AFACGLNQLLW+YA  R   C+  +      + +Y    L   C  + K  +S++   ++L+W+ +GLVDL++  L+  H  +E+ GK +FG+Y   ++IVLLNMLIAMM+ SYQ I++QADIEWKFARS+L++ YF+D  TLP PFNI+ SPK+IYY L +  K  C C    + S+  S++  KI+  VN+ E  Y+K +
Sbjct:  490 LPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFGLVDLTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIYYCLHYLTKKLCNCTKLQQPSKQKSMRNQKILRSVNDRENNYRKTI 757          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-2 (TRP (Transient receptor potential) channel family; TRP homlogous cation channel protein [Source:UniProtKB/TrEMBL;Acc:G5EE02])

HSP 1 Score: 376.711 bits (966), Expect = 2.987e-111
Identity = 235/469 (50.11%), Postives = 323/469 (68.87%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLS--SSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAM--FPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEY--NHLENDDY-----RGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISWAGRNGIPTTQHL 1720
            E+QFLL+ ER DI S+++ L       FNINC DPLGRNA+LIAIE E+IE++ELLL ++++ GDA+L+AI EEN EAVEII+   +E  D+  S      ++  S+FTPDITPI+LA+H+DNYE IKL LD+   +P PHD+RC+C  C  ++++DSLR S+SRINAY+AL SPSLI LS++DPIL AFELSWELKRL  +ENEF+ +YE LS KC+ F   +L+Q RGS+EL ++LNH+  ++ + T     + +  +   LARLKLAI+ +QK FVAHP+CQQLL  +WYEG+   R   F+YK  +IF I  M  FP+ + +YL+ P S+     KKPFIKF+ HS SY+ FL+LLI+A+ R+    N L  DD      RG  PT+IE  + +++ G IW E+K+LWE G+  Y  ++WN+LDF TNSLY+ T +LR VAY +   E + +    N +   +HL
Sbjct:   34 EKQFLLSCERGDIGSVRKLLAGISTETFNINCLDPLGRNALLIAIENENIEMIELLLDHNIETGDAILYAIGEENVEAVEIIVE-HLEKMDKFDSERQGVEITEHSAFTPDITPIVLAAHKDNYECIKLFLDKKGTVPHPHDVRCSCPECYVAREEDSLRLSRSRINAYRALTSPSLICLSARDPILYAFELSWELKRLSFIENEFRTDYEELSQKCQKFCVHMLDQVRGSKELEVVLNHTTNAWHDVT-----SANYGNPEKLARLKLAIQLSQKRFVAHPNCQQLLLDIWYEGVESVRCTNFIYK--LIFYILGMLSFPLFSLVYLLAPHSSMGQFAKKPFIKFLSHSGSYIFFLILLIMASQRMNVIDNILRTDDVDRKETRGPPPTIIECAIFLWVLGLIWVEIKQLWECGLYNYCRNLWNILDFITNSLYLCTTALRVVAYVQVEQEALRA----NSVHIARHL 490          

HSP 2 Score: 270.781 bits (691), Expect = 3.104e-75
Identity = 134/264 (50.76%), Postives = 187/264 (70.83%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYY-LFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQK 2469
            + R  WD++DPTL+SEC FA ANIFS+LKLV+IFTV+P+LGPL+ISLGRM+ DI+KFF++Y LVL AFACGLNQLLW+YA  R   C+  +      + +Y    L   C  + K  +S++   ++L+W+ +GLVDL++  L+  H  +E+ GK +FG+Y   ++IVLLNMLIAMM+ SYQ I++QADIEWKFARS+L++ YF+D  TLP PFNI+ SPK+IYY L +  K  C C    + S+  S+ ++ SK   + QR +K
Sbjct:  490 LPRRDWDAWDPTLLSECFFATANIFSSLKLVHIFTVSPHLGPLKISLGRMVIDIVKFFMVYALVLFAFACGLNQLLWYYASMRQNECNLYEQYKNEKSLSYKYEHLKESCDDKYKSCSSIYHTAETLFWALFGLVDLTHFRLKEDHFLSEWTGKTIFGSYCCCSIIVLLNMLIAMMSNSYQYISDQADIEWKFARSRLFLEYFDDTATLPPPFNIVPSPKSIYYCLHYLTKKLCNCTKLQQPSKQKSM-RVESKNLAIRQRPRK 752          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 251.906 bits (642), Expect = 2.693e-68
Identity = 164/448 (36.61%), Postives = 258/448 (57.59%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXHAINEENFEAVEIIIN-----AQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSY------MXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYY 1654
            ER+FL A E  +  +++  LD       N+NC D +GR A+ IA++ E++E++ELLL+        ALL AI E  +  VE+++N      ++       + D +   S+ ++ DI+P+ILA+  + +EI+++L+ +   I KPH   C C+ C   +  DSL++S  RIN ++ALASP+ ++L+S DPIL+AF+LSW+L+RL   E+EFK  Y  LS +C+ ++  LL Q R SEE+  +LN          +N+ N D       L+RLKLAIKY QK+FV+HPHCQQLL S+WYEG+P  +R        +   +  ++P+   +Y++ P+S    L++ PF+KF  +S S+      + +         + E   +     RG   T +E ++  ++ G +W E+K+LWE G K Y+   WN LDF    LY+ TIS+R  AYY
Sbjct:   50 ERRFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGN------VNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYY 491          

HSP 2 Score: 223.016 bits (567), Expect = 6.192e-59
Identity = 133/384 (34.64%), Postives = 212/384 (55.21%), Query Frame = 1
Query: 1519 IYLAGGQRVMGKWCQGIHHGYVEFIGLCH*FPLCSYN-QFESSRIL*IIK*KYYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNC--------LCKSKGKKSRWHSIKK---IVSKVNEMEQR------------YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLD 2598
            ++  G +R M +W       +++F+ +C    LC+ + +  +  I    +  Y +  R  W S +P L++E LFA  N+FS  +++Y+F  NP LGPLQISLG ML D+ KF  I++L++ +F+ GL QL W+Y         D      LP            C      F+S+ +   +L WS + +    + ++   H+ T++VG+ MF  Y   ++IVLLNMLIAMM+ S+Q+I + AD+EWKF R+KLW+++F++G++LP PFNII++PK++ Y+     MNC        L K   +K+R  +  +      K NEME+             Y  ++  L+ R++   +K    +GV EDDL+EIK DIS+ R+EL D
Sbjct:  455 LWEEGFKRYMRQWW-----NWLDFLMIC--LYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYY---------DPNTDVCLPGAT---------CKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYV-----MNCLFNTVRWLLGKYTYQKNRNRATIRRPGYSRKRNEMEKSGGHDDDSLKPLTYADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRD 808          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: trp-1 (Transient-receptor-potential-like protein [Source:UniProtKB/Swiss-Prot;Acc:P34586])

HSP 1 Score: 247.669 bits (631), Expect = 7.989e-67
Identity = 162/446 (36.32%), Postives = 256/446 (57.40%), Query Frame = 2
Query:  353 QFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXHAINEENFEAVEIIIN-----AQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSY------MXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYY 1654
            +FL A E  +  +++  LD       N+NC D +GR A+ IA++ E++E++ELLL+        ALL AI E  +  VE+++N      ++       + D +   S+ ++ DI+P+ILA+  + +EI+++L+ +   I KPH   C C+ C   +  DSL++S  RIN ++ALASP+ ++L+S DPIL+AF+LSW+L+RL   E+EFK  Y  LS +C+ ++  LL Q R SEE+  +LN          +N+ N D       L+RLKLAIKY QK+FV+HPHCQQLL S+WYEG+P  +R        +   +  ++P+   +Y++ P+S    L++ PF+KF  +S S+      + +         + E   +     RG   T +E ++  ++ G +W E+K+LWE G K Y+   WN LDF    LY+ TIS+R  AYY
Sbjct:   72 RFLEAAELGNKPTLQECLDYDGDRRLNVNCLDSMGRTALEIAVDNENMEVVELLLQQPDIRIGNALLCAIREGVYRLVEVLVNHPNITREMLGDGWSQALDPSEAASAEYSSDISPVILAAQLNQFEILQMLIRKDASIEKPHRHSCICETCDRERLNDSLQYSLKRINTFRALASPAWMSLTSPDPILSAFKLSWDLQRLAFEEHEFKETYLQLSEQCKQYSCDLLSQCRSSEEVIAILNKDGN------VNDDNIDVWASKLSLSRLKLAIKYEQKAFVSHPHCQQLLTSIWYEGIPYRQRSGTWANFFLYAFLLFLWPIFCLMYILMPKSRLGRLVRSPFMKFFYYSVSFATFLGLLTWATFEDYRYEKGERGGMTRASDRGPPATWVESLVFTWVIGMLWSEIKQLWEEGFKRYMRQWWNWLDFLMICLYLCTISIRLSAYY 511          

HSP 2 Score: 223.402 bits (568), Expect = 5.315e-59
Identity = 133/384 (34.64%), Postives = 212/384 (55.21%), Query Frame = 1
Query: 1519 IYLAGGQRVMGKWCQGIHHGYVEFIGLCH*FPLCSYN-QFESSRIL*IIK*KYYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNC--------LCKSKGKKSRWHSIKK---IVSKVNEMEQR------------YQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLD 2598
            ++  G +R M +W       +++F+ +C    LC+ + +  +  I    +  Y +  R  W S +P L++E LFA  N+FS  +++Y+F  NP LGPLQISLG ML D+ KF  I++L++ +F+ GL QL W+Y         D      LP            C      F+S+ +   +L WS + +    + ++   H+ T++VG+ MF  Y   ++IVLLNMLIAMM+ S+Q+I + AD+EWKF R+KLW+++F++G++LP PFNII++PK++ Y+     MNC        L K   +K+R  +  +      K NEME+             Y  ++  L+ R++   +K    +GV EDDL+EIK DIS+ R+EL D
Sbjct:  475 LWEEGFKRYMRQWW-----NWLDFLMIC--LYLCTISIRLSAYYIFTYREDPYRYTVRTYWTSEEPMLVAEALFAVGNVFSFARIIYLFQTNPYLGPLQISLGCMLVDVAKFCFIFVLIISSFSIGLAQLYWYY---------DPNTDVCLPGAT---------CKHSSNVFSSIADSYLTLLWSLFSITKPEDTDVVENHKITQWVGQGMFIMYHCTSIIVLLNMLIAMMSHSFQIINDHADLEWKFHRTKLWMAHFDEGSSLPPPFNIIVTPKSLIYV-----MNCLFNTVRWLLGKYTYQKNRNRATIRRPGYSRKRNEMEKSGGHDDDSLKPLTYADIITRLVARFIHQTKKDMKMDGVNEDDLHEIKQDISSLRYELRD 828          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Match: spe-41 (TRP homologous cation channel protein; TRP-3 channel protein [Source:UniProtKB/TrEMBL;Acc:G5EF09])

HSP 1 Score: 62.003 bits (149), Expect = 5.277e-19
Identity = 50/233 (21.46%), Postives = 98/233 (42.06%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVG------------------KLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIII 2331
            R  W S++ +L+ E   A A + S LK  Y   +  ++G   IS+G+ +     + LI + ++V+F+ GLN ++  Y  +      D                  +Y  T   Y T +    ++L+WS +G +         P  FT  VG                  +++   Y  I +I +LN++ +++      + +  ++E+KF R+ ++  +       P P N+I+
Sbjct:  465 RMHWPSFEFSLLHEICLAIACVLSILKCFYYAQMMKSIGGSVISVGKCVGKTYTYILIMVAIIVSFSVGLNIIVDPYLNRSTMKIGDQ-----------------DYTKTTDSYET-IGTSSKNLFWSIFGYLG--------PSTFTTVVGNTGPNMDPVKHTLNSSTFEILAAVYHGILIITVLNLMTSILVKGADEVLDNEEMEFKFTRAAIYSEFLSWEMAAPPPLNLIL 671          

HSP 2 Score: 53.5286 bits (127), Expect = 5.277e-19
Identity = 69/323 (21.36%), Postives = 131/323 (40.56%), Query Frame = 2
Query:  653 SSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTA-FELSWELKRLGRLEN-EFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASL----WYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFA 1603
            S  F P +TP++LA   +N+ I++ L+ RG  I  PH + C C  C   +++    HS +R+       S       + D +  A   ++ +L++L   +  E+   Y  L    + F   + +Q    +E  +++  +N ++    + E ++          RL++A+    + F    + Q  + S+    WY      +R  + +    I     + P L  ++   P  T    M  P  +FI H + Y++FL+  IL    I +     D     T   +E  +  Y+ G   ++    +  G  G+    W   D A
Sbjct:  137 SPHFPPHMTPLMLACILNNFSIVQCLITRGHCIQIPHFITCECKTC---KRETVTTHSSTRLVDVMRALSSEAYLWLATDDVFAATCAVARDLQQLASDDQLEYVETYRDLEMNVQRFLCRISDQAWRVDEFNMMV--ANRNYCPERMTEISS---------PRLQMAMDSQMRQFTCSTNSQTTIKSVFRSDWYNYGIKPKRDAWRFLRACI-----LMPFLVMLHAFMP--TKGTTMCVPLARFIAHITMYLVFLIAAILRPT-IGFYFAWTDSIE-VTVQALEIFMYAYVMGLALEKGILFYRVGRDGFFAFWWRWFDAA 436          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080945)

HSP 1 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 249/465 (53.55%), Postives = 330/465 (70.97%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGF-NINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQ-IEVHDQ-KPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG----LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE--------------YNHLEN-DDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            E++FLLAVER D+A  +R L  +Q T + N+NC DPLGR A+L+AI+ E++E++ELL+ Y++D  DALLH+I+EE  EAVE++++ + +  H +   S +  S  +S+FTPDITP+ILA+HRDNYEIIK+LLDRG  +P PHD+RC CD CV+S+++DSLRHS+SRINAY+ALASPSLIALSSKDPILTAFELSWEL+RL  LE+EFK EY+ L  +C+DFA ALL+ TR S EL ILLNH             +    +  HG    L RLKLAIK  QK FVAH + QQLLAS+WYEGLPGFRR+    +   I  I  MFP+ +  Y++ P S+    M+KPFIKFICHS+SY  FL LL+LA+ RIE               N +E     RG  PT IEW+++ +++G IW EVK+LW+ G++ Y+ DMWN++DF TNSLYVAT++LR V++++   E I
Sbjct:   21 EKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNH-------------DPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMI 472          

HSP 2 Score: 352.443 bits (903), Expect = 0.000e+0
Identity = 169/316 (53.48%), Postives = 229/316 (72.47%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNV 2631
            R +WD++DP LISE LF+AANIFS+LKLVYIF+VNP+LGPLQ+SL RM+ DIMKFF +Y+LVL AF  GLNQLLW+YA    + C +      L   N + +   N C    + F++LFE  Q+L+W+ +GL+DL +  L+    FT F G LMFGTYS I ++VLLN+LIAMMN SYQLI+E+AD+EWKFARSKLWISYFE+G T P PFNII +PK+I+Y   W  ++ C   S  ++    +I++   + ++ + +YQ++M NL+ RY+   Q+  +++GVTEDD+NEIK DISAFR EL++ILKN+GM  NV
Sbjct:  482 RERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDP--NACIV-WRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDTNV 794          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0335144)

HSP 1 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 249/465 (53.55%), Postives = 330/465 (70.97%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGF-NINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQ-IEVHDQ-KPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG----LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE--------------YNHLEN-DDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            E++FLLAVER D+A  +R L  +Q T + N+NC DPLGR A+L+AI+ E++E++ELL+ Y++D  DALLH+I+EE  EAVE++++ + +  H +   S +  S  +S+FTPDITP+ILA+HRDNYEIIK+LLDRG  +P PHD+RC CD CV+S+++DSLRHS+SRINAY+ALASPSLIALSSKDPILTAFELSWEL+RL  LE+EFK EY+ L  +C+DFA ALL+ TR S EL ILLNH             +    +  HG    L RLKLAIK  QK FVAH + QQLLAS+WYEGLPGFRR+    +   I  I  MFP+ +  Y++ P S+    M+KPFIKFICHS+SY  FL LL+LA+ RIE               N +E     RG  PT IEW+++ +++G IW EVK+LW+ G++ Y+ DMWN++DF TNSLYVAT++LR V++++   E I
Sbjct:   82 EKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNH-------------DPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMI 533          

HSP 2 Score: 352.829 bits (904), Expect = 0.000e+0
Identity = 169/316 (53.48%), Postives = 229/316 (72.47%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNV 2631
            R +WD++DP LISE LF+AANIFS+LKLVYIF+VNP+LGPLQ+SL RM+ DIMKFF +Y+LVL AF  GLNQLLW+YA    + C +      L   N + +   N C    + F++LFE  Q+L+W+ +GL+DL +  L+    FT F G LMFGTYS I ++VLLN+LIAMMN SYQLI+E+AD+EWKFARSKLWISYFE+G T P PFNII +PK+I+Y   W  ++ C   S  ++    +I++   + ++ + +YQ++M NL+ RY+   Q+  +++GVTEDD+NEIK DISAFR EL++ILKN+GM  NV
Sbjct:  543 RERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDP--NACIV-WRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDTNV 855          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: Trpgamma (gene:FBgn0032593 transcript:FBtr0080946)

HSP 1 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 249/465 (53.55%), Postives = 330/465 (70.97%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGF-NINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQ-IEVHDQ-KPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG----LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE--------------YNHLEN-DDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            E++FLLAVER D+A  +R L  +Q T + N+NC DPLGR A+L+AI+ E++E++ELL+ Y++D  DALLH+I+EE  EAVE++++ + +  H +   S +  S  +S+FTPDITP+ILA+HRDNYEIIK+LLDRG  +P PHD+RC CD CV+S+++DSLRHS+SRINAY+ALASPSLIALSSKDPILTAFELSWEL+RL  LE+EFK EY+ L  +C+DFA ALL+ TR S EL ILLNH             +    +  HG    L RLKLAIK  QK FVAH + QQLLAS+WYEGLPGFRR+    +   I  I  MFP+ +  Y++ P S+    M+KPFIKFICHS+SY  FL LL+LA+ RIE               N +E     RG  PT IEW+++ +++G IW EVK+LW+ G++ Y+ DMWN++DF TNSLYVAT++LR V++++   E I
Sbjct:   21 EKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNH-------------DPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMI 472          

HSP 2 Score: 352.443 bits (903), Expect = 0.000e+0
Identity = 169/316 (53.48%), Postives = 229/316 (72.47%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNV 2631
            R +WD++DP LISE LF+AANIFS+LKLVYIF+VNP+LGPLQ+SL RM+ DIMKFF +Y+LVL AF  GLNQLLW+YA    + C +      L   N + +   N C    + F++LFE  Q+L+W+ +GL+DL +  L+    FT F G LMFGTYS I ++VLLN+LIAMMN SYQLI+E+AD+EWKFARSKLWISYFE+G T P PFNII +PK+I+Y   W  ++ C   S  ++    +I++   + ++ + +YQ++M NL+ RY+   Q+  +++GVTEDD+NEIK DISAFR EL++ILKN+GM  NV
Sbjct:  482 RERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDP--NACIV-WRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDTNV 794          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0088471)

HSP 1 Score: 326.25 bits (835), Expect = 2.762e-170
Identity = 200/452 (44.25%), Postives = 299/452 (66.15%), Query Frame = 2
Query:  365 AVERSDIASIKRFLDSSQK-TGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQ-KPSTDYTSNLSSS-FTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHL--------------ENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNE 1669
            AVER D+ +++R L  + +    NINC DPLGR A+ +AI+ E++E++ELL+   ++  DALLHAIN E  EAVE+++  +  ++ + +P +    +++++ F PDITP++LA+H++N+EI+++LLDRG  +P PHD+RC C+ CV    +DSLRHS SR+N Y+AL SPSLI L+S DPI+TAF+LSWEL+ L   E E K+EY  L  +C+ FA  LL+QTR S ELAI+LN+           + ++    D   L RL  AI Y QK FVAH + QQLL+S+WY+GLPGFRR+  + KV  I  ++ +FP+   IY+  P      LM+KPF+KF+ H+SSY+ FL +LIL + R + + +              +    RG TP+ +E I+++Y+ GF+W+EV+E++  G+K Y+ +MWN +DF  NSLYV+ + LRA AY + + E
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYD---------PQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATE 490          

HSP 2 Score: 295.049 bits (754), Expect = 2.762e-170
Identity = 150/317 (47.32%), Postives = 205/317 (64.67%), Query Frame = 1
Query: 1678 FMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVN 2628
            ++ R KW  +DP LI+E LFAAAN+FS LKLV++F++NP+LGPLQISLGRM+ DI+KFF IY LVL AFACGLNQLLW++A      C      Y LP          + C  + + F +LFE  QSL+W+++G+V L +  L     +T F G LMFG+YS I +IVLLN+LIAMM+ SY +I E +D EWKFAR+KLW+SYFED  TLP PFN++ S K +  +F         KS     R  S K+   K  E    Y  +M +L+ RY+    +  +N  V+EDD+NE+K +I+  R+E+L+I +N+GM V+
Sbjct:  499 YIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKC------YVLPGGEADWGSHGDSC-MKWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFR--------KSSKTIDRQRSKKR---KEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLEIFENSGMDVS 797          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Match: trpl (gene:FBgn0005614 transcript:FBtr0301662)

HSP 1 Score: 326.25 bits (835), Expect = 2.762e-170
Identity = 200/452 (44.25%), Postives = 299/452 (66.15%), Query Frame = 2
Query:  365 AVERSDIASIKRFLDSSQK-TGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQ-KPSTDYTSNLSSS-FTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHL--------------ENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNE 1669
            AVER D+ +++R L  + +    NINC DPLGR A+ +AI+ E++E++ELL+   ++  DALLHAIN E  EAVE+++  +  ++ + +P +    +++++ F PDITP++LA+H++N+EI+++LLDRG  +P PHD+RC C+ CV    +DSLRHS SR+N Y+AL SPSLI L+S DPI+TAF+LSWEL+ L   E E K+EY  L  +C+ FA  LL+QTR S ELAI+LN+           + ++    D   L RL  AI Y QK FVAH + QQLL+S+WY+GLPGFRR+  + KV  I  ++ +FP+   IY+  P      LM+KPF+KF+ H+SSY+ FL +LIL + R + + +              +    RG TP+ +E I+++Y+ GF+W+EV+E++  G+K Y+ +MWN +DF  NSLYV+ + LRA AY + + E
Sbjct:   48 AVERGDMPNVRRILQKALRHQHININCMDPLGRRALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLAAHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRNLALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYD---------PQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQLLSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADDDFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLRAFAYIQQATE 490          

HSP 2 Score: 295.049 bits (754), Expect = 2.762e-170
Identity = 150/317 (47.32%), Postives = 205/317 (64.67%), Query Frame = 1
Query: 1678 FMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVN 2628
            ++ R KW  +DP LI+E LFAAAN+FS LKLV++F++NP+LGPLQISLGRM+ DI+KFF IY LVL AFACGLNQLLW++A      C      Y LP          + C  + + F +LFE  QSL+W+++G+V L +  L     +T F G LMFG+YS I +IVLLN+LIAMM+ SY +I E +D EWKFAR+KLW+SYFED  TLP PFN++ S K +  +F         KS     R  S K+   K  E    Y  +M +L+ RY+    +  +N  V+EDD+NE+K +I+  R+E+L+I +N+GM V+
Sbjct:  499 YIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIYTLVLFAFACGLNQLLWYFAALEKSKC------YVLPGGEADWGSHGDSC-MKWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSYTRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFR--------KSSKTIDRQRSKKR---KEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLEIFENSGMDVS 797          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 374.015 bits (959), Expect = 0.000e+0
Identity = 231/441 (52.38%), Postives = 313/441 (70.98%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            E+ +L AVE+ D AS+K  L+ ++     NINC DPLGR A+LIAIE E++E++ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIK+L+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFKAEYE LS +C+ FA+ LL+QTR S EL ++LN  +    N   +E N +       LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+     I  MFP+L+  YL+ P+S +   ++KPFIKFICH++SY+ FL LL+LA+  I  N   N D +G  PT +EW+++ ++ GFIW E+K++W+ G + YI D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:   33 EKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDD--MNLLQDEANNE-------LARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVSN---NPDRQGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSG 461          

HSP 2 Score: 307.76 bits (787), Expect = 0.000e+0
Identity = 150/310 (48.39%), Postives = 211/310 (68.06%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
            R  W+ + PTL++E +FA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y      TC   +                  C  +   F++LFE +QSL+WS +GL+ L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+I YL  W K++   +   +K  + ++ +  ++   +  +YQ+V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E++ ++K N
Sbjct:  465 RDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGIR------------------CERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSICYLITWIKVHVFKRRSKRKETFGTLGRRAAENVRLNHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVIGMMKGN 756          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 374.015 bits (959), Expect = 0.000e+0
Identity = 231/441 (52.38%), Postives = 313/441 (70.98%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            E+ +L AVE+ D AS+K  L+ ++     NINC DPLGR A+LIAIE E++E++ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIK+L+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFKAEYE LS +C+ FA+ LL+QTR S EL ++LN  +    N   +E N +       LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+     I  MFP+L+  YL+ P+S +   ++KPFIKFICH++SY+ FL LL+LA+  I  N   N D +G  PT +EW+++ ++ GFIW E+K++W+ G + YI D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:   33 EKSYLSAVEKGDYASVKLALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKMLVQKGVSVPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKAEYEELSHQCKHFAKDLLDQTRSSRELELILNFRDD--MNLLQDEANNE-------LARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLMFPLLSLCYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVSN---NPDRQGPKPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSG 461          

HSP 2 Score: 307.76 bits (787), Expect = 0.000e+0
Identity = 150/310 (48.39%), Postives = 211/310 (68.06%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
            R  W+ + PTL++E +FA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y      TC   +                  C  +   F++LFE +QSL+WS +GL+ L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+I YL  W K++   +   +K  + ++ +  ++   +  +YQ+V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E++ ++K N
Sbjct:  465 RDTWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYENSEGMTCKGIR------------------CERQNNAFSTLFETLQSLFWSIFGLISLYVTNVKADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSICYLITWIKVHVFKRRSKRKETFGTLGRRAAENVRLNHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVIGMMKGN 756          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 372.474 bits (955), Expect = 0.000e+0
Identity = 229/439 (52.16%), Postives = 313/439 (71.30%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNI--NCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FL AVE+ D A ++  L  ++   +NI  NC DPLGR+A+LIAIE E++E++ELLL + ++ GDALL+AI +E   AVE++++ +    +++  +       S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +    +  L+ R      +   LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RRR +  K+ M F I  +FP+ + +YL+ P+ST    +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   58 ERAFLSAVEKGDYAGVQHALREAE-VYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDD--QSEELDPR------ECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVK 484          

HSP 2 Score: 298.13 bits (762), Expect = 0.000e+0
Identity = 157/317 (49.53%), Postives = 216/317 (68.14%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK-----SRWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + D+  +               C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+ +YL  W     LC S+         +  ++K+   K  +     Q YQ+V+ +L+ RY+    + A+ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  491 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETEAADEPNHCKGIR----------CERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWVHGR-LCGSETAPPEEDTHKHENLKEFTEKHADRLIQNQHYQEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDLLGN 791          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 372.089 bits (954), Expect = 0.000e+0
Identity = 229/439 (52.16%), Postives = 313/439 (71.30%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNI--NCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FL AVE+ D A ++  L  ++   +NI  NC DPLGR+A+LIAIE E++E++ELLL + ++ GDALL+AI +E   AVE++++ +    +++  +       S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +    +  L+ R      +   LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RRR +  K+ M F I  +FP+ + +YL+ P+ST    +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 ERAFLSAVEKGDYAGVQHALREAE-VYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDD--QSEELDPR------ECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 292.738 bits (748), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 211/315 (66.98%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKK------IVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + D+  +               C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+ +YL  W     LC S+       + K        V K   +     +V+ +L+ RY+    + A+ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETEAADEPNHCKGIR----------CERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWVHGR-LCGSETAPPEEDTHKHENLKEFTVKKAVRIHLNIVEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDLLGN 764          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Match: trpc5a (transient receptor potential cation channel, subfamily C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040812-1])

HSP 1 Score: 372.089 bits (954), Expect = 0.000e+0
Identity = 229/439 (52.16%), Postives = 313/439 (71.30%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNI--NCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FL AVE+ D A ++  L  ++   +NI  NC DPLGR+A+LIAIE E++E++ELLL + ++ GDALL+AI +E   AVE++++ +    +++  +       S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +    +  L+ R      +   LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RRR +  K+ M F I  +FP+ + +YL+ P+ST    +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 ERAFLSAVEKGDYAGVQHALREAE-VYYNIDTNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDD--QSEELDPR------ECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCFIIGLLFPVFSLVYLLAPKSTLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 298.516 bits (763), Expect = 0.000e+0
Identity = 157/317 (49.53%), Postives = 216/317 (68.14%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK-----SRWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + D+  +               C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+ +YL  W     LC S+         +  ++K+   K  +     Q YQ+V+ +L+ RY+    + A+ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETEAADEPNHCKGIR----------CERQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFWYLCRWVHGR-LCGSETAPPEEDTHKHENLKEFTEKHADRLIQNQHYQEVIRSLVKRYVASMIRSAKTSEGLTEENFKELKQDISSFRYEVLDLLGN 766          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC5 (transient receptor potential cation channel, subfamily C, member 5 [Source:NCBI gene;Acc:100493720])

HSP 1 Score: 380.178 bits (975), Expect = 0.000e+0
Identity = 230/438 (52.51%), Postives = 314/438 (71.69%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ +L+AVE+ D AS+K  L+ ++     NINC DPLGR+A+LIAIE E++E++ELLL +++ +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ +  K+     I  +FP+L+  YLI P+S     +KKPFIKFICH++SY+ FL LL+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAYLIAVEKGDYASVKHALEEAEIYYNININCMDPLGRSALLIAIENENLEIMELLLSHNIYVGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQRRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKKFAKDLLDQARSSRELEIILNHRDD--QSEELDPQKC------HDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWAVKLVTCITIGLLFPVLSVAYLIAPKSRLGLFIKKPFIKFICHTASYLTFLFLLLLASQHIVRTELH---MQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFNEYVHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 298.13 bits (762), Expect = 0.000e+0
Identity = 156/316 (49.37%), Postives = 215/316 (68.04%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK---SRWHSIKKIVSKVNE----MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +WD + PTLI+E  FA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + ++     P N          C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G T+P PFNII SPK+I+Y   W +   LC  K  +    + H   K  ++ +       Q YQ+V+ NL+ RY+    + ++ NEG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWDMWHPTLIAEAFFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETSASEE-----PNNCKGIR-----CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGATMPPPFNIIASPKSIWYFCKWVRYK-LCPGKNSEEDIQKQHENLKTFTERHADNLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGN 765          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: hint1 (histidine triad nucleotide binding protein 1 [Source:Xenbase;Acc:XB-GENE-1014427])

HSP 1 Score: 374.785 bits (961), Expect = 0.000e+0
Identity = 227/440 (51.59%), Postives = 314/440 (71.36%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG--LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL Y++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIK L+ +G  +P+PH++RC C  CV     DSLRHS+SR+N Y+AL+SPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS++C+ FA+ LL+QTR S EL I+LN+ +           +   L D++G  LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR ++ K+     +  +FP  +  YLI P+STF   ++KPFIKFICH++SY+ FL LL+LA+  I     + +  +G  PT++EW+++ ++ GFIW E+K++W+ G + YI D WNL+DF  NSLY+ATISL+ VAY K
Sbjct:   33 EKAYLSAVEKGDYASVKQALEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSYNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKHLVQKGVSVPRPHEVRCNCVECVSGSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSSQCKQFAKDLLDQTRSSRELEIILNYRD-----------DGGLLDDSNGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWVVKMVTCVIVGLLFPAFSCCYLIAPKSTFGLFIRKPFIKFICHTASYLTFLFLLLLASQNIN----KTESLQGPAPTIVEWMILPWVLGFIWGEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVK 457          

HSP 2 Score: 312.768 bits (800), Expect = 0.000e+0
Identity = 159/321 (49.53%), Postives = 214/321 (66.67%), Query Frame = 1
Query: 1672 YYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFY-AKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTV 2625
            Y    R +W+ + PTL++E +FA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y A  +   C   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+++YL  W  K  C  K K K   + +I +  +        YQ+VM NL+ RY+    + A+  EG+TE++  E+K DIS+FRFE+L +LK N   +
Sbjct:  455 YVKRNRAEWEMFHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEADAKSSDCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVDPKHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSLWYLIKWIRKQICKKKMKRKPESFGAIGRRAADNLRRHNHYQEVMKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLKGNKFNI 757          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 278.87 bits (712), Expect = 4.267e-132
Identity = 186/441 (42.18%), Postives = 281/441 (63.72%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPS----TDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FLLA E+ D   +K+ L+ +     NIN  D LGRNAI I+IE E++++L+LLL Y     DALL AI+ E   AV+I++N Q +    +P+     +   N   S T D+ P+ILA+HR+NYEI+ +LL +   +PKPH + C C +C    K+DSLRHS+ R++ Y+ LASP+LI L+ +DPIL AFELS +LK L  +E EF+ +YE L+ KC+ FA+ LL Q R S EL ++LNH +   S+  +++R    L +   L+RLKLAIKYNQK FV+  +CQQ L ++W+  + G+RR+    K+ ++  +   +P+L+  YL+ P+S    ++  PF+KFI H +SY  FLLLL L +L   YN  +  +  G     I+++LI+++ G +W +VK LW +G++ ++ +  N L F  NSLY+AT +L+ VA+ K
Sbjct:  151 ERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWRT-RPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS---SDEPVDKRGL--LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLLLLNLYSLV--YNE-DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNK 582          

HSP 2 Score: 216.468 bits (550), Expect = 4.267e-132
Identity = 124/310 (40.00%), Postives = 184/310 (59.35%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGL--VDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLH-RQKAEDNEGVTEDDLNEIKGDISAFRFELLDIL 2604
            R  WD++ PTL++E LFA  N+ S L+L +++T +  LGPLQIS+G+ML D  KF  +++LVL +F  GL QL   Y K    T ++ K+   +     S +  +++  T             +L+W  + L  V L      +  +   FVG L+ GTY+ + +IVL  +L+AM++ S+QLIA   D EWKFAR+KLW+SYF+D  TLP PFNI+ SPKTI YLF    K  C   + G+  R +S+K+  S   + ++ YQKVM  L+ RYL   RQK +  +  T ++LNE++ D+S FR E+ D+L
Sbjct:  589 RKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQL---YDKGY--TTNEQKDCVGIFCEQQSNDAFHSFTGT-----------CYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISKWICSHTTTGRVKRQNSLKEWKSLRQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLL 882          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 278.485 bits (711), Expect = 7.329e-132
Identity = 186/441 (42.18%), Postives = 281/441 (63.72%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPS----TDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FLLA E+ D   +K+ L+ +     NIN  D LGRNAI I+IE E++++L+LLL Y     DALL AI+ E   AV+I++N Q +    +P+     +   N   S T D+ P+ILA+HR+NYEI+ +LL +   +PKPH + C C +C    K+DSLRHS+ R++ Y+ LASP+LI L+ +DPIL AFELS +LK L  +E EF+ +YE L+ KC+ FA+ LL Q R S EL ++LNH +   S+  +++R    L +   L+RLKLAIKYNQK FV+  +CQQ L ++W+  + G+RR+    K+ ++  +   +P+L+  YL+ P+S    ++  PF+KFI H +SY  FLLLL L +L   YN  +  +  G     I+++LI+++ G +W +VK LW +G++ ++ +  N L F  NSLY+AT +L+ VA+ K
Sbjct:   66 ERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWR-TRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS---SDEPVDKRGL--LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLLLLNLYSLV--YNE-DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNK 497          

HSP 2 Score: 215.698 bits (548), Expect = 7.329e-132
Identity = 124/310 (40.00%), Postives = 184/310 (59.35%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGL--VDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLH-RQKAEDNEGVTEDDLNEIKGDISAFRFELLDIL 2604
            R  WD++ PTL++E LFA  N+ S L+L +++T +  LGPLQIS+G+ML D  KF  +++LVL +F  GL QL   Y K    T ++ K+   +     S +  +++  T             +L+W  + L  V L      +  +   FVG L+ GTY+ + +IVL  +L+AM++ S+QLIA   D EWKFAR+KLW+SYF+D  TLP PFNI+ SPKTI YLF    K  C   + G+  R +S+K+  S   + ++ YQKVM  L+ RYL   RQK +  +  T ++LNE++ D+S FR E+ D+L
Sbjct:  504 RKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQL---YDKGY--TTNEQKDCVGIFCEQQSNDAFHSFTGT-----------CYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISKWICSHTTTGRVKRQNSLKEWKSLRQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLL 797          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Match: TRPC1 (transient receptor potential cation channel, subfamily C, member 1 [Source:NCBI gene;Acc:100497011])

HSP 1 Score: 278.1 bits (710), Expect = 9.725e-132
Identity = 186/441 (42.18%), Postives = 281/441 (63.72%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPS----TDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FLLA E+ D   +K+ L+ +     NIN  D LGRNAI I+IE E++++L+LLL Y     DALL AI+ E   AV+I++N Q +    +P+     +   N   S T D+ P+ILA+HR+NYEI+ +LL +   +PKPH + C C +C    K+DSLRHS+ R++ Y+ LASP+LI L+ +DPIL AFELS +LK L  +E EF+ +YE L+ KC+ FA+ LL Q R S EL ++LNH +   S+  +++R    L +   L+RLKLAIKYNQK FV+  +CQQ L ++W+  + G+RR+    K+ ++  +   +P+L+  YL+ P+S    ++  PF+KFI H +SY  FLLLL L +L   YN  +  +  G     I+++LI+++ G +W +VK LW +G++ ++ +  N L F  NSLY+AT +L+ VA+ K
Sbjct:   46 ERLFLLACEKGDYYMVKKLLEENSSEELNINSVDVLGRNAITISIENENLDILQLLLNYGCQSTDALLVAIDSEVVGAVDILLNHQPKWR-TRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCTAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELAQKCKTFAKDLLAQARNSRELEVILNHQS---SDEPVDKRGL--LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMAGYRRKHTCKKILIVLTVGIFWPVLSVCYLLAPKSQVGRIIHTPFMKFIIHGASYFTFLLLLNLYSLV--YNE-DKKNTMGPALERIDFLLIMWLIGMVWSDVKRLWYDGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNK 477          

HSP 2 Score: 215.698 bits (548), Expect = 9.725e-132
Identity = 124/310 (40.00%), Postives = 184/310 (59.35%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGL--VDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLH-RQKAEDNEGVTEDDLNEIKGDISAFRFELLDIL 2604
            R  WD++ PTL++E LFA  N+ S L+L +++T +  LGPLQIS+G+ML D  KF  +++LVL +F  GL QL   Y K    T ++ K+   +     S +  +++  T             +L+W  + L  V L      +  +   FVG L+ GTY+ + +IVL  +L+AM++ S+QLIA   D EWKFAR+KLW+SYF+D  TLP PFNI+ SPKTI YLF    K  C   + G+  R +S+K+  S   + ++ YQKVM  L+ RYL   RQK +  +  T ++LNE++ D+S FR E+ D+L
Sbjct:  484 RKDWDAFHPTLVAEGLFAFGNVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQL---YDKGY--TTNEQKDCVGIFCEQQSNDAFHSFTGT-----------CYALFWYIFSLAHVALFVTRFSFSEELQSFVGALIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIVPSPKTICYLFNSISKWICSHTTTGRVKRQNSLKEWKSLRQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEMRDLL 777          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc5 (transient receptor potential cation channel, subfamily C, member 5 [Source:MGI Symbol;Acc:MGI:109524])

HSP 1 Score: 378.252 bits (970), Expect = 0.000e+0
Identity = 231/438 (52.74%), Postives = 313/438 (71.46%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FL AVE+ D A++K+ L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ +   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ ++ K+     I  +FPML+  YLI PRS     +KKPFIKFICH++SY+ FL +L+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD--HSEELDPQK------YHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLH---VQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 303.138 bits (775), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSK---GKKSRWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  + ++  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+  YL  WF  N  C  +   G++ R H+++    +  +     Q YQ+V+ NL+ RY+    + ++ NEG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIR---------------CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFN-NTFCPKRDPDGRRRR-HNLRSFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGN 763          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 377.481 bits (968), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 313.153 bits (801), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 219/315 (69.52%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  +C   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+    ++A+  EG+TE+++ E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLS 760          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc4 (transient receptor potential cation channel, subfamily C, member 4 [Source:MGI Symbol;Acc:MGI:109525])

HSP 1 Score: 377.096 bits (967), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 311.997 bits (798), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 219/315 (69.52%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  +C   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+    ++A+  EG+TE+++ E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLSCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLVKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIREAKTEEGLTEENVKELKQDISSFRFEVLGLLRGSKLS 760          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc1 (transient receptor potential cation channel, subfamily C, member 1 [Source:MGI Symbol;Acc:MGI:109528])

HSP 1 Score: 286.189 bits (731), Expect = 8.285e-135
Identity = 187/441 (42.40%), Postives = 281/441 (63.72%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPS----TDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FLLA ++ D   +K+ L+ +     NINC D LGRNA+ I IE E +++L+LLL Y     DALL AI+ E   AV+I++N + +    +P+     +   N   S T D+ P+ILA+HR+NYEI+ +LL +   +PKPH + C C +C    K+DSLRHS+ R++ Y+ LASP+LI L+ +DPIL AFELS +LK L  +E EF+ +YE L+ +C+ FA+ LL Q R S EL ++LNH++   S+  L++R    L +   L+RLKLAIKYNQK FV+  +CQQ L ++W+  + G+RR+P   K+  +  +   +P+L+  YLI P+S F  ++  PF+KFI H +SY  FLLLL L +L   YN  +  +  G     I+++LI++I G IW ++K LW  G++ ++ +  N L F  NSLY+AT +L+ VA+ K
Sbjct:   64 EKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENESLDILQLLLDYGCQSADALLVAIDSEVVGAVDILLNHRPK-RSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTS---SDEPLDKRGL--LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSL--VYNE-DKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNK 495          

HSP 2 Score: 217.238 bits (552), Expect = 8.285e-135
Identity = 125/313 (39.94%), Postives = 185/313 (59.11%), Query Frame = 1
Query: 1678 FMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNL--NLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLH-RQKAEDNEGVTEDDLNEIKGDISAFRFELLDIL 2604
            F  R  WD++ PTL++E LFA AN+ S L+L +++T +  LGPLQIS+G+ML D  KF  +++LVL +F  GL QL   Y K    T  + K+   +     S +  +++  T             +L+W  + L  ++       Y  +   FVG ++ GTY+ + +IVL  +L+AM++ S+QLIA   D EWKFAR+KLW+SYF+D  TLP PFNII SPKTI Y+     K  C   SKGK  R +S+K+  +   + ++ YQKVM  L+ RYL   RQK +  +  T ++LNE++ D+S FR E+ D+L
Sbjct:  499 FADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKFLGMFLLVLFSFTIGLTQL---YDKGY--TSKEQKDCVGIFCEQQSNDTFHSFIGT-----------CFALFWYIFSLAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEWKFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEWRNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLL 795          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Match: Trpc7 (transient receptor potential cation channel, subfamily C, member 7 [Source:MGI Symbol;Acc:MGI:1349470])

HSP 1 Score: 260.766 bits (665), Expect = 2.730e-132
Identity = 179/487 (36.76%), Postives = 273/487 (56.06%), Query Frame = 2
Query:  299 PDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPST----------DYTS--NLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTH--GLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSY-MXXXXXXXXXXXRIE-YNHLENDDYRGNTPTVI----------EWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            P  M +E   +  P  ER FL + E  +I  +++ L+ S+    N NC D +G+NA+ +A+  E+  +  L L  +    +GDALL AI++     VE I++       Q+ +           D+ +     + F+ DITPIILA+H   YEI+ +LL +G RI +PHD  C C+ C E Q++DS  HS+SR+NAY+ LAS + ++LSS+DP+LTA ELS EL RL  +E EFK +Y  LS +C+DF   +L+  R +EE+  +LN            + N     D H   L+R+KLAIKY  K FVAHP+CQQ L ++WYE L G R++    K   +FG+S   P LA  Y I P S     ++ PF+KF+ H+ S+ +   LL++ A+ R E    L N+ +      +           E +++ ++ G IW E KE+WE G + Y++ +WNLLDF   S++VA+ + R +A+ K+S   +
Sbjct:   29 PAYMFNEKGTSLTPEEER-FLDSAEYGNIPVVRKMLEESKT--LNFNCVDYMGQNALQLAVGNEHLEVTELLLKKENLARVGDALLLAISKGYVRIVEAILSHPAFAQGQRLTLSPLEQELRDDDFYAYDEDGTRFSHDITPIILAAHCQEYEIVHILLLKGARIERPHDYFCKCNECTEKQRKDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELARLANIETEFKNDYRKLSMQCKDFVVGVLDLCRDTEEVEAILN-----------GDVNLQVWSDHHRPSLSRIKLAIKYEVKKFVAHPNCQQQLLTMWYENLSGLRQQSIAVKFLAVFGVSIGLPFLAIAYWIAPCSKLGQTLRSPFMKFVAHAVSFTIFLGLLVVNASDRFEGVKTLPNETFTDYPKQIFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEEGPREYVLHLWNLLDFGMLSIFVASFTARFMAFLKASEAQL 501          

HSP 2 Score: 234.187 bits (596), Expect = 2.730e-132
Identity = 132/333 (39.64%), Postives = 189/333 (56.76%), Query Frame = 1
Query: 1672 YYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNC---LCKSKGK----------------KSRWHSIKK-----IVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLD 2598
            Y+   R KW   DP +ISE L+A A + S  ++ YI   N + GPLQISLGR + DI KF +I+++V VAF  G+  L  +Y   +                       YN        FT++ E  ++L+WS +GL ++ ++ L+Y H+F E +G +++G Y+   ++VLLNMLIAM+N SYQ I E AD+EWKFAR+KLW+SYF++G TLP PFN++ SPK+ YYL    KM C   LC+SK K                K+R+ +  +       +       RYQK+M  LI RY+L  Q   +N+ V E +L EIK DIS+ R+ELL+
Sbjct:  523 YFTYARDKWWPSDPQIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIGMFNLYSYYRGAK-----------------------YN------PAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVVVLLNMLIAMINNSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPAPFNLVPSPKSFYYLIMRIKM-CLIELCQSKAKRCENDLEMGMLNSKFRKTRYQAGMRNSENLTANSTFSKPTRYQKIMKRLIKRYVLKAQVDRENDEVNEGELKEIKQDISSLRYELLE 825          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9VJJ7|TRPG_DROME (Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 0.000e+0
Identity = 249/465 (53.55%), Postives = 330/465 (70.97%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGF-NINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQ-IEVHDQ-KPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG----LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE--------------YNHLEN-DDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            E++FLLAVER D+A  +R L  +Q T + N+NC DPLGR A+L+AI+ E++E++ELL+ Y++D  DALLH+I+EE  EAVE++++ + +  H +   S +  S  +S+FTPDITP+ILA+HRDNYEIIK+LLDRG  +P PHD+RC CD CV+S+++DSLRHS+SRINAY+ALASPSLIALSSKDPILTAFELSWEL+RL  LE+EFK EY+ L  +C+DFA ALL+ TR S EL ILLNH             +    +  HG    L RLKLAIK  QK FVAH + QQLLAS+WYEGLPGFRR+    +   I  I  MFP+ +  Y++ P S+    M+KPFIKFICHS+SY  FL LL+LA+ RIE               N +E     RG  PT IEW+++ +++G IW EVK+LW+ G++ Y+ DMWN++DF TNSLYVAT++LR V++++   E I
Sbjct:   21 EKKFLLAVERGDMAGTRRMLQKAQDTEYINVNCVDPLGRTALLMAIDNENLEMVELLINYNVDTKDALLHSISEEFVEAVEVLLDHENVTFHSEGNHSWESASEDTSTFTPDITPLILAAHRDNYEIIKILLDRGAVLPMPHDVRCGCDECVQSRQEDSLRHSRSRINAYRALASPSLIALSSKDPILTAFELSWELRRLSFLEHEFKNEYQELRKQCQDFATALLDHTRTSHELEILLNH-------------DPTGPVYEHGERMHLNRLKLAIKLRQKKFVAHSNVQQLLASIWYEGLPGFRRKNMALQAVDIIRIGIMFPIFSLAYILAPYSSIGQTMRKPFIKFICHSASYFTFLFLLMLASQRIETFIGGWFFADSSGMLNTMEELPTKRGAKPTFIEWLILAWVSGLIWSEVKQLWDVGLQEYLNDMWNVIDFVTNSLYVATVALRVVSFFQVQKEMI 472          

HSP 2 Score: 352.443 bits (903), Expect = 0.000e+0
Identity = 169/316 (53.48%), Postives = 229/316 (72.47%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWF-KMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNV 2631
            R +WD++DP LISE LF+AANIFS+LKLVYIF+VNP+LGPLQ+SL RM+ DIMKFF +Y+LVL AF  GLNQLLW+YA    + C +      L   N + +   N C    + F++LFE  Q+L+W+ +GL+DL +  L+    FT F G LMFGTYS I ++VLLN+LIAMMN SYQLI+E+AD+EWKFARSKLWISYFE+G T P PFNII +PK+I+Y   W  ++ C   S  ++    +I++   + ++ + +YQ++M NL+ RY+   Q+  +++GVTEDD+NEIK DISAFR EL++ILKN+GM  NV
Sbjct:  482 RERWDAWDPMLISEGLFSAANIFSSLKLVYIFSVNPHLGPLQVSLSRMVMDIMKFFFLYVLVLFAFGSGLNQLLWYYADLEKKRCPEVSPMSALLNMNGTNDP--NACIV-WRRFSNLFETTQTLFWAVFGLIDLDSFELDGIKIFTRFWGMLMFGTYSVINIVVLLNLLIAMMNHSYQLISERADVEWKFARSKLWISYFEEGGTCPPPFNIIPTPKSIWYAIKWMRRVFCSGSSAARREHLKTIRRKAQQASDRDFKYQQIMRNLVRRYVTVEQRKAESQGVTEDDVNEIKQDISAFRCELVEILKNSGMDTNV 794          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|O62852|TRPC5_RABIT (Short transient receptor potential channel 5 OS=Oryctolagus cuniculus OX=9986 GN=TRPC5 PE=2 SV=1)

HSP 1 Score: 378.252 bits (970), Expect = 0.000e+0
Identity = 231/438 (52.74%), Postives = 313/438 (71.46%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FL AVE+ D A++K+ L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ +   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ ++ K+     I  +FPML+  YLI PRS     +KKPFIKFICH++SY+ FL +L+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD--HSEELDPQK------YHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLH---VQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 303.138 bits (775), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSK---GKKSRWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  + ++  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+  YL  WF  N  C  +   G++ R H+++    +  +     Q YQ+V+ NL+ RY+    + ++ NEG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIR---------------CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFN-NTFCPKRDPDGRRRR-HNLRSFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGN 763          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9QX29|TRPC5_MOUSE (Short transient receptor potential channel 5 OS=Mus musculus OX=10090 GN=Trpc5 PE=1 SV=2)

HSP 1 Score: 378.252 bits (970), Expect = 0.000e+0
Identity = 231/438 (52.74%), Postives = 313/438 (71.46%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FL AVE+ D A++K+ L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ +   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ ++ K+     I  +FPML+  YLI PRS     +KKPFIKFICH++SY+ FL +L+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAFLSAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRKPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD--HSEELDPQK------YHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLH---VQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 303.138 bits (775), Expect = 0.000e+0
Identity = 155/315 (49.21%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSK---GKKSRWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  + ++  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+  YL  WF  N  C  +   G++ R H+++    +  +     Q YQ+V+ NL+ RY+    + ++ NEG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIR---------------CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFN-NTFCPKRDPDGRRRR-HNLRSFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTNEGLTEENFKELKQDISSFRYEVLDLLGN 763          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9UL62|TRPC5_HUMAN (Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 231/438 (52.74%), Postives = 313/438 (71.46%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            E+ FL AVE+ D A++K+ L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++  T       S FTPDITPI+LA+H +NYEIIKLL+ +   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEFKAEYE LS +C+ FA+ LL+Q R S EL I+LNH +    +  L+ +        H LA+LK+AIKY+QK FVA P+CQQLLA+LWY+G PG+RR+ ++ K+     I  +FPML+  YLI PRS     +KKPFIKFICH++SY+ FL +L+LA+  I    L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 EKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLGRSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFTPDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDD--HSEELDPQK------YHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLISPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLH---VQGPPPTVVEWMILPWVLGFIWGEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 459          

HSP 2 Score: 293.508 bits (750), Expect = 0.000e+0
Identity = 152/314 (48.41%), Postives = 213/314 (67.83%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKS--RWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA +NI S+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  + ++  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+  YL  WF  N  C  +      R  +++    +  +     Q YQ+V+ NL+ RY+    + ++ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  466 REEWEMWHPTLIAEALFAISNILSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIR---------------CEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFN-NTFCPKRDPDGRRRRRNLRSFTERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGN 763          
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Match: sp|Q9UBN4|TRPC4_HUMAN (Short transient receptor potential channel 4 OS=Homo sapiens OX=9606 GN=TRPC4 PE=1 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 0.000e+0
Identity = 232/446 (52.02%), Postives = 319/446 (71.52%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            E+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++EL+ELLL +++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+ALASPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL I+LN+            R+ +SLI+      LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+ +  YLI P+S     ++KPFIKFICH++SY+ FL LL+LA+  I+ + L   + +G  PT++EW+++ ++ GFIW E+K++W+ G++ YI D WNL+DF  NSLY+ATISL+ VA+ K S  N
Sbjct:   33 EKAYLNAVEKGDYASVKKSLEEAEIYFKININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSEYEELSRQCKQFAKDLLDQTRSSRELEIILNY------------RDDNSLIEEQSGNDLARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIRKPFIKFICHTASYLTFLFLLLLASQHIDRSDL---NRQGPPPTIVEWMILPWVLGFIWGEIKQMWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALN 463          

HSP 2 Score: 313.538 bits (802), Expect = 0.000e+0
Identity = 156/315 (49.52%), Postives = 217/315 (68.89%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK--SRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMT 2622
            R  WD + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y + +  TC   +                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYFE+G TLP PFN+I SPK+++YL  W   + LCK K ++    + +I +  +       +YQ+VM NL+ RY+    + A+  EG+TE++  E+K DIS+FRFE+L +L+ + ++
Sbjct:  465 RESWDMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYEETKGLTCKGIR------------------CEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVIPSPKSLWYLIKWIWTH-LCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLS 760          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267DGY4 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029366g2 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 0.000e+0
Identity = 278/442 (62.90%), Postives = 348/442 (78.73%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKP-STDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE---YNHLEND-DYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER++L AVE  D+A+++R ++S+   G NINCRD LGR+A+ +AIEYEHIELLE+LL Y+L+LGDALLHAI EEN  AVE+++++Q E   +K  S    +  SSSFTPD+TPIILA+  DNYEIIKLLLDRGDR+PKPH+LRCAC  CV + K+DSL+HSKSRINAY+ALASPSLIALSSKDPILTAFELSWE+ RLGRLE+EF+ EYE LS  C+ FA ALLEQTR SEELAI+LN   G   N  LN++      +   LARLK+AIKY QK FVAHPHCQQLLA+LWYEGLPGFRR+   +++GMI   + +FP+L+ +YL+ PRS     M+KPFIKFICHS+SYMLFL  L+LAA+R+E    + LE     RG  P+++EWI++IYI GF+WQE+K+LW  G+K Y+ DMWNLLDF TN+LYVATI+LR V+YY+
Sbjct:   88 ERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQ-GNAKLNDKTLTE-GERMNLARLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYLVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYR 527          

HSP 2 Score: 434.876 bits (1117), Expect = 0.000e+0
Identity = 202/314 (64.33%), Postives = 244/314 (77.71%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMN-CLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGM 2619
            + R  WD+YDPTLISECLFA ANIFS LKLV IFT+NP+LGPLQISLGRMLNDI+KF  + +LV+ +FACG NQL WFYA +R + C D  NK++        ++ Y+YC TRG+ F++LFEI QSLYWS YGL+DLSN +LEY H FTEF+GKLM+G +S IT IVLLNMLIAMMN S++ I  QAD EWKFAR KLWISYF++G TLP PFNII SPK+  Y   W K   C C  + ++S+W SI+K+V KVNE E RYQ VM +LI RYL+ RQK++D +GVTEDDLNEIKGDISAFRFELL+I + NGM
Sbjct:  537 LHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQD--NKFYFGITGTDLDK-YSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDKQGVTEDDLNEIKGDISAFRFELLEIFRTNGM 847          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267FS73 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029366g3 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 0.000e+0
Identity = 277/442 (62.67%), Postives = 348/442 (78.73%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKP-STDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE---YNHLEND-DYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER++L AVE  D+A+++R ++S+   G NINCRD LGR+A+ +AIEYEHIELLE+LL Y+L+LGDALLHAI EEN  AVE+++++Q E   +K  S    +  SSSFTPD+TPIILA+  DNYEIIKLLLDRGDR+PKPH+LRCAC  CV + K+DSL+HSKSRINAY+ALASPSLIALSSKDPILTAFELSWE+ RLGRLE+EF+ EYE LS  C+ FA ALLEQTR SEELAI+LN   G   N  LN++      +   LARLK+AIKY QK FVAHPHCQQLLA+LWYEGLPGFRR+   +++GMI   + +FP+L+ +Y++ PRS     M+KPFIKFICHS+SYMLFL  L+LAA+R+E    + LE     RG  P+++EWI++IYI GF+WQE+K+LW  G+K Y+ DMWNLLDF TN+LYVATI+LR V+YY+
Sbjct:   88 ERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQ-GNAKLNDKTLTE-GERMNLARLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYMVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYR 527          

HSP 2 Score: 434.876 bits (1117), Expect = 0.000e+0
Identity = 202/314 (64.33%), Postives = 244/314 (77.71%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMN-CLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGM 2619
            + R  WD+YDPTLISECLFA ANIFS LKLV IFT+NP+LGPLQISLGRMLNDI+KF  + +LV+ +FACG NQL WFYA +R + C D  NK++        ++ Y+YC TRG+ F++LFEI QSLYWS YGL+DLSN +LEY H FTEF+GKLM+G +S IT IVLLNMLIAMMN S++ I  QAD EWKFAR KLWISYF++G TLP PFNII SPK+  Y   W K   C C  + ++S+W SI+K+V KVNE E RYQ VM +LI RYL+ RQK++D +GVTEDDLNEIKGDISAFRFELL+I + NGM
Sbjct:  537 LHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQD--NKFYFGITGTDLDK-YSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDKQGVTEDDLNEIKGDISAFRFELLEIFRTNGM 847          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267DTY7 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029366g1 PE=3 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 0.000e+0
Identity = 277/442 (62.67%), Postives = 348/442 (78.73%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKP-STDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE---YNHLEND-DYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER++L AVE  D+A+++R ++S+   G NINCRD LGR+A+ +AIEYEHIELLE+LL Y+L+LGDALLHAI EEN  AVE+++++Q E   +K  S    +  SSSFTPD+TPIILA+  DNYEIIKLLLDRGDR+PKPH+LRCAC  CV + K+DSL+HSKSRINAY+ALASPSLIALSSKDPILTAFELSWE+ RLGRLE+EF+ EYE LS  C+ FA ALLEQTR SEELAI+LN   G   N  LN++      +   L+RLK+AIKY QK FVAHPHCQQLLA+LWYEGLPGFRR+   +++GMI   + +FP+L+ +YL+ PRS     M+KPFIKFICHS+SYMLFL  L+LAA+R+E    + LE     RG  P+++EWI++IYI GF+WQE+K+LW  G+K Y+ DMWNLLDF TN+LYVATI+LR V+YY+
Sbjct:   88 ERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQ-GNAKLNDKTLTE-GERMNLSRLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYLVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYR 527          

HSP 2 Score: 293.893 bits (751), Expect = 0.000e+0
Identity = 137/209 (65.55%), Postives = 165/209 (78.95%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTL 2307
            + R  WD+YDPTLISECLFA ANIFS LKLV IFT+NP+LGPLQISLGRMLNDI+KF  + +LV+ +FACG NQL WFYA +R + C D  NK++        ++ Y+YC TRG+ F++LFEI QSLYWS YGL+DLSN +LEY H FTEF+GKLM+G +S IT IVLLNMLIAMMN S++ I  QAD EWKFAR KLWISYF++G TL
Sbjct:  537 LHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQD--NKFYFGITGTDLDK-YSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTL 742          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267DBT5 (ANK_REP_REGION domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003128g1 PE=3 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 0.000e+0
Identity = 277/442 (62.67%), Postives = 348/442 (78.73%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKP-STDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE---YNHLEND-DYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER++L AVE  D+A+++R ++S+   G NINCRD LGR+A+ +AIEYEHIELLE+LL Y+L+LGDALLHAI EEN  AVE+++++Q E   +K  S    +  SSSFTPD+TPIILA+  DNYEIIKLLLDRGDR+PKPH+LRCAC  CV + K+DSL+HSKSRINAY+ALASPSLIALSSKDPILTAFELSWE+ RLGRLE+EF+ EYE LS  C+ FA ALLEQTR SEELAI+LN   G   N  LN++      +   L+RLK+AIKY QK FVAHPHCQQLLA+LWYEGLPGFRR+   +++GMI   + +FP+L+ +YL+ PRS     M+KPFIKFICHS+SYMLFL  L+LAA+R+E    + LE     RG  P+++EWI++IYI GF+WQE+K+LW  G+K Y+ DMWNLLDF TN+LYVATI+LR V+YY+
Sbjct:   88 ERRYLQAVELGDLATVRRSIESASSLGININCRDSLGRSALHVAIEYEHIELLEVLLAYNLELGDALLHAIQEENIIAVEMLLSSQTERQKKKDLSGLLGTTPSSSFTPDVTPIILAAQIDNYEIIKLLLDRGDRVPKPHELRCACVDCVRAHKEDSLQHSKSRINAYKALASPSLIALSSKDPILTAFELSWEMHRLGRLEHEFREEYENLSADCQKFATALLEQTRSSEELAIVLNQDAGQ-GNAKLNDKTLTE-GERMNLSRLKMAIKYKQKKFVAHPHCQQLLAALWYEGLPGFRRKHMFFQMGMIGTFAGIFPLLSMVYLVAPRSELGQKMRKPFIKFICHSASYMLFLGFLVLAAIRVEDLIMDTLEEKMQERGGAPSIVEWIIVIYILGFVWQEIKQLWGEGIKAYVTDMWNLLDFITNALYVATITLRGVSYYR 527          

HSP 2 Score: 381.333 bits (978), Expect = 0.000e+0
Identity = 178/284 (62.68%), Postives = 217/284 (76.41%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMN-CLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNE 2529
            + R  WD+YDPTLISECLFA ANIFS LKLV IFT+NP+LGPLQISLGRMLNDI+KF  + +LV+ +FACG NQL WFYA +R + C D  NK++        ++ Y+YC TRG+ F++LFEI QSLYWS YGL+DLSN +LEY H FTEF+GKLM+G +S IT IVLLNMLIAMMN S++ I  QAD EWKFAR KLWISYF++G TLP PFNII SPK+  Y   W K   C C  + ++S+W SI+K+V KVNE E RYQ VM +LI RYL+ RQK++DNE
Sbjct:  537 LHRKYWDAYDPTLISECLFAIANIFSMLKLVNIFTINPHLGPLQISLGRMLNDILKFLFVVVLVICSFACGFNQLYWFYAYQRNKYCQD--NKFYFGITGTDLDK-YSYCVTRGRTFSNLFEITQSLYWSAYGLIDLSNTDLEYEHSFTEFIGKLMYGAFSAITFIVLLNMLIAMMNCSFEEIVAQADTEWKFARGKLWISYFDEGGTLPTPFNIIPSPKSFLYAMAWLKDKVCSCSKRHQRSKWQSIRKVVKKVNEKEARYQSVMRDLIKRYLMVRQKSDDNE 817          
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Match: A0A267F969 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013797g1 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 0.000e+0
Identity = 266/445 (59.78%), Postives = 343/445 (77.08%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTD--YTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTH-GLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIE---YNHLE-NDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER++LL+VE  D+ S+++++++++    N+NC D LGR+A+LIAIE+E    L  LL    L+LGDALLHAI EEN  AVE++++AQ E   +KP       +  SSSFTPDITPIILA+H DNYEI+K+LLDRGDR+PKPH+LRCACD CV +QK+DSLRHSKSRINAY+ALASPSLI LSSKDPILTAFELSWE+KRLGRLENEFK+EYE L+ KC+++A ALLEQTR S ELAI+LN   G  S   +NE+  +   +    L+RLKLAIKY QK FVAHPHCQQLLA+LWY+GLPGFRR+  + ++GMI   + +FP LA +YL+ P S     M+KPFIKFICHS+SY+LFL  L+LAA+R+E   ++ +E     RG  P+ +E I++ Y+ GF+WQE+K+LW  G K Y+ DMWNLLDFATN+LY+ATI+LR VA+Y+
Sbjct:   73 ERRYLLSVEMGDMTSVRQYVENAETLSVNVNCVDSLGRSAVLIAIEFEHIELLEMLLSFGFLELGDALLHAIQEENVVAVEMLLHAQAEKQQKKPQAPGPMGAVPSSSFTPDITPIILAAHIDNYEILKILLDRGDRVPKPHELRCACDECVLAQKEDSLRHSKSRINAYKALASPSLICLSSKDPILTAFELSWEMKRLGRLENEFKSEYEQLAAKCQEYASALLEQTRSSAELAIVLNQDIGQ-SGHKVNEKALEETDEERMTLSRLKLAIKYKQKKFVAHPHCQQLLAALWYDGLPGFRRKHLILQMGMIATFAGIFPALAFMYLLAPHSEMGQKMRKPFIKFICHSASYLLFLGFLVLAAIRVEDLLFDTMELKMKERGAGPSAVELIIVTYVMGFVWQEIKQLWNEGAKAYVTDMWNLLDFATNALYIATITLRGVAWYR 516          

HSP 2 Score: 441.425 bits (1134), Expect = 0.000e+0
Identity = 206/312 (66.03%), Postives = 248/312 (79.49%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMN-CLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGM 2619
            R  WD+YDPTLISECLFA ANIFS LKLVYIFTVNP+LGPLQISLGRML+DI+KF  + +LVL +FACG NQL WFYA +R + C D K  + +  ++    E Y YC TRG+ F++LFEI Q+LYWSTYGL+DLSN +LEY H FTEFVGKLM+G +S IT +VLLNMLIAMMN SY+ IA QAD EWKFARSKLWISYFE+G TLPVPFNII SPK+  Y+  W K   C C  + ++S+W SI+K+V +VNE E RYQ VM +L+ RYL+ RQ+ ++ +GVTEDDLNEIKGDISAFRFELL+IL+ NGM
Sbjct:  528 RQYWDAYDPTLISECLFATANIFSMLKLVYIFTVNPHLGPLQISLGRMLSDILKFLFVVVLVLSSFACGFNQLYWFYAYERNKYCKDVKLGFGITGSDL---EKYQYCVTRGRTFSNLFEITQTLYWSTYGLIDLSNTDLEYEHSFTEFVGKLMYGVFSAITFVVLLNMLIAMMNCSYESIATQADTEWKFARSKLWISYFEEGGTLPVPFNIIPSPKSFLYIATWTKERLCSCSKQHQRSKWQSIRKVVKRVNEREARYQTVMRDLVKRYLMVRQRLDERQGVTEDDLNEIKGDISAFRFELLEILRTNGM 836          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc5a (short transient receptor potential channel 5-like [Source:NCBI gene;Acc:103044006])

HSP 1 Score: 373.244 bits (957), Expect = 0.000e+0
Identity = 227/438 (51.83%), Postives = 311/438 (71.00%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKT-GFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER FLLAVE+ D A +K  L  ++     ++NC DPLGR+A+LIAIE E++E++ELLL + ++ GDALL+AI +E   AVE++++ +    +++  +       S FTPDITPI+LA+H +NYEIIKLL+     IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +    +  L+ R      +   LA+LKLAIKY+QK FV+ P+CQQLLA+LWY+G PG+RRR +  K+ M   I  +FP+ + IYL+ PRS+    +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   36 ERAFLLAVEKGDYAGVKHALQEAEVYYNIDVNCVDPLGRSALLIAIENENLEVMELLLDHGVNTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDAQFSEFTPDITPIMLAAHTNNYEIIKLLVQHKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDD--QSEELDPR------ECRDLAKLKLAIKYHQKEFVSQPNCQQLLATLWYDGFPGWRRRHWAVKLVMCIIIGLLFPVFSIIYLLAPRSSLGFFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAYVK 462          

HSP 2 Score: 298.901 bits (764), Expect = 0.000e+0
Identity = 153/313 (48.88%), Postives = 214/313 (68.37%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWH-SIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + D+  +               C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNI+ SPK+ +YL  W       +     S  H ++K +  K  +     + YQ+V+ +L+ RY+    + A+ NEG+TE++  E+K DIS+FR+E++D+L N
Sbjct:  469 REEWEMWHPTLMAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETQAADEPNHCKGIR----------CEKQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIVPSPKSAWYLCCWLHRWLCWRGDAPHSEKHENLKDLTEKHADRIIQNKHYQEVIRSLVKRYVAAMIRSAKTNEGLTEENFKELKQDISSFRYEVMDLLGN 766          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc4b (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103045092])

HSP 1 Score: 367.851 bits (943), Expect = 0.000e+0
Identity = 230/441 (52.15%), Postives = 307/441 (69.61%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            E+ +L AVER D  S+KR LD ++     NINC DPLGR A+LIAIE E++EL+ELLL Y++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+AL+SPSLIALSS+DP LTAF+LSWEL+ L ++ENEFK EYE LS +C+ FA+ LL+QTR S EL ++LN  +   S     E N +       LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K      I  +FP L+  YL+ P+S +   ++KPFIKFICH++SY+ FL LL+LA+  I        + +G  PT +EW+++ ++ GFIW E+K++W+ G + YI D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:   33 EKAYLSAVERGDYGSVKRALDEAEIYFKININCVDPLGRTALLIAIENENLELIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPSGEKQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKLLVQKGVSVPQPHEVRCNCMECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFQLSWELQELSKVENEFKTEYEELSHQCKRFAKDLLDQTRSSRELELILNFRD-DLSLLQDQESNNE-------LARLKLAIKYRQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKFITCVFIGLLFPTLSICYLVAPKSRYGLFIRKPFIKFICHTASYLTFLFLLLLASQHIVST---KPNLQGPAPTTVEWMILPWVLGFIWTEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYVKYSG 462          

HSP 2 Score: 310.071 bits (793), Expect = 0.000e+0
Identity = 151/310 (48.71%), Postives = 211/310 (68.06%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
            R KW+ + PTL++E +FA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  K    C   +                  C  +   F++LFE +QSL+WS +GL+ L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+I+YL  W K++   +   +   +  + +  ++   +  +YQ+V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E+L ++K N
Sbjct:  466 RDKWEMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYDTKDDRVCKGIR------------------CEHQNNAFSTLFETLQSLFWSIFGLIGLYVTNVQADHKFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPTPFNIIPSPKSIWYLITWIKIHVFRRKSKRTETFGVLGRRAAEKVRLNNQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMKGN 757          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc4a (short transient receptor potential channel 4-like [Source:NCBI gene;Acc:103035222])

HSP 1 Score: 361.303 bits (926), Expect = 0.000e+0
Identity = 222/444 (50.00%), Postives = 311/444 (70.05%), Query Frame = 2
Query:  344 LERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            LE+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++E++ELLL +++ +GDALLHAI +E   AVE+++N + +    +          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+AL+SPSLIALSS+DP LTAF LSWEL+ L ++ENEFK EYE LS +C+ FA+ LL+QTR S EL ++LN+ +       +N    + + D   LARLKLA++Y+QK FVA P+CQQLLAS WY+  PG+RRR +  K      I  +FP+ +  YL+ P+S +   ++KPFIKFICH++SY+ FL LL+LA+  I  +   +   +G  P  +EW+++ ++ GFIW E+K++W+ G + Y+ D WNL+DF  NSLY+ATISL+ VAY K S  N
Sbjct:   32 LEKAYLNAVEKGDYASVKQSLEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKQRGGMQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYRALSSPSLIALSSEDPFLTAFRLSWELEELSKVENEFKYEYEELSQQCKQFAKNLLDQTRSSRELELILNYRDD------INPLEDEGVND---LARLKLAVRYHQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAVKFITCIFIGLLFPLFSIFYLVAPKSHYGLFIRKPFIKFICHTASYLTFLFLLLLASQHITGSKALS---QGPPPNTVEWMILPWVLGFIWAEIKQMWDGGFQDYVHDWWNLMDFVMNSLYLATISLKVVAYLKYSGSN 463          

HSP 2 Score: 310.071 bits (793), Expect = 0.000e+0
Identity = 154/311 (49.52%), Postives = 212/311 (68.17%), Query Frame = 1
Query: 1684 GRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
             R  WD + PTL++E +FA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + +  K+               C  +   FT+LFE +QSL+WS +GL+DL   N+   H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+++Y   W K N    +  K   + +I +  ++   +  +YQ+V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E++ ++K N
Sbjct:  464 ARESWDMWHPTLVAEAVFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETDASNSTKWCKGIR----------CEHQNNAFTTLFETLQSLFWSIFGLIDLHVTNVGPDHRFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVWYFVRWIKRNVFRVAATKTETFGTISRRAAENVRINHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVMGMMKGN 759          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc5b (transient receptor potential cation channel, subfamily C, member 5b [Source:ZFIN;Acc:ZDB-GENE-091112-24])

HSP 1 Score: 372.859 bits (956), Expect = 9.386e-156
Identity = 226/438 (51.60%), Postives = 309/438 (70.55%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER +L AVE+ D A +K  L  ++     NINC DPLGR+A+LIAIE E++E++ELLL + + +GDALL+AI +E   AVE++++ +    +++       +  S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ LASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +    +  L+ R      +   LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RRR ++ K+   F I  +FP+ + IYL+ P+S     +KKPFIKFICH++SY+ FL LL+LA+  I    L     +G  PT++EW+++ ++ GFIW E+KE+W+ G   Y+ D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 ERAYLTAVEKGDYAGVKMALQEAEIYYNININCLDPLGRSALLIAIENENLEVMELLLSHGVQVGDALLYAIRKEVVGAVELLLSHRKPSGEKQVPALMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKTLASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKLFAKDLLDQARSSRELETILNHRDD--HSEELDPR------ECRDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRRHWVVKLVTCFTIGLLFPVFSIIYLLAPKSALGFFIKKPFIKFICHTASYLTFLFLLLLASQHIVRTDLH---VQGPPPTIVEWMILPWVLGFIWAEIKEMWDGGFTEYVHDWWNLMDFAMNSLYLATISLKMVAYLK 459          

HSP 2 Score: 199.904 bits (507), Expect = 9.386e-156
Identity = 119/312 (38.14%), Postives = 178/312 (57.05%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNL--NLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET + D+  +        QN  +           S F I+  L  + + L  L +   +L+ P                 +++ + +   IAM     Q   + ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+++YL  W       + + ++   H  + +     +      +V+ NL+ RY+    ++ + +EG+TE++  E+K DIS+FR+E+LD+L N 
Sbjct:  466 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETEAADEPNHCKGIRCEKQNNAF-----------STFIIITFL--TVFALTALEDTFKDLKIP-----------------LSIAMFITRFIAMFPLPPQ---DHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLCVWLHSRLCGRGQPRQEEEHKHENLKEFTVKTVLLRNEVIRNLVKRYVAAMIRRTKTDEGLTEENFKELKQDISSFRYEVLDLLGNR 739          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Match: trpc7a (short transient receptor potential channel 7-like [Source:NCBI gene;Acc:103035292])

HSP 1 Score: 269.24 bits (687), Expect = 2.144e-133
Identity = 188/486 (38.68%), Postives = 281/486 (57.82%), Query Frame = 2
Query:  299 PDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIII-NAQIE-----VH---DQKPSTD----YTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXR--IEYNHLENDD--------YRGNTPTV--IEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI 1675
            P  M  E R  +    E +FL A E  +I  +++ L+ S+    N+NC D +G+NA+ +A+  E+  +  L L  +    +GDALL AI++     VE I+ +   E      H   +Q+P  D    Y  +  + F+ D+TP+ILA+H   YEI+ +LL +G RI KPHD  C C  C+ESQKQDS  HS+SR+NAY+ LAS + ++LSS+DP+LTA ELS EL +L  +E EFK +Y  LS +C+DF   +L+  R +EE+  +L   NG   + T  E N         L+R+KLAIKY  K FVAHP+CQQ L +LWYE L G R++P   K   + G+    P LA  Y I P S    +++ PF+KF+ H+ S+  FL LL+L A    +   +L N+         +R  T      E +++ ++ G IW E KE+WE+G + YIM +WN+LDF   S+++A+ + R +A+ ++SN  +
Sbjct:   83 PAYMFSE-RGTSLTAEEERFLDAAEYGNIPVVRKMLEESKT--LNVNCMDYMGQNALQLAVGNEHLEVTELLLKTEGLARIGDALLLAISKGYVRIVEAILAHPAFEGGLRFAHSPLEQEPREDDFYAYDED-GTRFSQDVTPVILAAHCQEYEIVHILLLKGARIEKPHDHFCKCSECMESQKQDSFSHSRSRMNAYKGLASAAYLSLSSEDPVLTALELSNELSQLANIETEFKNDYRKLSMQCKDFVVGVLDLCRNTEEVEAIL---NGDVDHNTPREHNRPC------LSRVKLAIKYEVKKFVAHPNCQQQLLTLWYENLSGLRQQPIGVKCLTVLGVMVGLPFLAIAYWIMPYSKVGQVLRSPFMKFVAHAVSFTTFLGLLVLNASDRFLGVKNLPNETITDHPRQVFRVKTTQFSWTEMLIMKWVLGMIWSECKEIWEDGPREYIMHLWNILDFGMLSIFIASYTARLMAFLRASNAQL 555          

HSP 2 Score: 229.18 bits (583), Expect = 2.144e-133
Identity = 129/333 (38.74%), Postives = 194/333 (58.26%), Query Frame = 1
Query: 1672 YYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCL---CKSKGKK-----------SR--------WHSIKKIVSKVNEMEQ--RYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLD 2598
            Y+   R +W   DP LISE L++ A + S  ++ YI   N + GPLQISLGR + DI KF +I+++V +AF  G+  L  +Y   +                       YN        FT++ E  ++L+WS +GL ++ ++ L+Y H+F E +G +++G Y+   +IVLLNMLIAM+N SYQ I E AD+EWKFAR+KLW+SYF++G TLP PFN++ SPK+ YY+    +  CL   CK++G++           SR        +H+ ++   K N ++   RYQK+M  LI RY+L  Q   +N+ + E +L EIK DIS+ R+ELL+
Sbjct:  577 YFTYARNRWLPSDPQLISEGLYSIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYLGAK-----------------------YN------PAFTTVEESFKTLFWSIFGLSEVISVVLKYDHKFIENIGYVLYGVYNVTMVIVLLNMLIAMINHSYQEIEEDADVEWKFARAKLWLSYFDEGRTLPPPFNLVPSPKSFYYMALRTRA-CLVRQCKARGRRHGSQRDMDIPGSRTKLHRFRSYHAQEEYTVK-NPIKHPTRYQKLMKRLIKRYVLKAQTDSENDEINEGELKEIKQDISSLRYELLE 878          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 334.339 bits (856), Expect = 1.626e-135
Identity = 178/344 (51.74%), Postives = 239/344 (69.48%), Query Frame = 2
Query:  635 DYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            ++    SS FTPD+TPIILA+H +NYE+IKLLL RG  +P+PH +RCAC  C    + D LRHS+SR+  Y+ALASP L+AL+S+DP LTAF LS EL  L R+ENEFKAEYE LS +C+ FA+ LL+QTR + EL I+LN+   S          A    D   L RLKLAIKY+QK FVA P+CQQLLASLWY+G PG+RRR +  K+     +  +FP+ +  YL+ PRS  A  ++KPFIKFICH++SY+ FL LL+LA+ +I      + + +G +PT++EW+++ +I   IW E+K++W+ G   Y+ D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:    5 EFAEGHSSEFTPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEES--------DGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIART---DPNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSG 337          

HSP 2 Score: 168.703 bits (426), Expect = 1.626e-135
Identity = 96/238 (40.34%), Postives = 142/238 (59.66%), Query Frame = 1
Query: 1684 GRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFY---AKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNT-SYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLC 2385
             R +W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y   A +  +TC   +                  C  +   F++L   ++ L+ S    V L        H FT     + F  + ++++ V L   +++ +  +++   + ADIEWKFAR+KLW+SYFE+G TLP PFNI+ SPK+ +YL  + +  C+C
Sbjct:  340 AREQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETSAGQGNDTCKGIR------------------CEKQNNAFSTLCNCLKHLFPSVSICVHLCPSGSICFHLFTSV--SICFHLFPYVSICVHLFPSVSITSCNAFKNTVDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVRA-CIC 556          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc4b (transient receptor potential cation channel, subfamily C, member 4b [Source:ZFIN;Acc:ZDB-GENE-120329-1])

HSP 1 Score: 328.946 bits (842), Expect = 2.808e-131
Identity = 175/334 (52.40%), Postives = 234/334 (70.06%), Query Frame = 2
Query:  665 TPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            TPD+TPIILA+H +NYE+IKLLL RG  +P+PH +RCAC  C    + D LRHS+SR+  Y+ALASP L+AL+S+DP LTAF LS EL  L R+ENEFKAEYE LS +C+ FA+ LL+QTR + EL I+LN+   S          A    D   L RLKLAIKY+QK FVA P+CQQLLASLWY+G PG+RRR +  K+     +  +FP+ +  YL+ PRS  A  ++KPFIKFICH++SY+ FL LL+LA+ +I      + + +G +PT++EW+++ +I   IW E+K++W+ G   Y+ D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:    1 TPDMTPIILAAHTNNYELIKLLLTRGVSVPRPHAVRCACLQCAAGSEADGLRHSRSRLAVYRALASPCLVALASEDPFLTAFTLSCELCELSRVENEFKAEYEELSQQCKQFAKELLDQTRSTRELEIVLNYKEES--------DGAPEAPDAFNLERLKLAIKYHQKEFVAQPNCQQLLASLWYDGFPGWRRRHWAVKLVTCATLGLLFPLFSVCYLLAPRSRMAFFLRKPFIKFICHTASYLTFLFLLLLASQQIART---DPNMQGPSPTLVEWMILPWICRLIWAEIKQMWDGGFSEYVHDWWNLMDFVMNSLYLATISLKLVAYLKYSG 323          

HSP 2 Score: 160.229 bits (404), Expect = 2.808e-131
Identity = 94/238 (39.50%), Postives = 139/238 (58.40%), Query Frame = 1
Query: 1684 GRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTY----SFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLC 2385
             R +W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y     ET +   N          QN  ++       +FTS+        + +  +    ++++ +   +T+    ++   Y     F + IV    +I    +    + + ADIEWKFAR+KLW+SYFE+G TLP PFNI+ SPK+ +YL  + +  C+C
Sbjct:  326 AREQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY-----ETSAGQGNDTCKGIRCEKQNNAFS------TWFTSVSICFHLFPYVSICVHLFPSVSIFF---YTDKRKNMLNAAYLREMHFSSAIVACQTIIRASASDPNHVEDHADIEWKFARTKLWMSYFEEGATLPPPFNIVPSPKSAWYLCRYVRA-CIC 548          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: trpc3 (transient receptor potential cation channel, subfamily C, member 3 [Source:ZFIN;Acc:ZDB-GENE-140129-1])

HSP 1 Score: 214.157 bits (544), Expect = 7.848e-107
Identity = 118/334 (35.33%), Postives = 191/334 (57.19%), Query Frame = 1
Query: 1669 KYYFMGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFF-----------WFK--------MNCL-CKSK----GKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLD 2598
            +Y+ + R  W   DP +ISE L++ A + S  ++ YI   N + GPLQISLG+ + DI KF +I+++V +AF  G+  L  +Y   +V                              + F ++ E  ++L+WS +GL +++++ + Y H+F E +G +++G Y+   ++VLLNMLIAM+N+SYQ I + +D+EWKFAR+KLWISYFE G TLPVPFN++ SPK+   L             W K        M+ L  K+K     +++   ++ + ++ + +   RYQ++M  LI RY+L  Q  ++N+ V E +L +IK DIS+ R+ELL+
Sbjct:  467 RYFNLARSHWLPSDPQIISEGLYSIAIVLSFSRIAYILPANESFGPLQISLGQTVKDIFKFMVIFIMVFLAFMIGMFNLYSYYRGAKV-----------------------------NRAFVTVEESFKTLFWSIFGLSEVASVVINYNHKFIENIGYILYGVYNVTMVVVLLNMLIAMINSSYQEIEDDSDVEWKFARAKLWISYFEQGRTLPVPFNLVPSPKSAVQLLLAAARALGRLCRWRKHKGKLDVEMDMLDAKAKPNTLTQRALRSNMNRSMNSIGQHPTRYQQIMKRLIKRYVLKAQFDKENDEVNEGELKDIKQDISSLRYELLE 771          

HSP 2 Score: 193.356 bits (490), Expect = 7.848e-107
Identity = 159/482 (32.99%), Postives = 235/482 (48.76%), Query Frame = 2
Query:  299 PDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFL-DSSQKTGFNINCRDPLGRNXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQK----PSTDYTSNL--------SSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSY------MXXXXXXXXXXXRIEYNHLENDD----YRGNTP--TVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSS 1663
            P  M  E R  +    E +FL A E  +I  ++R L D       N+NC D +G+NA+ +A+  E+  +  L L       +GDAL+ AI++     VE I+       +++    P    T +          + F+PDITPIILA+H   YEI+ +LL RG RI +PHD  C C  C E Q+ D+  HS+SRINAY+ LASP+ ++LSS+DP+LTA ELS EL  L  +E EFK +Y+ LS +C+DF   LL+  R +EE+  +LN       +  LN    D       L RLKLAIKY  K                              K+G +                         ++ PF+KF+ H++S+      ++         +++  N  E D     +R  T   T  E +++ +I G IW E KELW  G+K Y+  +WN+LDF   S++VA+ + R  A+ K+S
Sbjct:   26 PAYMFSE-RATSLTAEEERFLDAAEYGNIPVVRRMLEDGGAGRSLNVNCVDYMGQNAMQLAVGNEHLEVAELLLKRDKLSRVGDALMLAISKGYVRIVEAILAHPAFAGEKRLILSPREQETQDDDFYAYDEDGTRFSPDITPIILAAHCQEYEIVHILLRRGARIERPHDYFCKCGECTEKQRHDAFSHSRSRINAYRGLASPAYLSLSSEDPVLTALELSNELAMLANIEKEFKNDYKKLSVQCKDFVVGLLDLCRDTEEVEAILN------GDAELNPPACDR--QRAALIRLKLAIKYEVK------------------------------KIGKV-------------------------LRSPFMKFVAHAASFTIFLALLVLNASDRFEGVKLLPNETETDHPQQLFRIKTTSFTWTELLIVAWIIGMIWAECKELWAEGLKEYLFQLWNVLDFGMLSIFVASFTARLFAFLKAS 443          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001180.1 (pep scaffold:Pmarinus_7.0:GL486488:994:2494:1 gene:ENSPMAG00000001058.1 transcript:ENSPMAT00000001180.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 4.064e-18
Identity = 37/82 (45.12%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 2044 EIVQSLYWSTYGLVDLSNLNLEYPH-QFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISY 2286
            E  Q L+W+ +G+ D    ++  P+ +  +FVG+ ++G Y+ I  IVLLNMLIAM+ +S++ I + AD+EWKFARS+L++SY
Sbjct:   21 ETFQYLFWTVFGMEDRRTTDI--PNFEIAQFVGRSLYGVYAIIMAIVLLNMLIAMITSSFERIEDDADVEWKFARSRLYLSY 100          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007332.1 (pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gene:ENSPMAG00000006613.1 transcript:ENSPMAT00000007332.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 2.488e-13
Identity = 59/225 (26.22%), Postives = 98/225 (43.56%), Query Frame = 1
Query: 1732 LFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNL-NLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKK 2403
            L A A  F  ++L+   + +   GP  I +  ++ D+ +F ++  +  VAF   L  L      + V    D       P  N S        +T  +   +  ++   L++S +G+ D ++L ++         +    FG Y  +TLIVL+N+LIAMM+ +YQ I  Q+D +WKF R  L +       T P P N++           W    C C+   KK
Sbjct:  435 LLAKALAFCCVQLLDFLSFHHLFGPWAIIISDLMKDLARFGMVLGIFHVAFTLHLTALC-----QPVYPQGD-------PVGNSSTAAAAWDPSTAAQ---TTLDVTVLLFFSLFGMGDQNSLPDVSRSPSIVSTLVNATFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTQWKFGRVVL-VREATRRTTPPAPLNVVTQ-------LLWLLQRCACRKACKK 636          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Yeast
Match: HBS1 (GTPase with similarity to translation release factors; together with binding partner Dom34p, facilitates ribosomal subunit dissociation and peptidyl-tRNA release when translation is stalled, particularly in 3' UTRs; genetically implicated in mRNA no-go decay; HBS1 has a paralog, SKI7, that arose from the whole genome duplication [Source:SGD;Acc:S000001792])

HSP 1 Score: 58.9214 bits (141), Expect = 6.307e-9
Identity = 30/103 (29.13%), Postives = 58/103 (56.31%), Query Frame = 1
Query: 3952 NFAFIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLDSSNNERDFKETI-LSSFHFVEINGKSFNLIDCPGNLCYYLQIIKAIMKTD 4257
            +F  +G+  +GKST++G +L  LNI +++ ++K   E+  +     K AW++D +N ER+   T+ + + HF   +  +F ++D PG+  +    I  I + D
Sbjct:  169 SFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHF-STHRANFTIVDAPGHRDFVPNAIMGISQAD 270          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Yeast
Match: SUP35 (Translation termination factor eRF3; has a role in mRNA deadenylation and decay; altered protein conformation creates the [PSI(+)] prion that modifies cellular fitness, alters translational fidelity by affecting reading frame selection, and results in a nonsense suppressor phenotype; many stress-response genes are repressed in the presence of [PSI(+)] [Source:SGD;Acc:S000002579])

HSP 1 Score: 53.9138 bits (128), Expect = 1.799e-7
Identity = 27/99 (27.27%), Postives = 51/99 (51.52%), Query Frame = 1
Query: 3961 FIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLDSSNNERDFKETILSSFHFVEINGKSFNLIDCPGNLCYYLQIIKAIMKTD 4257
            F+G+  +GKST+ GN+L      D+  I+K   EA         ++W++D++  ER+  +TI     + E   + + ++D PG+  Y  ++I    + D
Sbjct:  265 FMGHVDAGKSTMGGNLLYLTGSVDKRTIEKYEREAKDAGRQGWYLSWVMDTNKEERNDGKTIEVGKAYFETEKRRYTILDAPGHKMYVSEMIGGASQAD 363          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO45311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ7])

HSP 1 Score: 186.422 bits (472), Expect = 4.345e-66
Identity = 112/333 (33.63%), Postives = 185/333 (55.56%), Query Frame = 2
Query:  680 PIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNH--SNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNEN 1672
            P+++A+   NYE++ +L+ +G ++ KPH++ C C+ C    + D+ R S+ R++ Y+ LA+P  I+++S DP LTAFELS EL+ + R E+E++ +Y  LS +C  F   LL++ R S E   +LN+   NGS  +      N+  L+++        AI YNQK FVAHP CQ L+    +  + G+R   FLY++  +     +FP+LA IY   P       +K+PF+KFI H+SS+++FL+LL      +  +H     +R   P+ +EW++  +I G  W E K++W  G + Y    WN +D     L +    L  + +    + N
Sbjct:    1 PLVVAAQLGNYEVLNMLVSKGFQLVKPHNVLCRCEEC----QADNFRESQRRLDIYRGLANPVFISMTSNDPFLTAFELSSELEVIARREDEYEKDYLQLSQQCSQFTIGLLDECRTSREQRCILNYPGENGSVEDYA---ENSLGLVNS--------AISYNQKEFVAHPFCQHLVMQHIFGDITGWRTNHFLYRIAYVLTQVIIFPVLAVIYFFMPFLEVGRKIKRPFVKFINHTSSFVVFLILLA-----VSSHHQFEIRFR-KMPSGLEWLIFSWILGVAWSECKQVWHEGARRYFSSGWNWMDIGMVFLLLGAFVLWTIIFIVDFDSN 312          

HSP 2 Score: 85.8853 bits (211), Expect = 4.345e-66
Identity = 57/192 (29.69%), Postives = 96/192 (50.00%), Query Frame = 1
Query: 1723 SECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDG 2298
            ++ ++A   + S  +L+Y+  ++  LG LQ+SL RM+  I +F  I  +VL +F+  +  L                  Y LP     +N   +  A   K + +L   + +L W++  +V L  LN+       +F    +F  Y   +++VLLNMLIAMM+ SYQ + +  + E+KFAR++LW  Y  D 
Sbjct:  324 ADGMYAFGVVASFFRLIYLCQISRYLGLLQLSLSRMVRVIFQFAFISCVVLWSFSVAMTMLY-----------MSSFEAYQLPRP--VKNVTSDIDAILDKGYDNLLSTMVTLMWASLDMVGLDTLNVFKKQSLIQFWTAALFTLYHAASMVVLLNMLIAMMSNSYQQVEDNIETEYKFARTQLWTDYIGDA 502          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO48346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX1])

HSP 1 Score: 143.665 bits (361), Expect = 7.161e-56
Identity = 99/320 (30.94%), Postives = 160/320 (50.00%), Query Frame = 2
Query:  674 ITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSY-MXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYV 1621
            +TP+ILASH ++Y+I+KLLL +G  I + HD  C C  C    +  +  H      A  +    SL  LS KDP+  AFEL+ EL  L  +E EF+++Y  LS +CE+FA ALL+Q R   E+             + ++  + D  +  +G   L  L  AI      FVAHP+CQ +L S+ Y     + +     K+      +   P+ A +Y   P S  +  +  P +KFI H+ ++ +  LLL++ +  R   ++     +  N   +   ++ I+I G I QE+K++W  G + Y+   WNL+  A   L++
Sbjct:   64 MTPLILASHNNSYDIVKLLLSKGHTIDRVHDRGCLCPWCQSLGRIGTSLHRLYTYRALASPVYMSLTFLSCKDPVRQAFELNKELVELADIEYEFRSDYLQLSQQCEEFAVALLDQCRDMSEI------------EQMMSVPDMDGALTKNGSKSLGVLDYAINNKNGRFVAHPYCQMMLNSVIYGDFHTWEKMGVTLKILFALLFTIFIPVWAIVYFFTPTSCLSQKLATPILKFIMHTGAFGLFLLLLILSSIQRFISSNTFLLKFLFNFSDI---LITIWIFGLIVQELKDMWRQGKERYLSQWWNLVTLAMLGLFI 368          

HSP 2 Score: 94.3597 bits (233), Expect = 7.161e-56
Identity = 65/225 (28.89%), Postives = 120/225 (53.33%), Query Frame = 1
Query: 1699 DSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLL--WFYAKKRVETCSDDKNKYFLPTNNYSQNELYN-YCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLE--YPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLF 2358
            +SY   L++   F    + + L       VN  LGPLQ+SL +M+ DI+KF L++ L+ +AF   L ++   + +A K   T S                 LY+ +C+ +G         ++ ++W+ +   +L   N +  +P + T+  G+++F  ++  +++V +NMLIAMM+ S+Q +A+  D  WKF+R+++W+ Y   G+ LP PF+++ S  +I   F
Sbjct:  390 ESYRFILLANAFFTIGVLLAFLHFSNAVQVNSTLGPLQLSLVKMVKDILKFLLLFFLIYLAFVVALRRVYSQYVWAGKTPHTIS-----------------LYSVFCSVQGS--------MRLVFWAIFDKTELEEFNTDPSFPTKITQSTGEVLFALFNIASILVAINMLIAMMSNSFQKVADSEDFLWKFSRTRMWMEYIIKGSVLPAPFSVLPSIASIINFF 589          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO49302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH68])

HSP 1 Score: 127.102 bits (318), Expect = 7.261e-32
Identity = 103/349 (29.51%), Postives = 177/349 (50.72%), Query Frame = 2
Query:  674 ITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKS------RINAYQXXXXXXXXXXX------XKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG----LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYK-----VGMIFGI--SAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAY 1651
            ++P++LA H + ++II+L L +G R+ +PHD     D   +  + +      S      R+NAY+ALASP  I+        +  PI    EL+ +LK     + EF  +Y+ +S  C+ FA  LLEQ R ++E  +LL+        + + E++   +  +H     L+ L LAI+ +    VAHP  Q  L  + Y GL  F+R P +++      G +F +  + + P LA  Y+I P    + ++K P +KF  H+ +++LF + L +++    +      DY    P +I+W  ++++ G   QEVK+L+  G   YI   WN++      L++ + SLR  AY
Sbjct:  122 VSPLMLAVHLEKFDIIELFLSKGYRVLEPHDDDDEDDDDEQLNRTNVGLELSSELSFNLRVNAYRALASPLYISYFFIMNPDALHPIFHVLELNKKLKNQMYRDFEFNNDYKQISKDCQRFAVDLLEQCRTTDETNVLLDVYP---EIQRVYEKDKKHIEGSHTAFKELSMLNLAIRNDMNELVAHPQSQLRLDKILYHGLYMFKREPRVWRYRSWYTGKLFWLRHTLLLPFLALFYIIAPDCRISNVLKTPMVKFYSHTGAFVLFAIALAVSSFEDHFT-----DYTL-IPVLIDWGTLLFVLGLFLQEVKDLYFQGAFRYIRQWWNIISLLMVVLFLISYSLRLTAY 461          

HSP 2 Score: 30.4166 bits (67), Expect = 7.261e-32
Identity = 23/68 (33.82%), Postives = 39/68 (57.35%), Query Frame = 1
Query: 1714 TLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFY 1917
            +L++   FA A +FS + L     V+   GPLQ+SL  +  D++KFF+ + ++ +AF   L +L   Y
Sbjct:  482 SLLANSFFAFAMVFSFIHLTNFLQVSDVFGPLQLSLYMLFADLIKFFVFFFVLFLAFGLSLRKLYSHY 549          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO31100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYW3])

HSP 1 Score: 74.3294 bits (181), Expect = 3.054e-20
Identity = 49/202 (24.26%), Postives = 103/202 (50.99%), Query Frame = 1
Query: 1732 LFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISP 2337
            ++    +F  L++  +  +N   GPLQ++L RML D+    + +++V++AF+  + ++  ++A++ +     + N        YS      +C   G     L +  +SL WS +GL DL ++     ++    +   ++  +  I +++LLN L+A++N +Y+ I   +D EWK+ R+ ++   +   +  P P N+I  P
Sbjct:  559 MYGINTLFLILRVSSVLELNRTTGPLQLALMRMLVDLWVIIVQFVVVILAFSFAITKV--YFAQRSLAMGQTETNA------TYS-----GFCPLDGG--NCLRKTTESLVWSLFGLTDLDSIATN--NRAASTLAYYLYAIFLVICVVMLLNTLVALLNNTYEDIKSNSDTEWKYVRA-MYADQYNRCHPFPPPVNLITVP 742          

HSP 2 Score: 44.2838 bits (103), Expect = 3.054e-20
Identity = 20/61 (32.79%), Postives = 33/61 (54.10%), Query Frame = 2
Query: 1478 PTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKS 1660
            PT +E++++++  G I  EV++   +  K Y  DMWN LD      Y+  + +R V   KS
Sbjct:  484 PTAVEYVILVFFLGRILAEVQQYQRSRSKIYFRDMWNYLDITIILCYITIVIVRIVTMAKS 544          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Match: EDO31202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL0])

HSP 1 Score: 79.7221 bits (195), Expect = 9.245e-18
Identity = 36/85 (42.35%), Postives = 60/85 (70.59%), Query Frame = 1
Query: 2050 VQSLYWSTYGLVDLSNLNL-EYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGN 2301
            + SL+WS +GL +L++    +     T+  G++MFG +  I +IV +NMLIAMM  S++ IAEQAD++WK +R++LW+S+ + G+
Sbjct:    1 LNSLFWSVFGLTELNSFGTNDAKFTITKETGEVMFGFFQVIAVIVAVNMLIAMMTRSFESIAEQADVKWKVSRTRLWMSWIQKGS 85          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4a (transient receptor potential cation channel subfamily C member 4 [Source:NCBI gene;Acc:101170611])

HSP 1 Score: 378.637 bits (971), Expect = 0.000e+0
Identity = 230/446 (51.57%), Postives = 314/446 (70.40%), Query Frame = 2
Query:  341 NLERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHG---LARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN 1666
            NLE+ +L AVE+ D AS+K+ L+ ++     NINC DPLGR A+LIAIE E++E++ELLL +++ +GDALLHAI +E   AVE+++N +      +          S FTPDITPIILA+H +NYEIIKLL+ +G  +P+PH++RC C  CV S   DSLRHS+SR+N Y+AL+SPSLIALSS+DP LTAF LSWEL+ L ++ENEFK+EYE LS +C+ FA+ LL+QTR S EL ++LN+            R+  +L+D  G   LARLKLAIKY+QK FVA P+CQQLLAS WY+  PG+RRR +  K+     I  +FP+ A  YLI P+S +   ++KPFIKFICH++SY+ FL LL+LA+  I     +  + +G  PT +EW+++ ++ GFIW E+K++W+ G + YI D WNL+DF  NSLY+ATISL+ VAY K S 
Sbjct:   31 NLEKAYLGAVEKGDYASVKQALEEAEIYFKININCIDPLGRTALLIAIENENLEIIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKKPSGGMQVPPILLDKQYSDFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVECVSSSDVDSLRHSRSRLNIYKALSSPSLIALSSEDPFLTAFRLSWELQELSKVENEFKSEYEELSQQCKQFAKDLLDQTRSSRELEMILNY------------RDDINLLDDEGNNELARLKLAIKYHQKEFVAQPNCQQLLASRWYDEFPGWRRRHWAGKLITCVFIGLLFPLFAFCYLIAPKSRYGNFIRKPFIKFICHTASYLTFLFLLLLASQHIVATEQDRQNRQGPAPTTVEWMILPWVLGFIWAEIKQMWDGGFQDYIHDWWNLMDFVMNSLYLATISLKIVAYTKYSG 464          

HSP 2 Score: 305.064 bits (780), Expect = 0.000e+0
Identity = 157/312 (50.32%), Postives = 213/312 (68.27%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKS--RWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNN 2613
            R +W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  K     SD++ K                C  +   F+SLFE +QSL+WS +GL+ L   N++  HQFTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ ADIEWKFAR+KLW+SYFE+G TLP PFNII SPK+ +YL  W K   +CK    KS   + ++ +  ++      +YQ+V+ NL+ RY+    + A+  EG+TED+  E+K DIS+FR+E++ ++K  
Sbjct:  468 RNQWEMWHPTLVAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETK----ASDERGKC-----------KGIRCVEQNNAFSSLFETLQSLFWSIFGLISLYVTNVDADHQFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGATLPTPFNIIPSPKSFWYLMCWIKRR-VCKRTRLKSAENFGTLGRRAAENLRTNHQYQEVLRNLVKRYVAAMIRDAKTEEGLTEDNFKELKQDISSFRYEVMGMMKTG 763          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 375.17 bits (962), Expect = 0.000e+0
Identity = 235/451 (52.11%), Postives = 322/451 (71.40%), Query Frame = 2
Query:  344 LERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEY---NHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISW 1684
            +E+ +L AVE+ D  S+K+ L+ ++     NINC D LGR A+LIAIE E++E++ELLL Y++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYE+IKLLL RG  IP+PH +RC+C  C+ S   D LR+S+SR+N Y+ALASPSLIALSS+DP LTAF+LSWELK L R+ENEFK+EYE LS  C+ FA+ LL+QTR S+EL I+LN+ +    N  L+E        T+ LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+L+  YLI+P+S +  L++KPF+KFICH++SY+ FLLLL LA+  I+    N L + D +G  PT +EW+++ +I GFIW E+K++W+NG++ Y  D WN++DF  NSLY+ATI+L+ VAY K  N  +  W
Sbjct:   32 MEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQVPGILLDKQFSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDD--INPILDE-------STNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDSTGPNSLSH-DVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVKMKNHCMDDW 472          

HSP 2 Score: 293.123 bits (749), Expect = 0.000e+0
Identity = 154/317 (48.58%), Postives = 209/317 (65.93%), Query Frame = 1
Query: 1696 WDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRY-----------QKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++YA       +++K+ Y +             C  +   F++LFE VQSL+WS +GLV L   N++ PH+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ AD+EWKFAR+KLW+SYFE+G TLP PFNII SPK++ YLF W +    C+   K+ R             +  RY            +V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E+L ++K 
Sbjct:  472 WEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYA-------TEEKSCYGI------------RCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKR-FCRKPAKRIR--------QTFETLGVRYFQSYLLNIYFFSEVLKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMKG 760          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 374.015 bits (959), Expect = 0.000e+0
Identity = 227/438 (51.83%), Postives = 308/438 (70.32%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKT-GFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER +L AVE+ D A +K  L  ++     ++NC DPLGR+ +LIAIE E++E++ELLL + +  GDALL+AI +E   AVE++++ +    +++  +    +  S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +   S   L+ R        H LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RR  +  K+   F I  +FP+ + IYL+ P+S     +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   36 ERAYLTAVEKGDYAGVKHALREAEVYYNMDVNCLDPLGRSGLLIAIENENLEIMELLLDHGIHTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEE-LDPRQC------HDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 463          

HSP 2 Score: 308.145 bits (788), Expect = 0.000e+0
Identity = 158/316 (50.00%), Postives = 220/316 (69.62%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSK---GKKS-RWHSIKKIVSKVNE---MEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  K  E  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+++YL  W   N LC+     G++S +  ++++   +  +     Q YQ+V+ NL+ RY+    + A+ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  470 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGIR---------------CERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWLH-NRLCRRGQPPGEESHKCENLREFTERHADSLIQNQHYQEVIRNLVKRYVAAMIRSAKTDEGLTEENFKELKQDISSFRYEVLDLLGN 769          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc5a (short transient receptor potential channel 5 [Source:NCBI gene;Acc:101169488])

HSP 1 Score: 373.629 bits (958), Expect = 0.000e+0
Identity = 227/438 (51.83%), Postives = 308/438 (70.32%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKT-GFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            ER +L AVE+ D A +K  L  ++     ++NC DPLGR+ +LIAIE E++E++ELLL + +  GDALL+AI +E   AVE++++ +    +++  +    +  S FTPDITPI+LA+H +NYEIIKLL+ R   IP+PH +RC C  CV S + DSLRHS+SR+N Y+ALASPSLIALSS+DPILTAF L WELK L ++ENEF+ EYE LS +C+ FA+ LL+Q R S EL  +LNH +   S   L+ R        H LA+LKLAIKY+QK FVA P+CQQLLA+LWY+G PG+RR  +  K+   F I  +FP+ + IYL+ P+S     +KKPFIKFICH++SY+ FL LL+LA+  I   +L     +G  PTV+EW+++ ++ GFIW E+KE+W+ G   YI D WNL+DFA NSLY+ATISL+ VAY K
Sbjct:   33 ERAYLTAVEKGDYAGVKHALREAEVYYNMDVNCLDPLGRSGLLIAIENENLEIMELLLDHGIHTGDALLYAIRKEVVGAVELLLSHRRPSGEKQVPSLMMDSQFSEFTPDITPIMLAAHTNNYEIIKLLVQRKVTIPRPHQIRCDCVECVSSSEVDSLRHSRSRLNIYKALASPSLIALSSEDPILTAFRLGWELKELSKVENEFRQEYEELSQQCKRFAKDLLDQARSSRELETILNHRDSDQSEE-LDPRQC------HDLAKLKLAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRHHWAVKLVTCFIIGLLFPVFSMIYLLAPKSALGRFIKKPFIKFICHTASYLTFLFLLLLASQHIARTNLH---MQGPPPTVVEWMILPWVLGFIWAEIKEMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVK 460          

HSP 2 Score: 303.523 bits (776), Expect = 0.000e+0
Identity = 157/309 (50.81%), Postives = 214/309 (69.26%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            R +W+ + PTLI+E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++Y  K  E  ++ K                  C  +   F++LFE +QSL+WS +GL++L   N++  H+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQLIA+ ADIEWKFAR+KLW+SYF++G TLP PFNII SPK+++YL  W   N LC+ +G+     S K       E  + + +V+ NL+ RY+    + A+ +EG+TE++  E+K DIS+FR+E+LD+L N
Sbjct:  467 REEWEMWHPTLIAEALFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETKASEEPNNCKGIR---------------CERQNNAFSTLFETLQSLFWSIFGLLNLYVTNVKARHEFTEFVGATMFGTYNIISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSVWYLLMWLH-NRLCR-RGQPPGEESHK------CENLREFTEVIRNLVKRYVAAMIRSAKTDEGLTEENFKELKQDISSFRYEVLDLLGN 752          
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Match: trpc4b (short transient receptor potential channel 4 [Source:NCBI gene;Acc:101154885])

HSP 1 Score: 371.703 bits (953), Expect = 0.000e+0
Identity = 233/442 (52.71%), Postives = 319/442 (72.17%), Query Frame = 2
Query:  344 LERQFLLAVERSDIASIKRFLDSSQ-KTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEY---NHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYK 1657
            +E+ +L AVE+ D  S+K+ L+ ++     NINC D LGR A+LIAIE E++E++ELLL Y++ +GDALLHAI +E   AVE+++N +    +++          S FTPDITPIILA+H +NYE+IKLLL RG  IP+PH +RC+C  C+ S   D LR+S+SR+N Y+ALASPSLIALSS+DP LTAF+LSWELK L R+ENEFK+EYE LS  C+ FA+ LL+QTR S+EL I+LN+ +    N  L+E        T+ LARLKLAIKY QK FVA P+CQQLLAS WY+  PG+RRR +  K+   F I  +FP+L+  YLI+P+S +  L++KPF+KFICH++SY+ FLLLL LA+  I+    N L + D +G  PT +EW+++ +I GFIW E+K++W+NG++ Y  D WN++DF  NSLY+ATI+L+ VAY K
Sbjct:   32 MEKAYLGAVEKGDYGSVKQALEEAEIYFRININCIDSLGRTALLIAIENENLEIIELLLSYNVHVGDALLHAIRKEVVGAVELLLNHKKPRGEKQVPGILLDKQFSDFTPDITPIILAAHTNNYEVIKLLLQRGVSIPQPHAVRCSCVECMSSTDVDCLRYSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELKELSRVENEFKSEYEELSHTCKQFAKDLLDQTRSSKELEIILNYRDD--INPILDE-------STNDLARLKLAIKYCQKEFVAQPNCQQLLASRWYDKFPGWRRRHWAGKLITCFFIGLLFPLLSIFYLIFPKSRYGLLIRKPFVKFICHTASYLTFLLLLFLASQHIDSTGPNSLSH-DVQGPPPTTVEWMILPWIIGFIWTEIKQMWDNGLEDYADDWWNIMDFIMNSLYLATIALKIVAYVK 463          

HSP 2 Score: 293.893 bits (751), Expect = 0.000e+0
Identity = 154/317 (48.58%), Postives = 209/317 (65.93%), Query Frame = 1
Query: 1696 WDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRY-----------QKVMNNLIMRYLLHR-QKAEDNEGVTEDDLNEIKGDISAFRFELLDILKN 2610
            W+ + PTL++E LFA ANIFS+L+L+ +FT N +LGPLQISLGRML DI+KF  IY LVL+AFA GLNQL ++YA       +++K+ Y +             C  +   F++LFE VQSL+WS +GLV L   N++ PH+FTEFVG  MFGTY+ I+L+VLLNMLIAMMN SYQ IA+ AD+EWKFAR+KLW+SYFE+G TLP PFNII SPK++ YLF W +    C+   K+ R             +  RY            +V+ NL+ RY+    + A+  EG+TE++  E+K DIS+FR+E+L ++K 
Sbjct:  470 WEVWHPTLLAESLFAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYA-------TEEKSCYGI------------RCLQQNNAFSTLFETVQSLFWSVFGLVSLYVTNVKPPHEFTEFVGTTMFGTYNIISLVVLLNMLIAMMNNSYQHIADHADMEWKFARTKLWMSYFEEGGTLPPPFNIIPSPKSVCYLFGWIRKR-FCRKPAKRIR--------QTFETLGVRYFQSYLLNIYFFSEVLKNLVKRYVAAMIRDAKTEEGLTEENFKELKQDISSFRYEVLGMMKG 758          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000001959.1 (SMESG000001959.1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 615/623 (98.72%), Postives = 618/623 (99.20%), Query Frame = 1
Query: 3361 MFKKQSFYTXXXXXXXXXXXXXXXFTELDLDEVDRSINKIINPNFKKPQLKEDKPIFNILTSLSSQKKIITSSYHYDEPQKILFPDNYKPNMKSYNKSYIFSKYIQPLSIEYLRKWTRYCSKHKVFNFEEISEKLSVKPEIKKILPNKFCLGTDIVPSYLSKKTKAVKSIKDIKPEIQFQSVLKAFKSFKGYVSKENNFAFIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLDSSNNERDFKETILSSFHFVEINGKSFNLIDCPGNLCYYLQIIKAIMKTDSVXXXXXXXXXXXXXTENFSDINYIYFLFHLLKIFKVDKLKIIFVNGFKTDSNVPLKKIEAIWRKFSKSQLTSIVVINDLANIQSSEIKSIIDHIGGDCPMKTNEIAHEIEKPLLIEIIDIFKPIESNLPVIVGRVIKGGVFSGINNAASKVVICPEKVSCTIKSLKIHEKGELITRSSAFPGHIVELTLPEIISEDKIKIGSFICHQEHLLTINQCFQVRLVIFDCDIRVPIINGMKVFMWTPSRTCFCQLTKMLSVEYYEHREKIVKKNPRIITQSECVVNALITSEDFLAVEFHSNHXXXXXXXXXXXXXXXAGKFIDIIK 5229
            MFKKQSFYTKKSNNINSNELISSKFTELDLDEVDRSINKIINPNFKKPQLKEDKPIFNILTSLSSQKKIITSSYHYDEPQKILFPDNYKP MKSYNKSYIFSKYIQPLSIEYLRKWTRYCSKHKVFNFEEISEKLSVKPEIKKILPNKFCLGTDIVPSYLSKKTKAVKS KDIKPEIQFQSVLKAFKSFKGYVSKENNFAFIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLDSSNNERDFKETILSSFH+VEINGKSFNLIDCPGNLCYYLQIIKAIMKTDSVILIINLIIDWNINTENFSDINYIYFLFHLLKIFKVDKLKIIFVNGFKTDSNVPLKKIEAIWRKFSKSQLTSIV+INDLANIQSSEIKSIIDHIGGDCPMKT EIAHEIEKPLL+EIIDIFKPIESNLPVIVGRVIKGGVFSGINNAASKVVICPEKV CTIKSLKIHEKGELITRSSAFPGHIVELTLPEIISEDKIKIGSFICHQEHLLTINQCFQVRLVIFDCDIRVPIINGMKVFMWTPSRTCFCQLTKMLSVEYYEHREKIVKKNPRIITQSECVVNALITSEDFLAVEFHSNHKLDL LLFSELKLFSAGKFIDIIK
Sbjct:    1 MFKKQSFYTKKSNNINSNELISSKFTELDLDEVDRSINKIINPNFKKPQLKEDKPIFNILTSLSSQKKIITSSYHYDEPQKILFPDNYKPTMKSYNKSYIFSKYIQPLSIEYLRKWTRYCSKHKVFNFEEISEKLSVKPEIKKILPNKFCLGTDIVPSYLSKKTKAVKSKKDIKPEIQFQSVLKAFKSFKGYVSKENNFAFIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLDSSNNERDFKETILSSFHYVEINGKSFNLIDCPGNLCYYLQIIKAIMKTDSVILIINLIIDWNINTENFSDINYIYFLFHLLKIFKVDKLKIIFVNGFKTDSNVPLKKIEAIWRKFSKSQLTSIVIINDLANIQSSEIKSIIDHIGGDCPMKTIEIAHEIEKPLLLEIIDIFKPIESNLPVIVGRVIKGGVFSGINNAASKVVICPEKVLCTIKSLKIHEKGELITRSSAFPGHIVELTLPEIISEDKIKIGSFICHQEHLLTINQCFQVRLVIFDCDIRVPIINGMKVFMWTPSRTCFCQLTKMLSVEYYEHREKIVKKNPRIITQSECVVNALITSEDFLAVEFHSNHKLDLLLLFSELKLFSAGKFIDIIK 623          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 516/517 (99.81%), Postives = 517/517 (100.00%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVXXXXXXXXXXXXXXXXXXXXXXNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTXXXXXXXXXXXXHTMTSRSVPNIPPNIEKNQKNLSSVDTXXXXXXXXXXXXQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV 3231
            MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTNKLFSKKFNKKSHT+TSRSVPNIPPNIEKNQKNLSSVDTISRSNIIPSISSQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV
Sbjct:  503 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTNKLFSKKFNKKSHTLTSRSVPNIPPNIEKNQKNLSSVDTISRSNIIPSISSQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV 1019          

HSP 2 Score: 918.687 bits (2373), Expect = 0.000e+0
Identity = 504/506 (99.60%), Postives = 504/506 (99.60%), Query Frame = 2
Query:  176 MDSMNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISWAGR 1693
            MDSMNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIIS  GR
Sbjct:    1 MDSMNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIIS-MGR 505          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000039904.1 (SMESG000039904.1)

HSP 1 Score: 954.896 bits (2467), Expect = 0.000e+0
Identity = 516/517 (99.81%), Postives = 517/517 (100.00%), Query Frame = 1
Query: 1681 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVXXXXXXXXXXXXXXXXXXXXXXNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTXXXXXXXXXXXXHTMTSRSVPNIPPNIEKNQKNLSSVDTXXXXXXXXXXXXQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV 3231
            MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTNKLFSKKFNKKSHT+TSRSVPNIPPNIEKNQKNLSSVDTISRSNIIPSISSQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV
Sbjct:  500 MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQRFDTRSSTNTIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDEPSVSFATDLEIFAYESRENSSKLSKVTNKLFSKKFNKKSHTLTSRSVPNIPPNIEKNQKNLSSVDTISRSNIIPSISSQPLRQYNLNNSSPTLNRIYFCQDNLDVSKETRSKRSDLV 1016          

HSP 2 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 501/503 (99.60%), Postives = 501/503 (99.60%), Query Frame = 2
Query:  185 MNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIISWAGR 1693
            MNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIIS  GR
Sbjct:    1 MNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENRKNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILIAIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMLFLLLLILAALRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENIIS-MGR 502          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 540.421 bits (1391), Expect = 9.582e-172
Identity = 249/313 (79.55%), Postives = 280/313 (89.46%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTV 2625
            RPKWDSYDP LISECLF+AANIFSTLKLV IFT+NP+LGPLQISLGRMLNDI+KFF +YMLVL+AFACGLNQLLWFYAKKR + C+   +++F P+     ++LYNYCATRGKYFT+LFEIVQSLYWSTYGLVDL+ LNLEYPH+FTEFVGKLMFG YS ITL+VLLNMLIAMMNTSYQ+I E+ADIEWKFARSKLWISYFEDGNTLPVPFNIIISPK IYY   W  +N  CKSKG+KS+W SIKKIV+KVNEMEQRYQKVM NL+MRYL+ RQK ED + VTEDD+NEIKGDISAFR+ELLDILK+NGM +
Sbjct:  456 RPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEYPHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIYYFLRWIHLNWFCKSKGRKSKWQSIKKIVTKVNEMEQRYQKVMENLVMRYLMLRQKKEDKQEVTEDDINEIKGDISAFRYELLDILKSNGMDI 768          

HSP 2 Score: 533.102 bits (1372), Expect = 5.913e-169
Identity = 310/471 (65.82%), Postives = 374/471 (79.41%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN-ENIIS-----WAGRNGIPTTQHLYQ--NVF 1735
            ER FL+AVERSDI+++K +LD++    FNINCRD LGRNA+LIAI+ EH +LL+LLL+Y++DL DALL AI+EE+ E+VE+II AQ    + K   +  S+L SSFTPDITPIILA+H+DNYEIIK+LLDRGDRIPKPHDLRC+C ICVE+QK DSL HS SRINAY+ALASP LIALSSKDP+LTAFELSWEL RL RLENEF +EYE LS KCE+FA ALLEQTR S ELA+LLNH++ S     +N+ N      TH L RLKLAIKYNQKSFVA+PHCQQLLAS WYEGLPGFRR+PF+YK+ +I  +  MFP L  +YL++PRS    LM+KPFIKFICHS+SY++FL LLILAALRIE+ + E  + R N PT IE +L++YI GFIWQE+KELW  GVK YIMDMWNLLDFATN+LYVATISLRAVAYYK +N EN++      W   + I  ++ L+   N+F
Sbjct:   11 ERLFLMAVERSDISTVKSYLDNAAVLNFNINCRDSLGRNAVLIAIDNEHTDLLQLLLQYEMDLSDALLRAIDEEHLESVELIIAAQSTKTEDKNIDESRSSLISSFTPDITPIILAAHKDNYEIIKVLLDRGDRIPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNHNSTSVG---VNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEFTNSEVMESRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVAYYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIF 478          
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Match: SMESG000077497.1 (SMESG000077497.1)

HSP 1 Score: 540.806 bits (1392), Expect = 9.828e-172
Identity = 249/313 (79.55%), Postives = 280/313 (89.46%), Query Frame = 1
Query: 1687 RPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRMLNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNNYSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTEFVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKIVSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAFRFELLDILKNNGMTV 2625
            RPKWDSYDP LISECLF+AANIFSTLKLV IFT+NP+LGPLQISLGRMLNDI+KFF +YMLVL+AFACGLNQLLWFYAKKR + C+   +++F P+     ++LYNYCATRGKYFT+LFEIVQSLYWSTYGLVDL+ LNLEYPH+FTEFVGKLMFG YS ITL+VLLNMLIAMMNTSYQ+I E+ADIEWKFARSKLWISYFEDGNTLPVPFNIIISPK IYY   W  +N  CKSKG+KS+W SIKKIV+KVNEMEQRYQKVM NL+MRYL+ RQK ED + VTEDD+NEIKGDISAFR+ELLDILK+NGM +
Sbjct:  469 RPKWDSYDPILISECLFSAANIFSTLKLVSIFTMNPHLGPLQISLGRMLNDILKFFCVYMLVLIAFACGLNQLLWFYAKKRRDICAKSSHRFFQPSEKEPVSDLYNYCATRGKYFTNLFEIVQSLYWSTYGLVDLTYLNLEYPHEFTEFVGKLMFGVYSVITLVVLLNMLIAMMNTSYQIIVEKADIEWKFARSKLWISYFEDGNTLPVPFNIIISPKAIYYFLRWIHLNWFCKSKGRKSKWQSIKKIVTKVNEMEQRYQKVMENLVMRYLMLRQKKEDKQEVTEDDINEIKGDISAFRYELLDILKSNGMDI 781          

HSP 2 Score: 532.332 bits (1370), Expect = 1.425e-168
Identity = 310/471 (65.82%), Postives = 374/471 (79.41%), Query Frame = 2
Query:  347 ERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAINEENFEAVEIIINAQIEVHDQKPSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRCACDICVESQKQDSLRHSKSRINAYQXXXXXXXXXXXXKDPILTAFELSWELKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSFSNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEGLPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFICHSSSYMXXXXXXXXXXXRIEYNHLENDDYRGNTPTVIEWILIIYIAGFIWQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSN-ENIIS-----WAGRNGIPTTQHLYQ--NVF 1735
            ER FL+AVERSDI+++K +LD++    FNINCRD LGRNA+LIAI+ EH +LL+LLL+Y++DL DALL AI+EE+ E+VE+II AQ    + K   +  S+L SSFTPDITPIILA+H+DNYEIIK+LLDRGDRIPKPHDLRC+C ICVE+QK DSL HS SRINAY+ALASP LIALSSKDP+LTAFELSWEL RL RLENEF +EYE LS KCE+FA ALLEQTR S ELA+LLNH++ S     +N+ N      TH L RLKLAIKYNQKSFVA+PHCQQLLAS WYEGLPGFRR+PF+YK+ +I  +  MFP L  +YL++PRS    LM+KPFIKFICHS+SY++FL LLILAALRIE+ + E  + R N PT IE +L++YI GFIWQE+KELW  GVK YIMDMWNLLDFATN+LYVATISLRAVAYYK +N EN++      W   + I  ++ L+   N+F
Sbjct:   24 ERLFLMAVERSDISTVKSYLDNAAVLNFNINCRDSLGRNAVLIAIDNEHTDLLQLLLQYEMDLSDALLRAIDEEHLESVELIIAAQSTKTEDKNIDESRSSLISSFTPDITPIILAAHKDNYEIIKVLLDRGDRIPKPHDLRCSCQICVEAQKIDSLHHSMSRINAYKALASPCLIALSSKDPVLTAFELSWELSRLSRLENEFASEYEKLSKKCEEFATALLEQTRESSELAVLLNHNSTSVG---VNDINYGDSFQTHSLTRLKLAIKYNQKSFVANPHCQQLLASFWYEGLPGFRRKPFIYKLTIISALGFMFPGLGVVYLVFPRSKIGRLMRKPFIKFICHSASYIIFLALLILAALRIEFTNSEVMESRQNPPTAIECLLVVYICGFIWQEIKELWIAGVKCYIMDMWNLLDFATNALYVATISLRAVAYYKFNNVENLLQEQRPKWDSYDPILISECLFSAANIF 491          
The following BLAST results are available for this feature:
BLAST of Short transient receptor potential channel 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC40.000e+052.02transient receptor potential cation channel subfam... [more]
TRPC40.000e+052.02transient receptor potential cation channel subfam... [more]
TRPC50.000e+052.74transient receptor potential cation channel subfam... [more]
TRPC40.000e+052.02transient receptor potential cation channel subfam... [more]
TRPC40.000e+052.02transient receptor potential cation channel subfam... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-24.682e-11250.11TRP (Transient receptor potential) channel family;... [more]
trp-22.987e-11150.11TRP (Transient receptor potential) channel family;... [more]
trp-12.693e-6836.61Transient-receptor-potential-like protein [Source... [more]
trp-17.989e-6736.32Transient-receptor-potential-like protein [Source... [more]
spe-415.277e-1921.46TRP homologous cation channel protein; TRP-3 chann... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpgamma0.000e+053.55gene:FBgn0032593 transcript:FBtr0080945[more]
Trpgamma0.000e+053.55gene:FBgn0032593 transcript:FBtr0335144[more]
Trpgamma0.000e+053.55gene:FBgn0032593 transcript:FBtr0080946[more]
trpl2.762e-17044.25gene:FBgn0005614 transcript:FBtr0088471[more]
trpl2.762e-17044.25gene:FBgn0005614 transcript:FBtr0301662[more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b0.000e+052.38transient receptor potential cation channel, subfa... [more]
trpc4b0.000e+052.38transient receptor potential cation channel, subfa... [more]
trpc5a0.000e+052.16transient receptor potential cation channel, subfa... [more]
trpc5b0.000e+052.16transient receptor potential cation channel, subfa... [more]
trpc5a0.000e+052.16transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPC50.000e+052.51transient receptor potential cation channel, subfa... [more]
hint10.000e+051.59histidine triad nucleotide binding protein 1 [Sour... [more]
TRPC14.267e-13242.18transient receptor potential cation channel, subfa... [more]
TRPC17.329e-13242.18transient receptor potential cation channel, subfa... [more]
TRPC19.725e-13242.18transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpc50.000e+052.74transient receptor potential cation channel, subfa... [more]
Trpc40.000e+052.02transient receptor potential cation channel, subfa... [more]
Trpc40.000e+052.02transient receptor potential cation channel, subfa... [more]
Trpc18.285e-13542.40transient receptor potential cation channel, subfa... [more]
Trpc72.730e-13236.76transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VJJ7|TRPG_DROME0.000e+053.55Transient receptor potential-gamma protein OS=Dros... [more]
sp|O62852|TRPC5_RABIT0.000e+052.74Short transient receptor potential channel 5 OS=Or... [more]
sp|Q9QX29|TRPC5_MOUSE0.000e+052.74Short transient receptor potential channel 5 OS=Mu... [more]
sp|Q9UL62|TRPC5_HUMAN0.000e+052.74Short transient receptor potential channel 5 OS=Ho... [more]
sp|Q9UBN4|TRPC4_HUMAN0.000e+052.02Short transient receptor potential channel 4 OS=Ho... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DGY40.000e+062.90ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267FS730.000e+062.67ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DTY70.000e+062.67ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267DBT50.000e+062.67ANK_REP_REGION domain-containing protein OS=Macros... [more]
A0A267F9690.000e+059.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc5a0.000e+051.83short transient receptor potential channel 5-like ... [more]
trpc4b0.000e+052.15short transient receptor potential channel 4-like ... [more]
trpc4a0.000e+050.00short transient receptor potential channel 4-like ... [more]
trpc5b9.386e-15651.60transient receptor potential cation channel, subfa... [more]
trpc7a2.144e-13338.68short transient receptor potential channel 7-like ... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4b1.626e-13551.74transient receptor potential cation channel, subfa... [more]
trpc4b2.808e-13152.40transient receptor potential cation channel, subfa... [more]
trpc37.848e-10735.33transient receptor potential cation channel, subfa... [more]
ENSPMAT00000001180.14.064e-1845.12pep scaffold:Pmarinus_7.0:GL486488:994:2494:1 gene... [more]
ENSPMAT00000007332.12.488e-1326.22pep scaffold:Pmarinus_7.0:GL483392:1130:9476:1 gen... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HBS16.307e-929.13GTPase with similarity to translation release fact... [more]
SUP351.799e-727.27Translation termination factor eRF3; has a role in... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453114.345e-6633.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483467.161e-5630.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493027.261e-3229.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311003.054e-2024.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312029.245e-1842.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpc4a0.000e+051.57transient receptor potential cation channel subfam... [more]
trpc4b0.000e+052.11short transient receptor potential channel 4 [Sour... [more]
trpc5a0.000e+051.83short transient receptor potential channel 5 [Sour... [more]
trpc5a0.000e+051.83short transient receptor potential channel 5 [Sour... [more]
trpc4b0.000e+052.71short transient receptor potential channel 4 [Sour... [more]
back to top
BLAST of Short transient receptor potential channel 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001959.10.000e+098.72SMESG000001959.1[more]
SMESG000039904.10.000e+099.81SMESG000039904.1[more]
SMESG000039904.10.000e+099.81SMESG000039904.1[more]
SMESG000077497.19.582e-17279.55SMESG000077497.1[more]
SMESG000077497.19.828e-17279.55SMESG000077497.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006424 ID=SMED30006424|Name=Short transient receptor potential channel 4|organism=Schmidtea mediterranea sexual|type=transcript|length=5280bp
AATTAATACTCGTATTCAGGATTGCGATTATATATATAAGAAATATTAAT
CAATTTAAAGGATCAAATATTTATTTTGAAAATTAATTTATTTATCCTTA
ACATTTTTTATTCGCAAAATTATGAGATAGCTGACAAACTTTTGGAAATA
TAATTCGACTGAAGCTCGACGAGAAATGGACAGCATGAATTTAGAATCAA
TTTCCAATAACCTACACCAAAAACAAAACAATGCTCGATATAATTCAATT
GTACCGGATAATAACCAGAAATTATTGCATAATTCACGAATATTTCTTCC
GGATTTAATGTTGGATGAAAATCGGAAAAATAATTATCCCAACTTAGAAC
GACAATTTCTCTTAGCAGTTGAACGCAGTGACATTGCCTCAATCAAGCGG
TTTTTGGATAGTAGTCAAAAAACTGGATTTAACATAAACTGTCGCGATCC
TCTAGGGCGAAATGCGATTTTAATTGCCATTGAATATGAGCACATTGAAT
TGCTGGAACTTCTGTTGAAATACGATTTAGATTTGGGAGACGCGTTATTG
CATGCGATAAATGAGGAGAATTTCGAAGCAGTTGAAATAATTATCAATGC
TCAAATTGAGGTCCACGATCAAAAGCCCTCGACTGACTATACCTCAAATC
TATCAAGTTCTTTCACTCCTGACATCACTCCTATTATTTTGGCTTCACAT
AGAGATAATTATGAGATTATAAAACTTCTTCTCGATCGAGGCGACAGAAT
TCCGAAACCTCACGATTTACGTTGTGCATGCGACATATGCGTCGAATCAC
AAAAACAAGACTCTCTTCGTCATTCTAAATCTCGAATAAATGCATATCAA
GCATTAGCATCTCCGTCTTTGATTGCTTTATCTAGCAAAGACCCCATATT
AACTGCATTTGAACTGAGCTGGGAGCTAAAACGATTAGGAAGATTAGAAA
ATGAGTTTAAAGCTGAATACGAAATACTTTCCACTAAATGTGAAGATTTT
GCTCGAGCTCTTCTTGAGCAAACTCGGGGTTCTGAAGAACTTGCTATCCT
TCTTAATCACAGCAATGGATCATTCTCTAATCGTACACTTAACGAAAGAA
ATGCAGATTCCCTCATCGACACTCACGGATTAGCAAGACTAAAATTAGCA
ATAAAGTACAATCAAAAATCATTTGTAGCTCATCCTCACTGTCAACAGTT
ACTGGCATCTCTGTGGTATGAAGGCCTTCCAGGGTTTCGAAGAAGACCGT
TTCTTTATAAAGTAGGCATGATATTCGGAATCAGTGCAATGTTTCCAATG
TTGGCGACCATATATTTAATTTATCCACGCAGCACCTTTGCCGGACTAAT
GAAAAAACCTTTCATAAAATTTATTTGCCACAGTAGCAGCTATATGTTAT
TCTTGTTGCTTTTAATTCTTGCAGCCCTCCGAATAGAATATAATCACCTA
GAAAATGACGACTACCGGGGCAATACCCCGACGGTGATCGAATGGATCCT
CATAATATATATCGCTGGATTTATTTGGCAGGAGGTCAAAGAGTTATGGG
AAAATGGTGTCAAGGGATACATCATGGATATGTGGAATTTATTGGACTTT
GCCACTAATTCCCTTTATGTAGCTACAATCAGTTTGAGAGCAGTCGCATA
TTATAAATCATCAAATGAAAATATTATTTCATGGGCAGGCCGAAATGGGA
TTCCTACGACCCAACACTTATATCAGAATGTCTTTTTGCAGCAGCTAATA
TTTTCAGCACACTGAAATTGGTTTATATTTTCACCGTAAATCCAAATCTC
GGACCTCTTCAGATTTCTCTTGGAAGAATGTTGAACGATATTATGAAGTT
CTTTCTCATCTACATGCTGGTATTGGTGGCATTTGCATGTGGCCTTAATC
AGTTATTGTGGTTCTATGCCAAGAAACGAGTTGAAACTTGCTCAGATGAT
AAAAACAAATACTTTTTGCCAACAAACAATTACAGCCAAAACGAACTTTA
CAATTACTGTGCAACAAGAGGAAAATATTTTACTAGCTTGTTCGAGATAG
TCCAAAGTCTGTACTGGAGCACATATGGACTCGTAGACCTCAGTAACTTA
AATTTAGAATATCCTCACCAATTCACCGAATTTGTAGGTAAATTGATGTT
TGGAACCTACTCGTTCATAACGCTGATTGTGCTTCTGAACATGCTAATAG
CAATGATGAACACTTCCTATCAGTTAATTGCAGAGCAAGCTGATATTGAG
TGGAAATTTGCAAGATCGAAACTGTGGATCAGTTATTTTGAAGATGGAAA
TACTCTCCCAGTTCCTTTCAATATTATCATCAGTCCCAAAACAATATATT
ATTTGTTTTTCTGGTTTAAAATGAACTGCCTTTGTAAATCTAAAGGCAAA
AAAAGTCGTTGGCATAGTATAAAAAAAATCGTATCAAAAGTTAATGAAAT
GGAACAGAGATATCAAAAAGTGATGAACAATCTAATTATGAGATATTTAT
TACATCGTCAAAAGGCCGAAGATAATGAGGGAGTCACTGAAGATGACTTG
AATGAAATCAAAGGAGATATTAGCGCATTTAGATTTGAATTATTAGATAT
TCTTAAAAATAATGGAATGACTGTCAATGTTTCCTCCGATCGAGGATTAA
GATCAAAATTGCGGAGGAAAGGTAGTAAAAAGTCAATGAGCAGACTTAAT
CAAAGATTTGACACGAGATCTTCAACAAACACCATTGATCAGTTAGGCAG
TATTAGTGAAATATCTACCCCAATGAAAAGTAAAAAGTCTTTAATATCCT
ATACATCATTAGAAAAGTCCAAACCAACGACCAAATACAAAAAAGACCGG
CCTAAAAAATCTTTCTCCTTAGAAGATGAACCATCAGTTTCATTTGCAAC
AGATCTCGAAATATTTGCTTATGAATCACGAGAAAACTCTTCCAAACTCT
CCAAAGTTACCAATAAGTTATTTTCTAAGAAATTTAACAAAAAGTCACAC
ACAATGACATCGCGATCTGTTCCGAATATCCCGCCAAATATTGAGAAAAA
CCAAAAGAATTTATCTAGTGTTGATACGATTTCTAGATCCAATATTATTC
CATCCATTTCCTCTCAGCCTCTTCGTCAGTACAACTTAAATAACAGTTCC
CCAACTCTAAACCGAATCTATTTTTGCCAAGATAATCTTGATGTTTCGAA
AGAAACTCGGTCTAAACGAAGCGATCTCGTGTGACAAATCGTTACTCGGA
GACCAAGAGCATTTATGTGAAAACTTTCAATTGTTTTGTAGTTAAAAGTC
AAAAAGGTTTTTTTTAAATTTTAAAATTAAAGTTCAGCATATTTTTGTTT
TGAAAAAGGTATGTTTAAAAAACAAAGCTTTTATACTAAAAAATCAAATA
ATATCAATTCTAATGAATTGATATCCTCAAAATTCACAGAGCTAGATCTT
GATGAAGTAGACAGATCTATTAATAAAATAATAAATCCGAATTTTAAAAA
ACCTCAGTTAAAAGAAGATAAACCTATATTTAATATTCTTACCTCATTGT
CTTCTCAGAAAAAAATAATAACTTCATCATACCACTATGATGAACCCCAG
AAAATCTTGTTTCCAGATAACTATAAGCCTAACATGAAATCATATAATAA
ATCTTACATTTTTAGTAAATATATTCAGCCTCTTAGTATAGAATATTTAA
GAAAATGGACTCGATATTGTAGTAAACACAAAGTTTTTAATTTTGAAGAA
ATTTCTGAAAAACTTTCAGTAAAGCCAGAAATCAAAAAGATATTGCCAAA
TAAATTTTGTCTCGGTACAGATATTGTACCAAGTTATTTGAGTAAAAAGA
CTAAAGCTGTTAAATCAATAAAAGATATAAAACCTGAAATACAATTTCAG
TCAGTCTTGAAAGCTTTCAAGTCGTTTAAAGGTTATGTATCTAAAGAAAA
TAATTTTGCTTTTATTGGATATCCAAAATCAGGGAAAAGTACAGTCCTTG
GAAATATTTTACTTCATTTAAATATCTTTGATGAAGCTTTTATCAAGAAA
ACTGGATGGGAAGCTACAAAATTGGATTCTGTATATTCAAAAATTGCTTG
GTTATTAGATTCTTCTAACAATGAAAGGGATTTTAAGGAAACAATTTTGT
CTTCATTTCATTTCGTTGAGATAAATGGTAAATCATTCAATTTAATAGAT
TGCCCTGGAAACTTGTGTTATTATTTACAAATTATAAAAGCGATAATGAA
AACCGACTCAGTAATTCTAATAATCAATTTAATTATAGATTGGAATATAA
ATACAGAAAACTTCAGTGATATCAATTATATTTATTTTCTATTTCATTTA
CTCAAAATTTTTAAAGTTGATAAATTAAAAATTATCTTTGTCAATGGTTT
TAAAACCGATTCAAACGTTCCACTGAAAAAAATTGAAGCGATTTGGAGAA
AATTTTCGAAATCACAATTAACAAGTATTGTTGTTATAAATGACTTGGCT
AATATTCAATCTTCTGAAATCAAATCAATTATCGATCATATTGGCGGTGA
TTGTCCAATGAAAACCAATGAAATTGCTCACGAAATCGAGAAACCCTTAT
TAATTGAAATTATCGATATTTTCAAGCCAATCGAATCGAATCTTCCTGTA
ATCGTTGGTCGCGTTATTAAAGGTGGAGTATTTTCTGGAATTAATAATGC
AGCGAGCAAAGTTGTAATTTGTCCAGAAAAAGTCTCGTGTACAATTAAAT
CGTTGAAAATACACGAAAAAGGTGAATTGATAACAAGGTCATCGGCTTTC
CCTGGACATATTGTTGAATTAACTTTACCGGAAATCATATCAGAAGACAA
AATCAAAATTGGCAGTTTTATTTGTCACCAAGAGCATTTATTAACAATTA
ATCAATGTTTTCAAGTCCGGTTAGTAATATTCGATTGTGACATCAGAGTT
CCAATTATTAATGGAATGAAAGTGTTTATGTGGACTCCATCACGAACCTG
TTTTTGCCAGTTGACCAAAATGTTATCCGTTGAATATTATGAACATAGAG
AGAAAATTGTCAAAAAGAATCCTCGAATAATTACACAGTCAGAGTGCGTT
GTGAATGCTCTGATAACTTCTGAGGATTTTCTGGCTGTTGAATTTCATTC
AAATCATAAATTGGATTTGTTCTTGTTATTTTCAGAGCTTAAATTATTTT
CAGCCGGGAAATTTATTGATATTATCAAATAATATTTATTAGTTAACATT
TGTTGGTTCTTCTTTGTTTACTGTATTGCA
back to top

protein sequence of SMED30006424-orf-1

>SMED30006424-orf-1 ID=SMED30006424-orf-1|Name=SMED30006424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=624bp
MFKKQSFYTKKSNNINSNELISSKFTELDLDEVDRSINKIINPNFKKPQL
KEDKPIFNILTSLSSQKKIITSSYHYDEPQKILFPDNYKPNMKSYNKSYI
FSKYIQPLSIEYLRKWTRYCSKHKVFNFEEISEKLSVKPEIKKILPNKFC
LGTDIVPSYLSKKTKAVKSIKDIKPEIQFQSVLKAFKSFKGYVSKENNFA
FIGYPKSGKSTVLGNILLHLNIFDEAFIKKTGWEATKLDSVYSKIAWLLD
SSNNERDFKETILSSFHFVEINGKSFNLIDCPGNLCYYLQIIKAIMKTDS
VILIINLIIDWNINTENFSDINYIYFLFHLLKIFKVDKLKIIFVNGFKTD
SNVPLKKIEAIWRKFSKSQLTSIVVINDLANIQSSEIKSIIDHIGGDCPM
KTNEIAHEIEKPLLIEIIDIFKPIESNLPVIVGRVIKGGVFSGINNAASK
VVICPEKVSCTIKSLKIHEKGELITRSSAFPGHIVELTLPEIISEDKIKI
GSFICHQEHLLTINQCFQVRLVIFDCDIRVPIINGMKVFMWTPSRTCFCQ
LTKMLSVEYYEHREKIVKKNPRIITQSECVVNALITSEDFLAVEFHSNHK
LDLFLLFSELKLFSAGKFIDIIK*
back to top

protein sequence of SMED30006424-orf-2

>SMED30006424-orf-2 ID=SMED30006424-orf-2|Name=SMED30006424-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=530bp
MDSMNLESISNNLHQKQNNARYNSIVPDNNQKLLHNSRIFLPDLMLDENR
KNNYPNLERQFLLAVERSDIASIKRFLDSSQKTGFNINCRDPLGRNAILI
AIEYEHIELLELLLKYDLDLGDALLHAINEENFEAVEIIINAQIEVHDQK
PSTDYTSNLSSSFTPDITPIILASHRDNYEIIKLLLDRGDRIPKPHDLRC
ACDICVESQKQDSLRHSKSRINAYQALASPSLIALSSKDPILTAFELSWE
LKRLGRLENEFKAEYEILSTKCEDFARALLEQTRGSEELAILLNHSNGSF
SNRTLNERNADSLIDTHGLARLKLAIKYNQKSFVAHPHCQQLLASLWYEG
LPGFRRRPFLYKVGMIFGISAMFPMLATIYLIYPRSTFAGLMKKPFIKFI
CHSSSYMLFLLLLILAALRIEYNHLENDDYRGNTPTVIEWILIIYIAGFI
WQEVKELWENGVKGYIMDMWNLLDFATNSLYVATISLRAVAYYKSSNENI
ISWAGRNGIPTTQHLYQNVFLQQLIFSAH*
back to top

protein sequence of SMED30006424-orf-3

>SMED30006424-orf-3 ID=SMED30006424-orf-3|Name=SMED30006424-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MGRPKWDSYDPTLISECLFAAANIFSTLKLVYIFTVNPNLGPLQISLGRM
LNDIMKFFLIYMLVLVAFACGLNQLLWFYAKKRVETCSDDKNKYFLPTNN
YSQNELYNYCATRGKYFTSLFEIVQSLYWSTYGLVDLSNLNLEYPHQFTE
FVGKLMFGTYSFITLIVLLNMLIAMMNTSYQLIAEQADIEWKFARSKLWI
SYFEDGNTLPVPFNIIISPKTIYYLFFWFKMNCLCKSKGKKSRWHSIKKI
VSKVNEMEQRYQKVMNNLIMRYLLHRQKAEDNEGVTEDDLNEIKGDISAF
RFELLDILKNNGMTVNVSSDRGLRSKLRRKGSKKSMSRLNQRFDTRSSTN
TIDQLGSISEISTPMKSKKSLISYTSLEKSKPTTKYKKDRPKKSFSLEDE
PSVSFATDLEIFAYESRENSSKLSKVTNKLFSKKFNKKSHTMTSRSVPNI
PPNIEKNQKNLSSVDTISRSNIIPSISSQPLRQYNLNNSSPTLNRIYFCQ
DNLDVSKETRSKRSDLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR005821Ion_trans_dom
IPR013555TRP_dom
IPR027417P-loop_NTPase
IPR009000Transl_B-barrel_sf
IPR002153TRPC_channel
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005262calcium channel activity
GO:0015279store-operated calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0055085transmembrane transport
GO:0070588calcium ion transmembrane transport
GO:0006810transport
GO:0006816calcium ion transport
GO:0006828manganese ion transport
GO:0051480regulation of cytosolic calcium ion concentration
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 94..123
e-value: 1.0
score: 18.4
coord: 166..195
e-value: 1.3
score: 18.0
IPR013555Transient receptor ion channel domainPFAMPF08344TRP_2coord: 201..263
e-value: 9.4E-29
score: 99.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 46..342
e-value: 3.0E-19
score: 71.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 61..192
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 406..489
e-value: 7.4E-10
score: 38.5
NoneNo IPR availablePANTHERPTHR10117:SF51TRANSIENT RECEPTOR POTENTIAL PROTEINcoord: 50..531
NoneNo IPR availableTMHMMTMhelixcoord: 397..419
NoneNo IPR availableTMHMMTMhelixcoord: 434..452
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
IPR002153Transient receptor potential channel, canonicalPANTHERPTHR10117TRANSIENT RECEPTOR POTENTIAL CHANNELcoord: 50..531