SMED30006417

Overview
NameSMED30006417
Smed IDSMED30006417
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30006417 (SMED30006417) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30006417 (SMED30006417) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006417 (SMED30006417) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006417 (SMED30006417) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006417

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006417h1SMcG0008229 dd_Smed_v4_10279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30006417 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 96.2857 bits (238), Expect = 9.079e-23
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 9.355e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 94.3597 bits (233), Expect = 5.538e-22
Identity = 63/187 (33.69%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCE-SESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+  E   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 175          

HSP 2 Score: 54.6842 bits (130), Expect = 3.124e-8
Identity = 33/110 (30.00%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
             C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   74 ACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 177          
BLAST of SMED30006417 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 93.2041 bits (230), Expect = 1.555e-21
Identity = 63/188 (33.51%), Postives = 90/188 (47.87%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAV--CYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +  V  CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDVEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 176          

HSP 2 Score: 56.6102 bits (135), Expect = 7.346e-9
Identity = 34/116 (29.31%), Postives = 54/116 (46.55%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L  ++  C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDVEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 178          
BLAST of SMED30006417 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 92.8189 bits (229), Expect = 1.565e-21
Identity = 58/179 (32.40%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            ++ + CFKCG  GH AR C         +            ++    F     ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C  
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMR-----------SRGRGGFTSDRDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTI 163          

HSP 2 Score: 56.6102 bits (135), Expect = 6.533e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   59 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 166          
BLAST of SMED30006417 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 92.0485 bits (227), Expect = 2.482e-21
Identity = 60/182 (32.97%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +              R   F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMR----------SRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 167          

HSP 2 Score: 56.6102 bits (135), Expect = 7.886e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   62 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 169          
BLAST of SMED30006417 vs. Ensembl Celegans
Match: K08D12.3 (pep chromosome:WBcel235:IV:1710265:1711127:1 gene:WBGene00019537.1 transcript:K08D12.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08D12.3)

HSP 1 Score: 51.6026 bits (122), Expect = 9.020e-8
Identity = 42/143 (29.37%), Postives = 60/143 (41.96%), Query Frame = 3
Query:  297 CYKCNKVGHIARNC---ESES--------AVCYGCGKEGHLFKECVSSSKKVCYNCNSTE-----------HLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKK-SNKESVCYRCNRPGHLARNC 656
            CYKC + GHI+RNC   ES+         + CY C + GH  ++C                          H  +DCP         +        +  SF   +CYNC   GHI+R C +  S +E  CY+C   GH++R+C
Sbjct:    6 CYKCQQPGHISRNCPNGESDGGRRGGGGGSTCYNCQETGHFSRDCPKGGSGGGQRGGGGGGGSCYNCGGRGHYSRDCPS--ARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISRECTESGSAEEKRCYQCQETGHISRDC 146          

HSP 2 Score: 46.9802 bits (110), Expect = 3.629e-6
Identity = 45/187 (24.06%), Postives = 70/187 (37.43%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCE------------SESAVCYGCGKEGHLFKECVSS-------------------SKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSN 602
            ++   C+KC   GHI+RNC N +S      G   +                   CY C + GH +R+C                  CY CG  GH  ++C S+                     + CYNC  + H+ ++C                  T+  S    +CY C++ GHI+R+CP ++N
Sbjct:    1 MSDRNCYKCQQPGHISRNCPNGESDGGRRGGGGGS------------------TCYNCQETGHFSRDCPKGGSGGGQRGGGGGGGSCYNCGGRGHYSRDCPSARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISREC------------------TESGSAEEKRCYQCQETGHISRDCPSQTN 151          
BLAST of SMED30006417 vs. Ensembl Celegans
Match: F40F12.9 (pep chromosome:WBcel235:III:9913021:9913625:1 gene:WBGene00043995.1 transcript:F40F12.9b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40F12.9)

HSP 1 Score: 46.9802 bits (110), Expect = 1.097e-6
Identity = 20/44 (45.45%), Postives = 30/44 (68.18%), Query Frame = 3
Query:  294 ICYKCNKVGHIARNC-ESESAVCYGCGKEGHLFKECVSSSKKVC 422
            ICY C+K+GH++R+C E +   C+ CG  GH ++EC S  +K C
Sbjct:   28 ICYNCHKLGHMSRDCPEEQPKACFKCGFRGHYYRECPSQIEKKC 71          
BLAST of SMED30006417 vs. Ensembl Celegans
Match: F40F12.9 (pep chromosome:WBcel235:III:9913021:9913730:1 gene:WBGene00043995.1 transcript:F40F12.9a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40F12.9)

HSP 1 Score: 46.2098 bits (108), Expect = 3.130e-6
Identity = 19/42 (45.24%), Postives = 29/42 (69.05%), Query Frame = 3
Query:  294 ICYKCNKVGHIARNC-ESESAVCYGCGKEGHLFKECVSSSKK 416
            ICY C+K+GH++R+C E +   C+ CG  GH ++EC S  +K
Sbjct:   28 ICYNCHKLGHMSRDCPEEQPKACFKCGFRGHYYRECPSQIEK 69          
BLAST of SMED30006417 vs. Ensembl Celegans
Match: F40F12.9 (pep chromosome:WBcel235:III:9913021:9914075:1 gene:WBGene00043995.1 transcript:F40F12.9a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F40F12.9)

HSP 1 Score: 46.2098 bits (108), Expect = 3.130e-6
Identity = 19/42 (45.24%), Postives = 29/42 (69.05%), Query Frame = 3
Query:  294 ICYKCNKVGHIARNC-ESESAVCYGCGKEGHLFKECVSSSKK 416
            ICY C+K+GH++R+C E +   C+ CG  GH ++EC S  +K
Sbjct:   28 ICYNCHKLGHMSRDCPEEQPKACFKCGFRGHYYRECPSQIEK 69          
BLAST of SMED30006417 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0303464)

HSP 1 Score: 92.0485 bits (227), Expect = 1.410e-21
Identity = 60/177 (33.90%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  135 LNMS-TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSI-ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            ++MS TC+KC   GH AR+C+          G    G        +   + ++   CYKCN+ GH AR C  E+  CY C   GH+ K+C  +    CY CN T H V++CP    E   +N                 CY C   GHI++NCP+ S     CY C + GHL R C+
Sbjct:    1 MSMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNV---------------SCYKCNRTGHISKNCPETS---KTCYGCGKSGHLRRECD 159          
BLAST of SMED30006417 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0071994)

HSP 1 Score: 92.0485 bits (227), Expect = 1.410e-21
Identity = 60/177 (33.90%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  135 LNMS-TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSI-ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            ++MS TC+KC   GH AR+C+          G    G        +   + ++   CYKCN+ GH AR C  E+  CY C   GH+ K+C  +    CY CN T H V++CP    E   +N                 CY C   GHI++NCP+ S     CY C + GHL R C+
Sbjct:    1 MSMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNV---------------SCYKCNRTGHISKNCPETS---KTCYGCGKSGHLRRECD 159          
BLAST of SMED30006417 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 88.9669 bits (219), Expect = 1.823e-20
Identity = 55/181 (30.39%), Postives = 82/181 (45.30%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            + ++ S CF CG  GH  +NC N+                            K + CY+C + GHIAR+CE     CY C + GH+ ++C    K   + CYNC    H+ +DC  +   E          H  ++  +  +CY C + GH+A  C K +  E  CY C + GHLAR+C+ 
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGR-----------------GRGRGKDLFCYRCGEQGHIARDCEQTEDACYNCHRSGHISRDCKEPKKEREQCCYNCGKAGHVARDC--DHANEQKCYSCGGFGHIQKLCDKV-KCYRCGEIGHVAVQCSKAT--EVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30006417 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 88.9669 bits (219), Expect = 1.823e-20
Identity = 55/181 (30.39%), Postives = 82/181 (45.30%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            + ++ S CF CG  GH  +NC N+                            K + CY+C + GHIAR+CE     CY C + GH+ ++C    K   + CYNC    H+ +DC  +   E          H  ++  +  +CY C + GH+A  C K +  E  CY C + GHLAR+C+ 
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGR-----------------GRGRGKDLFCYRCGEQGHIARDCEQTEDACYNCHRSGHISRDCKEPKKEREQCCYNCGKAGHVARDC--DHANEQKCYSCGGFGHIQKLCDKV-KCYRCGEIGHVAVQCSKAT--EVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30006417 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 88.9669 bits (219), Expect = 1.823e-20
Identity = 55/181 (30.39%), Postives = 82/181 (45.30%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            + ++ S CF CG  GH  +NC N+                            K + CY+C + GHIAR+CE     CY C + GH+ ++C    K   + CYNC    H+ +DC  +   E          H  ++  +  +CY C + GH+A  C K +  E  CY C + GHLAR+C+ 
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGR-----------------GRGRGKDLFCYRCGEQGHIARDCEQTEDACYNCHRSGHISRDCKEPKKEREQCCYNCGKAGHVARDC--DHANEQKCYSCGGFGHIQKLCDKV-KCYRCGEIGHVAVQCSKAT--EVNCYNCGKTGHLARDCSI 159          
BLAST of SMED30006417 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 86.6557 bits (213), Expect = 1.101e-19
Identity = 54/179 (30.17%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            ++ + CF CG  GH  +NC N+                            K + CY+C + GH+AR+CE     CY CG+ GH+ ++C    K   +VCYNC    H+ +DC  +   E          H  +      +CY C + GH+A  C K S  E  CY C + GH+A+ C  
Sbjct:    1 MSSNECFGCGRTGHWIKNCPNAGRGRGK-----------------GRGRGKDLFCYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDC--DHANEQKCYSCGGFGHIQK-GCEKVKCYRCGEIGHVAVQCSKAS--EVNCYNCGKSGHVAKECTI 157          

HSP 2 Score: 60.8474 bits (146), Expect = 1.334e-10
Identity = 36/110 (32.73%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
             C+ CG  GHI+R+C   +   E +  N        R+  + N       CY C   GHI + CE     CY CG+ GH+  +C  +S+  CYNC  + H+ K+C +  T
Sbjct:   57 ACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDCDHAN----EQKCYSCGGFGHIQKGCEK--VKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHVAKECTIEAT 160          
BLAST of SMED30006417 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 86.6557 bits (213), Expect = 1.101e-19
Identity = 54/179 (30.17%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            ++ + CF CG  GH  +NC N+                            K + CY+C + GH+AR+CE     CY CG+ GH+ ++C    K   +VCYNC    H+ +DC  +   E          H  +      +CY C + GH+A  C K S  E  CY C + GH+A+ C  
Sbjct:    1 MSSNECFGCGRTGHWIKNCPNAGRGRGK-----------------GRGRGKDLFCYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDC--DHANEQKCYSCGGFGHIQK-GCEKVKCYRCGEIGHVAVQCSKAS--EVNCYNCGKSGHVAKECTI 157          

HSP 2 Score: 60.8474 bits (146), Expect = 1.334e-10
Identity = 36/110 (32.73%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
             C+ CG  GHI+R+C   +   E +  N        R+  + N       CY C   GHI + CE     CY CG+ GH+  +C  +S+  CYNC  + H+ K+C +  T
Sbjct:   57 ACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDCDHAN----EQKCYSCGGFGHIQKGCEK--VKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHVAKECTIEAT 160          
BLAST of SMED30006417 vs. Ensembl Xenopus
Match: stk25 (serine/threonine kinase 25 [Source:Xenbase;Acc:XB-GENE-5860335])

HSP 1 Score: 55.4546 bits (132), Expect = 1.355e-7
Identity = 40/158 (25.32%), Postives = 64/158 (40.51%), Query Frame = 3
Query:  171 GHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV--------------------CYGCGKEGHLFKECVSSS--KKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCY--NCKDFGH 572
            G      + S+  SE+  GN+   R     + N+ + DK ++C  C+K GH+++NC     +                    C  C   GH FKEC+  +  +K C+ C+ T H    CP    + H++N           + + D  Y  NC   GH
Sbjct:  228 GERGAEWSISEKDSEAHIGNYTPLR-----RSNRYYTDKDVVCRNCDKRGHLSKNCPVPKKLPACCLCGERGHLQNSCPARYCLNCFLPGHFFKECIERAYWRKTCHRCSMTGHYADACPEIWRQYHLTNKAGPIKKPKSYTGQKDIVYCCNCAKKGH 380          
BLAST of SMED30006417 vs. Ensembl Xenopus
Match: ENSXETT00000025799.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:97559869:97663223:-1 gene:ENSXETG00000014121.1 transcript:ENSXETT00000025799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 1.659e-6
Identity = 33/132 (25.00%), Postives = 51/132 (38.64%), Query Frame = 3
Query:  246 VFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGH 641
            +  +++    + D    C +C +  HI ++C+     C  CG+ GH    C  S  K C  C + +HL KDCP                           C  C +FGHI ++C    +   +C  C   GH
Sbjct:    4 LIGKDREYLFYPDMPRFCRRCGRYDHIQQDCKDPRPQCKNCGEWGHTTVSCPKS--KTCSTCGAVDHLFKDCPY--------------------------CQRCNEFGHILQDC---ESGLRICANCLEFGH 104          
BLAST of SMED30006417 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 96.2857 bits (238), Expect = 6.233e-23
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 6.422e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 96.2857 bits (238), Expect = 6.233e-23
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 6.422e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 94.3597 bits (233), Expect = 3.802e-22
Identity = 63/187 (33.69%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCE-SESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+  E   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 175          

HSP 2 Score: 54.6842 bits (130), Expect = 2.145e-8
Identity = 33/110 (30.00%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
             C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   74 ACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 177          
BLAST of SMED30006417 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 93.9745 bits (232), Expect = 3.927e-22
Identity = 61/180 (33.89%), Postives = 87/180 (48.33%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +      G  FV    + +  D   ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFQFV----SSSLPD---ICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 168          

HSP 2 Score: 56.6102 bits (135), Expect = 5.512e-9
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   63 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 170          
BLAST of SMED30006417 vs. Ensembl Mouse
Match: Zcchc13 (zinc finger, CCHC domain containing 13 [Source:MGI Symbol;Acc:MGI:1922314])

HSP 1 Score: 93.2041 bits (230), Expect = 7.806e-22
Identity = 60/180 (33.33%), Postives = 85/180 (47.22%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++  +CFKCG  GH AR C    +   +  G     +    N+        S +CY+C + GH A++C+     CY CG+ GH+ K+C  + +   + CY C+   HL +DC  N  EE          H  +      +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSKSCFKCGHSGHWARECPKGGTRGRTARGRTRGPQCSTANQ--------SDVCYRCGETGHYAKDCDLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDC--NRQEEQKCYTCGEFGHIQK-DCTQIKCYRCGENGHMAVNCSKTS--EVSCYRCGESGHLARECPIE 167          

HSP 2 Score: 64.3142 bits (155), Expect = 1.047e-11
Identity = 37/114 (32.46%), Postives = 55/114 (48.25%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L   TC+ CG  GHIA++CT ++   E             R+   Q    +   CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++CP+  T
Sbjct:   62 LLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDCNRQ----EEQKCYTCGEFGHIQKDCTQ--IKCYRCGENGHMAVNCSKTSEVSCYRCGESGHLARECPIEAT 169          
BLAST of SMED30006417 vs. UniProt/SwissProt
Match: sp|P62634|CNBP_RAT (Cellular nucleic acid-binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.360e-22
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 4.492e-8
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. UniProt/SwissProt
Match: sp|Q5R5R5|CNBP_PONAB (Cellular nucleic acid-binding protein OS=Pongo abelii OX=9601 GN=CNBP PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.360e-22
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 4.492e-8
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. UniProt/SwissProt
Match: sp|P62633|CNBP_HUMAN (Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.360e-22
Identity = 62/186 (33.33%), Postives = 89/186 (47.85%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 174          

HSP 2 Score: 56.225 bits (134), Expect = 4.492e-8
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   69 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 176          
BLAST of SMED30006417 vs. UniProt/SwissProt
Match: sp|P53996|CNBP_MOUSE (Cellular nucleic acid-binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 2.659e-21
Identity = 63/187 (33.69%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGN----FVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCE-SESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +       F + R F        F+  S+  ICY+C + GH+A++C+  E   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGF-------QFVSSSLPDICYRCGESGHLAKDCDLQEDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 175          

HSP 2 Score: 54.6842 bits (130), Expect = 1.500e-7
Identity = 33/110 (30.00%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
             C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   74 ACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 177          
BLAST of SMED30006417 vs. UniProt/SwissProt
Match: sp|Q3T0Q6|CNBP_BOVIN (Cellular nucleic acid-binding protein OS=Bos taurus OX=9913 GN=CNBP PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.192e-20
Identity = 60/182 (32.97%), Postives = 86/182 (47.25%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSI--ICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            ++ + CFKCG  GH AR C         +              R   F+  S+  ICY+C + GH+A++C+ +   CY CG+ GH+ K+C    +   + CYNC    HL +DC  +  +E          H  +   +  +CY C + GH+A NC K S  E  CYRC   GHLAR C   
Sbjct:    1 MSSNECFKCGRSGHWARECPTGGGRGRGMR----------SRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDC--DHADEQKCYSCGEFGHIQKDCTKV-KCYRCGETGHVAINCSKTS--EVNCYRCGESGHLARECTIE 167          

HSP 2 Score: 56.6102 bits (135), Expect = 3.787e-8
Identity = 34/114 (29.82%), Postives = 52/114 (45.61%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            L    C+ CG  GHIA++C   +   E    N        R+  + +       CY C + GHI ++C      CY CG+ GH+   C  +S+  CY C  + HL ++C +  T
Sbjct:   62 LQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHAD----EQKCYSCGEFGHIQKDCTK--VKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEAT 169          
BLAST of SMED30006417 vs. TrEMBL
Match: A0A482WHT1 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR005934 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 9.284e-25
Identity = 65/175 (37.14%), Postives = 89/175 (50.86%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            ++ STC++C  IGH AR+C          N     G          +  DK   CYKCN+ GH AR C+ +   CY C   GH+ ++C  S +  CYNC+ + H+ +DCP                     SF N  CYNCK  GHIAR+CP+   K  VCY CN+PGH++R+C+
Sbjct:    1 MSSSTCYRCNRIGHFARDCRGGGGGPAGGNFRSGGGGGGGGPVSRYSGRDK---CYKCNRSGHFARECKEDHERCYRCNGVGHIARDCDMSDEPACYNCHKSGHIARDCPDFNQ-----------------SFNNTNCYNCKKSGHIARDCPEGQTK--VCYICNKPGHVSRDCD 153          
BLAST of SMED30006417 vs. TrEMBL
Match: A0A2A4K6G8 (Uncharacterized protein OS=Heliothis virescens OX=7102 GN=B5V51_1023 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.659e-24
Identity = 63/179 (35.20%), Postives = 87/179 (48.60%), Query Frame = 3
Query:  126 FLILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            FL ++ S C+KC   GH AR CT               G V  R+     F  +   C+KCN+ GH AR+C+ E+  CY C   GH+ +EC  S  +  CYNCN T H+ ++CP    +                   N  CYNC   GHI+RNCP  +     CY C +PGH++R+C+
Sbjct:    3 FLTMSSSVCYKCNRTGHFARECTQ--------------GGVAARD---SGFNRQREKCFKCNRAGHFARDCKEEADRCYRCNGTGHIARECAQSPDEPSCYNCNKTGHIARNCPEGGRDSS-----------------NQTCYNCNKSGHISRNCPDGT---KTCYVCGKPGHISRDCD 144          
BLAST of SMED30006417 vs. TrEMBL
Match: A0A087T1Y2 (Cellular nucleic acid-binding protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_03205 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.678e-24
Identity = 66/180 (36.67%), Postives = 90/180 (50.00%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRND-QCYNCKDFGHIARNCPKKSN----KESVCYRCNRPGHLARNC 656
            +N S C+KC   GH AR+CT S   S    G    G  +   + + +       CY C + GH AR C      CY CGK GH+ +EC +  +K+ CY C    H+ +DCP  + E                  R+D +CY C D GHI+R+CP+  N     ++VCYRCN  GH+ARNC
Sbjct:    1 MNSSECYKCHKTGHFARDCTLSDGRSGGYRGGRGGGGGYRGGRGSDSRSSPRASCYNCGRSGHFARECRESDKTCYTCGKSGHISRECDNEDRKITCYQCGKPGHVSRDCPGADRE------------------RDDRKCYTCGDTGHISRDCPEGGNSAEVDDTVCYRCNERGHIARNC 162          

HSP 2 Score: 57.7658 bits (138), Expect = 4.495e-6
Identity = 36/118 (30.51%), Postives = 51/118 (43.22%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQS----YSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNC-------ESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPV 467
            TC+ CG  GHI+R C N       Y     G+          +R+         CY C   GHI+R+C       E +  VCY C + GH+ + C SS    CY C    H+ ++C +
Sbjct:   74 TCYTCGKSGHISRECDNEDRKITCYQCGKPGHVSRDCPGADRERDDR------KCYTCGDTGHISRDCPEGGNSAEVDDTVCYRCNERGHIARNCRSSRPSKCYQCGEVGHIARECEM 185          
BLAST of SMED30006417 vs. TrEMBL
Match: A0A1E1WT25 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.3180 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.272e-23
Identity = 59/176 (33.52%), Postives = 85/176 (48.30%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            ++ S C+KC   GH AR CT       ++              R+  F  +   C+KCN+ GH AR+C+ E+  CY C   GH+ +EC  S  +  CYNCN T H+ ++CP    +                   N  CYNC   GHI+RNCP  +     CY C +PGH++R+C+
Sbjct:    1 MSSSVCYKCNRTGHFARECTQGGGGGGAV--------------RDSGFGRQREKCFKCNRTGHFARDCKEEADRCYRCNGTGHIARECAQSPDEPSCYNCNKTGHIARNCPEGGRDSA-----------------NQTCYNCNKAGHISRNCPDGT---KTCYVCGKPGHISRDCD 142          

HSP 2 Score: 63.5438 bits (153), Expect = 2.402e-8
Identity = 40/113 (35.40%), Postives = 51/113 (45.13%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNC-----ESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNE 473
            CFKC   GH AR+C          NG     R   ++            CY CNK GHIARNC     +S +  CY C K GH+ + C   +K  CY C    H+ +DC  +E
Sbjct:   41 CFKCNRTGHFARDCKEEADRCYRCNGTGHIARECAQSP-------DEPSCYNCNKTGHIARNCPEGGRDSANQTCYNCNKAGHISRNCPDGTK-TCYVCGKPGHISRDCDESE 145          

HSP 3 Score: 61.6178 bits (148), Expect = 1.135e-7
Identity = 35/88 (39.77%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK 413
            C++C   GHIAR C  S       N N  TG +  RN         +  CY CNK GHI+RNC   +  CY CGK GH+ ++C  S +
Sbjct:   61 CYRCNGTGHIARECAQSPDEPSCYNCN-KTGHI-ARNCPEGGRDSANQTCYNCNKAGHISRNCPDGTKTCYVCGKPGHISRDCDESER 146          
BLAST of SMED30006417 vs. TrEMBL
Match: A0A5E4R3L5 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS10045 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.771e-23
Identity = 62/175 (35.43%), Postives = 83/175 (47.43%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNC 656
            ++ S C+KC   GH AR CT     S                 RN  F  +   C+KCN+ GH AR+C+ E+  CY C   GH+ +EC  S  +  CYNCN T H+ ++CP    E                   N  CYNC   GHI+RNCP  +     CY C +PGH++R+C
Sbjct:    1 MSSSVCYKCNRTGHFARECTQGGVAS-----------------RNPEFNRQREKCFKCNRTGHFARDCKEEADRCYRCNGTGHIARECAQSPDEPSCYNCNKTGHIARNCPEGGRESS-----------------NQTCYNCNKSGHISRNCPDGT---KTCYVCGKPGHISRDC 138          

HSP 2 Score: 60.077 bits (144), Expect = 3.383e-7
Identity = 34/88 (38.64%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK 413
            C++C   GHIAR C  S       N N  TG +  RN         +  CY CNK GHI+RNC   +  CY CGK GH+ ++C  + +
Sbjct:   58 CYRCNGTGHIARECAQSPDEPSCYNCN-KTGHI-ARNCPEGGRESSNQTCYNCNKSGHISRNCPDGTKTCYVCGKPGHISRDCEEAER 143          
BLAST of SMED30006417 vs. Ensembl Cavefish
Match: ENSAMXT00000005562.2 (cellular nucleic acid-binding protein [Source:NCBI gene;Acc:103027392])

HSP 1 Score: 87.4261 bits (215), Expect = 5.329e-20
Identity = 55/179 (30.73%), Postives = 79/179 (44.13%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            ++ + CF CG  GH  +NC N+                            K + CY+C + GH+AR+CE     CY CG+ GH+ ++C    K   +VCYNC    H+ +DC  +   E          H  +      +CY C + GH+A  C K S  E  CY C + GHLA+ C  
Sbjct:    1 MSSNECFGCGRTGHWIKNCPNAGRGRGK-----------------GRGRGKDLFCYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHVARDC--DHANEQKCYSCGGFGHIQK-GCEKVKCYRCGEIGHVAVQCSKAS--EVNCYNCGKSGHLAKECTI 157          

HSP 2 Score: 62.7734 bits (151), Expect = 2.651e-11
Identity = 40/130 (30.77%), Postives = 60/130 (46.15%), Query Frame = 3
Query:  150 CFKCGTIGHIARNC--TNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCES-------------------ESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            C++CG  GH+AR+C  T    Y+    G+        + +R Q       +CY C K GH+AR+C+                    E   CY CG+ GH+  +C  +S+  CYNC  + HL K+C +  T
Sbjct:   38 CYRCGEPGHVARDCERTEDACYNCGRGGHISRDCKEPKKEREQ-------VCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKGCEKVKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHLAKECTIEAT 160          
BLAST of SMED30006417 vs. Ensembl Cavefish
Match: cnbpa (cellular nucleic acid-binding protein-like [Source:NCBI gene;Acc:103024401])

HSP 1 Score: 83.5741 bits (205), Expect = 1.832e-18
Identity = 57/190 (30.00%), Postives = 81/190 (42.63%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESE---------SAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            + ++ S CF CG  GH  +NC N+                            K + CY+C + GHIAR+CE           S  CY C + GH+ ++C    K   + CYNC    H+ +DC  +   E          H  ++  +  +CY C + GH+A  C K S  E  CY C + GHLAR C  
Sbjct:    1 MDMSSSECFGCGRSGHWVKNCPNAGRGRGR-----------------GRGRGKDLFCYRCGEQGHIARDCEQTEDGEALSPFSQTCYNCHRSGHISRDCKEPKKEREQCCYNCGKAGHVARDC--DHANEQKCYSCGGFGHIQKLCDKV-KCYRCGEIGHVAVQCSKAS--EVNCYNCGKTGHLARECTI 168          
BLAST of SMED30006417 vs. Ensembl Cavefish
Match: ENSAMXT00000049641.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:133096:141172:1 gene:ENSAMXG00000031265.1 transcript:ENSAMXT00000049641.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 2.350e-8
Identity = 39/117 (33.33%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  291 IICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGH 641
            I C+KC ++GH  + C++ + VC  CG +GH + +C S +++ CY C+STEH VKDC V                         +C+ C + GH  + C    N E VC  C   GH
Sbjct:   47 IKCWKCGELGHRGKECQN-TEVCNLCGTQGHSYFKCPSQTQR-CYVCHSTEHQVKDCDV------------------------IKCWKCGELGHRGKEC---QNTE-VCNLCGTQGH 133          
BLAST of SMED30006417 vs. Ensembl Cavefish
Match: ENSAMXT00000047897.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:10959414:10969971:-1 gene:ENSAMXG00000029509.1 transcript:ENSAMXT00000047897.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.521 bits (114), Expect = 2.041e-6
Identity = 35/95 (36.84%), Postives = 42/95 (44.21%), Query Frame = 3
Query:  132 ILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNC-ESESAVCYGCGKEGHLFKECVSSSK 413
              + S C+KCG  GHI R            N N V+GR   R+K       +S  CYKC   GHI R C  S++  C  CGK GH    C    K
Sbjct:   39 APSQSGCYKCGAQGHIGRE----------SNTNHVSGR--ARSKPKPKAPSQS-GCYKCGAQGHIGRECIRSKNHKCSHCGKRGHFDDLCFHKDK 120          
BLAST of SMED30006417 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003739.1 (pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gene:ENSPMAG00000003418.1 transcript:ENSPMAT00000003739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 4.344e-14
Identity = 43/160 (26.88%), Postives = 62/160 (38.75%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK-----KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKS 599
            ++ + CF+CG  GH AR C N                        +    +   CY+C + GHIAR C      CY CGK GH+ +EC    +       CY C    HL ++C                  +      +++CY C   GH+ R+C K S
Sbjct:    1 MSSNECFRCGGSGHWARECPNGAGGGRGPG-----------GPVGRGGRGRGDGCYRCGEGGHIARECPLPQDTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLAREC-----------------SSGGGGPGDNKCYGCGQRGHMQRDCTKAS 132          

HSP 2 Score: 57.3806 bits (137), Expect = 2.033e-10
Identity = 37/140 (26.43%), Postives = 53/140 (37.86%), Query Frame = 3
Query:  297 CYKCNKVGHIARNCE------------------SESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNK--ESVCYRCNRPGHLARNC 656
            C++C   GH AR C                        CY CG+ GH+ +EC    +  CYNC    H+ ++CP    +                      CY C   GH+AR C        ++ CY C + GH+ R+C
Sbjct:    6 CFRCGGSGHWARECPNGAGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIAREC-PLPQDTCYNCGKGGHIARECPEGRQDRGG----------------GPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDC 128          

HSP 3 Score: 54.6842 bits (130), Expect = 1.532e-9
Identity = 30/93 (32.26%), Postives = 44/93 (47.31%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV-----CYGCGKEGHLFKECVSSSK 413
            C++CG  GHIAR C   Q    +        R     ++++        CY C K GH+AR C S         CYGCG+ GH+ ++C  +S+
Sbjct:   44 CYRCGEGGHIARECPLPQDTCYNCGKGGHIARECPEGRQDRG---GGPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCTKASR 133          

HSP 4 Score: 52.7582 bits (125), Expect = 6.978e-9
Identity = 34/121 (28.10%), Postives = 44/121 (36.36%), Query Frame = 3
Query:  357 CYGCGKEGHLFKECV-----------------SSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKES---VCYRCNRPGHLARNCN 659
            C+ CG  GH  +EC                        CY C    H+ ++CP+ +                      D CYNC   GHIAR CP+          CY C + GHLAR C+
Sbjct:    6 CFRCGGSGHWARECPNGAGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIARECPLPQ----------------------DTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECS 104          
BLAST of SMED30006417 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010393.1 (pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 gene:ENSPMAG00000009411.1 transcript:ENSPMAT00000010393.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.803e-11
Identity = 37/134 (27.61%), Postives = 55/134 (41.04%), Query Frame = 3
Query:  261 KRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSN--KESVCYRCNRPGHLARNC 656
            +  ++F D    CY+C + GHIAR C               L ++ VSS+   CYNC    H+ ++CP    +                      CY C   GH+AR C        ++ CY C + GH+ R+C
Sbjct:    1 RGGKSFTDG---CYRCGEGGHIARECP--------------LPQDSVSSNTAACYNCGKGGHIARECPEGRQDRGG----------------GPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDC 101          

HSP 2 Score: 54.6842 bits (130), Expect = 9.096e-10
Identity = 32/100 (32.00%), Postives = 46/100 (46.00%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVT-------GRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV-----CYGCGKEGHLFKECVSSSK 413
            C++CG  GHIAR C   Q   +S++ N          G +       +        CY C K GH+AR C S         CYGCG+ GH+ ++C  +S+
Sbjct:   10 CYRCGEGGHIARECPLPQ---DSVSSNTAACYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCTKASR 106          

HSP 3 Score: 54.6842 bits (130), Expect = 9.096e-10
Identity = 29/83 (34.94%), Postives = 37/83 (44.58%), Query Frame = 3
Query:  420 CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKES---VCYRCNRPGHLARNCN 659
            CY C    H+ ++CP+ +               D VS     CYNC   GHIAR CP+          CY C + GHLAR C+
Sbjct:   10 CYRCGEGGHIARECPLPQ---------------DSVSSNTAACYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECS 77          
BLAST of SMED30006417 vs. Ensembl Yeast
Match: GIS2 (Translational activator for mRNAs with internal ribosome entry sites; associates with polysomes and binds to a specific subset of mRNAs; localizes to RNA processing bodies (P bodies) and to stress granules; may have a role in translation regulation under stress conditions; ortholog of human ZNF9/CNBP, a gene involved in myotonic dystrophy type 2 [Source:SGD;Acc:S000005199])

HSP 1 Score: 77.411 bits (189), Expect = 1.906e-17
Identity = 51/187 (27.27%), Postives = 80/187 (42.78%), Query Frame = 3
Query:  135 LNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV----CYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNY----VDATSHTDEVSFRND-----QCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNC 656
            ++   C+ CG IGH+A +C                              D   +CY CNK GH+  +C     V    CY CG+ GH+  EC     + C+NCN T H+ ++CP  +     S          +H  +   + D     +CY C   GH++R+C      + +CY CN  GH++++C
Sbjct:    1 MSQKACYVCGKIGHLAEDC------------------------------DSERLCYNCNKPGHVQTDCTMPRTVEFKQCYNCGETGHVRSECTV---QRCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDC----QNDRLCYNCNETGHISKDC 150          

HSP 2 Score: 67.0106 bits (162), Expect = 8.606e-14
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 3
Query:  132 ILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV----CYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCP 464
             +    C+ CG  GH+   CT  + ++ +  G+    R     K+   F    + CYKC    H+A++C  E  +    CY CG+ GH+ ++C   + ++CYNCN T H+ KDCP
Sbjct:   43 TVEFKQCYNCGETGHVRSECTVQRCFNCNQTGHI--SRECPEPKKTSRF--SKVSCYKCGGPNHMAKDCMKEDGISGLKCYTCGQAGHMSRDC--QNDRLCYNCNETGHISKDCP 151          
BLAST of SMED30006417 vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 65.4698 bits (158), Expect = 2.089e-11
Identity = 42/137 (30.66%), Postives = 59/137 (43.07%), Query Frame = 3
Query:  297 CYKCNKVGHIARNCE----SESAVCYGCGKEGHLFKEC--VSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCP-----------KKSNKESVCYRCNRPGHLARNC 656
            C KC + GH AR+C       S  C+ C +EGH  +EC    S    C+ CN + H  ++CP N           ++  T         CY C + GH AR CP              + +S C++C + GH AR C
Sbjct:   36 CRKCGESGHFARDCPQGGGGGSRTCHKCNEEGHFARECPNADSGGNKCFKCNESGHFARECP-NSGGGGGGFGGGSSGST---------CYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFAREC 162          

HSP 2 Score: 60.4622 bits (145), Expect = 8.928e-10
Identity = 48/164 (29.27%), Postives = 63/164 (38.41%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNC---ESESAVCYGCGKEGHLFKEC-----------VSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKS 599
            C KCG  GH AR+C                          Q     S  C+KCN+ GH AR C   +S    C+ C + GH  +EC             SS   CY CN T H  ++CP  E+          +S        +  C+ C+  GH AR CP +S
Sbjct:   36 CRKCGESGHFARDCP-------------------------QGGGGGSRTCHKCNEEGHFARECPNADSGGNKCFKCNESGHFARECPNSGGGGGGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGGGSS--------DSTCFKCQQTGHFARECPNES 166          
BLAST of SMED30006417 vs. Ensembl Nematostella
Match: EDO36176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG4])

HSP 1 Score: 55.0694 bits (131), Expect = 2.138e-9
Identity = 37/148 (25.00%), Postives = 56/148 (37.84%), Query Frame = 3
Query:   93 FTADYLREIL*FLILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAV-------------------CYGCGKEGHLFKEC----VSSSKKVCYNCNSTEHLVKDCPV 467
            F  ++L  +L         C +CG  GH +R C N  +  E I             KR    +     C+KC K GH +R C ++ +                    C+ CG+EGH  +EC    +      C+ C  T H  ++CP 
Sbjct:    3 FVPEFLPYVLPGGGGGGGDCHQCGEAGHFSRECPNKGNQGEPI-------------KR----MGGGGACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGRNCHKCGQEGHFSRECPNQAIQGQSDTCHKCGETGHYSRECPT 133          

HSP 2 Score: 50.0618 bits (118), Expect = 1.365e-7
Identity = 32/122 (26.23%), Postives = 54/122 (44.26%), Query Frame = 3
Query:  297 CYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKS--NKESVCYRCNRPGHLARNC 656
            C++C + GH +R C ++       G +G   K         C+ C    H  ++CP  +++     Y+  T H      RN  C+ C   GH +R CP ++   +   C++C   GH +R C
Sbjct:   22 CHQCGEAGHFSRECPNK-------GNQGEPIKR--MGGGGACHKCGKEGHFSRECPNQDSQRMNIQYLCQT-HFSISGGRN--CHKCGQEGHFSRECPNQAIQGQSDTCHKCGETGHYSREC 131          
BLAST of SMED30006417 vs. Ensembl Nematostella
Match: EDO28813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E8])

HSP 1 Score: 49.6766 bits (117), Expect = 9.285e-8
Identity = 36/122 (29.51%), Postives = 51/122 (41.80%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCE----SES----AVCYGCGKEGHLFKECVSSSKKV------CYNCNSTEHLVKDCPVNE 473
            CF C  +GH A +C  ++  S  +                        +CYKC    HI ++C+    +ES    A C+ CG+ GHL   C  + K +      C  C S EHL +DCP  E
Sbjct:    1 CFHCRELGHRAADCPQTKKTSAGVG-----------------------VCYKCRATSHITKHCKVTTTTESPFPFAKCFICGETGHLSSSCPDNPKGLYPEGGGCKECGSVEHLRRDCPELE 99          
BLAST of SMED30006417 vs. Ensembl Nematostella
Match: EDO45618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSD8])

HSP 1 Score: 48.521 bits (114), Expect = 2.227e-7
Identity = 36/121 (29.75%), Postives = 50/121 (41.32%), Query Frame = 3
Query:  153 FKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCE----SES----AVCYGCGKEGHLFKECVSSSKKV------CYNCNSTEHLVKDCPVNE 473
            F C  +GH A +C  ++  S  +                        +CYKC    HI ++C+    SES    A C+ CG+ GHL   C  + K +      C  C S EHL +DCP  E
Sbjct:    2 FHCRELGHRAADCPQTKKTSAGVG-----------------------VCYKCGATSHITKHCKVTTTSESPFPFAKCFICGETGHLSSSCPDNPKGLYPEGGGCKECGSVEHLRRDCPELE 99          
BLAST of SMED30006417 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 84.3445 bits (207), Expect = 8.361e-19
Identity = 52/176 (29.55%), Postives = 80/176 (45.45%), Query Frame = 3
Query:  144 STCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSK---KVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            S CF CG  GH  ++C N+                  R +       K + CY+C   GH+AR+C+     CY C + GH+ ++C    K   ++CY C    H+ +DC  +   E          H  ++  +  +CY C + GH+A +C K S  E+ CY C + GHLA+ C  
Sbjct:    7 SECFGCGRPGHWVKHCPNASG---------------TRGRGRGRGRGKELFCYRCGDQGHMARDCDQTEDACYNCHRSGHISRDCKEPKKEREQLCYTCGKAGHMARDC--DHANEQKCYSCGGFGHIQKLCDKV-KCYRCGEIGHVAVHCSKAS--ETNCYNCGKAGHLAKECTI 162          

HSP 2 Score: 62.3882 bits (150), Expect = 3.851e-11
Identity = 39/121 (32.23%), Postives = 56/121 (46.28%), Query Frame = 3
Query:  342 SESAVCYGCGKEGHLFKECVSSS-------------KKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNC--PKKSNKESVCYRCNRPGHLARNCN 659
            S ++ C+GCG+ GH  K C ++S             +  CY C    H+ +DC   E                      D CYNC   GHI+R+C  PKK  +E +CY C + GH+AR+C+
Sbjct:    4 SSNSECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKELFCYRCGDQGHMARDCDQTE----------------------DACYNCHRSGHISRDCKEPKK-EREQLCYTCGKAGHMARDCD 101          

HSP 3 Score: 60.077 bits (144), Expect = 2.183e-10
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCES-------------------ESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNET 476
            C++CG  GH+AR+C  ++    + + +    R     K+     ++  +CY C K GH+AR+C+                    +   CY CG+ GH+   C  +S+  CYNC    HL K+C +  T
Sbjct:   43 CYRCGDQGHMARDCDQTEDACYNCHRSGHISRDCKEPKK-----EREQLCYTCGKAGHMARDCDHANEQKCYSCGGFGHIQKLCDKVKCYRCGEIGHVAVHCSKASETNCYNCGKAGHLAKECTIEAT 165          
BLAST of SMED30006417 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 73.559 bits (179), Expect = 2.346e-15
Identity = 56/177 (31.64%), Postives = 83/177 (46.89%), Query Frame = 3
Query:  144 STCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCES----ESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNF 662
            S CF CG  GH  ++C N+       +G    GR   R K           CY C++ GHI+R+C+        +CY CGK GH+ ++C  ++++ CY+C    H+ K C                   D+V     +CY C + GH+A +C K S  E+ CY C + GHLA+ C  
Sbjct:    7 SECFGCGRPGHWVKHCPNA-------SGTRGRGRGRGRGK----------ACYNCHRSGHISRDCKEPKKEREQLCYTCGKAGHMARDCDHANEQKCYSCGGFGHIQKLC-------------------DKV-----KCYRCGEIGHVAVHCSKAS--ETNCYNCGKAGHLAKECTI 140          

HSP 2 Score: 60.8474 bits (146), Expect = 6.483e-11
Identity = 41/120 (34.17%), Postives = 59/120 (49.17%), Query Frame = 3
Query:  342 SESAVCYGCGKEGHLFKECVSSS-----------KKVCYNCNSTEHLVKDC--PVNETEEHISNYVDATSHTDEVSFRNDQ-CYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
            S ++ C+GCG+ GH  K C ++S            K CYNC+ + H+ +DC  P  E E+       A     +    N+Q CY+C  FGHI + C K       CYRC   GH+A +C+
Sbjct:    4 SSNSECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKACYNCHRSGHISRDCKEPKKEREQLCYTCGKAGHMARDCDHANEQKCYSCGGFGHIQKLCDKVK-----CYRCGEIGHVAVHCS 118          
BLAST of SMED30006417 vs. Ensembl Medaka
Match: ENSORLT00000032413.1 (zinc finger CCHC-type containing 7 [Source:NCBI gene;Acc:101170154])

HSP 1 Score: 53.5286 bits (127), Expect = 2.786e-7
Identity = 38/120 (31.67%), Postives = 52/120 (43.33%), Query Frame = 3
Query:  237 TGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNC-ESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPK 593
            T R F++N+    +  K+I C  CNK GH+++NC E +   C+ CG  GHL  EC +   K C NC    HL   C                    E  +   QC+ C   GH    CP+
Sbjct:  209 TTRQFLQNRY---YTGKNIHCKNCNKTGHLSKNCPEPKLVPCFLCGAPGHLVIECPN---KHCNNCGHPGHLFNSC-------------------SEKPYWYKQCHRCSMKGHFLDACPE 303          
BLAST of SMED30006417 vs. Planmine SMEST
Match: SMESG000020671.1 (SMESG000020671.1)

HSP 1 Score: 353.984 bits (907), Expect = 3.151e-122
Identity = 175/175 (100.00%), Postives = 175/175 (100.00%), Query Frame = 3
Query:  141 MSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 665
            MSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN
Sbjct:    1 MSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCNFN 175          
BLAST of SMED30006417 vs. Planmine SMEST
Match: SMESG000008610.1 (SMESG000008610.1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.524e-19
Identity = 62/191 (32.46%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  141 MSTCFKCGTIGHIARNCTNSQ----SYSESINGNFVTG---RVFVRNKRNQNFIDKSIICYKCNKVGHIARNCES--ESAVCYGCGKEGHLFKECVSSSKKVCYNCNSTEHLVKDCPVNETEE----------HISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNC 656
            M+ C+KCG +G   R+C+N       Y  S  G +  G   R   R +   N       CY+C + GHIA++C S      CY CG   HL K+C     K CY CN   HL ++C     ++          H++   +  S+ +  S R+  CY C + GH AR+CP   N   +C+ C   GH+AR C
Sbjct:    1 MTECYKCGEVGCYGRDCSNGDERGYGYRNSNRGIYSRGGRPRSTQRGRGRGNVRLGRKSCYQCGREGHIAKDCGSGDNQNGCYNCGGTDHLQKDCPEVIVKTCYRCNCKGHLARNCTSTIEDDRSCYKCNKKGHLARDCN-NSYGNGSSNRHFVCYKCNEPGHYARDCP---NDSIICHNCQEVGHMAREC 187          

HSP 2 Score: 70.0922 bits (170), Expect = 8.196e-14
Identity = 53/163 (32.52%), Postives = 77/163 (47.24%), Query Frame = 3
Query:  129 LILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCES---ESAVCYGCGKEGHLFKECVSSSKK-------VCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNC 587
            + L   +C++CG  GHIA++C +     ++ NG +  G      K     I K+  CY+CN  GH+ARNC S   +   CY C K+GHL ++C +S          VCY CN   H  +DCP                  D +      C+NC++ GH+AR C
Sbjct:   53 VRLGRKSCYQCGREGHIAKDCGS----GDNQNGCYNCGGTDHLQKDCPEVIVKT--CYRCNCKGHLARNCTSTIEDDRSCYKCNKKGHLARDCNNSYGNGSSNRHFVCYKCNEPGHYARDCP-----------------NDSII-----CHNCQEVGHMAREC 187          

HSP 3 Score: 56.6102 bits (135), Expect = 3.530e-9
Identity = 33/90 (36.67%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  132 ILNMSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECV 401
            I +  +C+KC   GH+AR+C NS        GN  + R FV              CYKCN+ GH AR+C ++S +C+ C + GH+ +EC+
Sbjct:  120 IEDDRSCYKCNKKGHLARDCNNSY-------GNGSSNRHFV--------------CYKCNEPGHYARDCPNDSIICHNCQEVGHMARECL 188          
BLAST of SMED30006417 vs. Planmine SMEST
Match: SMESG000059266.1 (SMESG000059266.1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.393e-18
Identity = 58/192 (30.21%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNF-----VTGRV------FVRNKRNQNFIDKSIICYKCNKVGHIARNCESESA--------VCYGCGKEGHLFKECV---SSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNC 656
            C+ CG  GH+AR+CT  +    +   N      + G +        R   N+     S+ CY C + GH++++C  +           CY CG+ GH+ + C    S  +++ CY CN   H+ +DC                 + D  + R  +CYNC   GH++R CP   + E  CY+CN PGHLAR+C
Sbjct:   10 CYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDC-----------------NEDGGNDRQIKCYNCHQNGHMSRECPNGPS-EKKCYKCNNPGHLARDC 183          

HSP 2 Score: 72.7886 bits (177), Expect = 8.332e-15
Identity = 47/149 (31.54%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  276 FIDKSIICYKCNKVGHIARNC--------ESESAVCYGCGKEGHLFKECVSS-----------SKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPK--KSNKESVCYRCNRPGHLARNCN 659
            +  + + CY C K GH+AR+C           +  C+ CG  GH+ KEC  +           S   CYNC    H+ KDC           Y D          R + CY C + GHI+RNC +    +++  CY+CN+ GH++R+CN
Sbjct:    3 YNQRKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCS-------DQGYRDNAP-------RGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCN 137          

HSP 3 Score: 71.2478 bits (173), Expect = 2.904e-14
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESA-----VCYGCGKEGHLFKECVSS-SKKVCYNCNSTEHLVKDC 461
            TC+KCG  GHI+RNCT + S                         D+ + CYKCN++GH++R+C  +        CY C + GH+ +EC +  S+K CY CN+  HL +DC
Sbjct:   97 TCYKCGEAGHISRNCTQNWS------------------------GDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECPNGPSEKKCYKCNNPGHLARDC 183          

HSP 4 Score: 56.6102 bits (135), Expect = 3.697e-9
Identity = 33/115 (28.70%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  357 CYGCGKEGHLFKECVSSSKK-------VCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESV-----CYRCNRPGHLARNCNFN 665
            CY CGK+GH+ ++C    K         C+NC    H+ K+CP N           ++            CYNC + GH++++C  +  +++      CY+C   GH++RNC  N
Sbjct:   10 CYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSV----------TCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQN 114          
BLAST of SMED30006417 vs. Planmine SMEST
Match: SMESG000059254.1 (SMESG000059254.1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.393e-18
Identity = 58/192 (30.21%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  150 CFKCGTIGHIARNCTNSQSYSESINGNF-----VTGRV------FVRNKRNQNFIDKSIICYKCNKVGHIARNCESESA--------VCYGCGKEGHLFKECV---SSSKKV-CYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNC 656
            C+ CG  GH+AR+CT  +    +   N      + G +        R   N+     S+ CY C + GH++++C  +           CY CG+ GH+ + C    S  +++ CY CN   H+ +DC                 + D  + R  +CYNC   GH++R CP   + E  CY+CN PGHLAR+C
Sbjct:   10 CYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDC-----------------NEDGGNDRQIKCYNCHQNGHMSRECPNGPS-EKKCYKCNNPGHLARDC 183          

HSP 2 Score: 72.7886 bits (177), Expect = 8.332e-15
Identity = 47/149 (31.54%), Postives = 69/149 (46.31%), Query Frame = 3
Query:  276 FIDKSIICYKCNKVGHIARNC--------ESESAVCYGCGKEGHLFKECVSS-----------SKKVCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPK--KSNKESVCYRCNRPGHLARNCN 659
            +  + + CY C K GH+AR+C           +  C+ CG  GH+ KEC  +           S   CYNC    H+ KDC           Y D          R + CY C + GHI+RNC +    +++  CY+CN+ GH++R+CN
Sbjct:    3 YNQRKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCS-------DQGYRDNAP-------RGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCN 137          

HSP 3 Score: 71.2478 bits (173), Expect = 2.904e-14
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 3
Query:  147 TCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESESA-----VCYGCGKEGHLFKECVSS-SKKVCYNCNSTEHLVKDC 461
            TC+KCG  GHI+RNCT + S                         D+ + CYKCN++GH++R+C  +        CY C + GH+ +EC +  S+K CY CN+  HL +DC
Sbjct:   97 TCYKCGEAGHISRNCTQNWS------------------------GDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECPNGPSEKKCYKCNNPGHLARDC 183          

HSP 4 Score: 56.6102 bits (135), Expect = 3.697e-9
Identity = 33/115 (28.70%), Postives = 54/115 (46.96%), Query Frame = 3
Query:  357 CYGCGKEGHLFKECVSSSKK-------VCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCPKKSNKESV-----CYRCNRPGHLARNCNFN 665
            CY CGK+GH+ ++C    K         C+NC    H+ K+CP N           ++            CYNC + GH++++C  +  +++      CY+C   GH++RNC  N
Sbjct:   10 CYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSV----------TCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQN 114          
BLAST of SMED30006417 vs. Planmine SMEST
Match: SMESG000059283.1 (SMESG000059283.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.003e-15
Identity = 39/117 (33.33%), Postives = 60/117 (51.28%), Query Frame = 3
Query:  342 SESAVCYGCGKEGHLFKECVSSSKK-------VCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVS-FRNDQCYNCKDFGHIARNCPKKSN---KESVCYRCNRPGHLARNCN 659
            S    CY CGK+GH+ ++C  S K         C+NC  + H+ ++CP N +              D     R  +CYNC + GH++R CPK+ +   + + CY+C   GH+AR+CN
Sbjct:    3 SRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN 119          

HSP 2 Score: 72.4034 bits (176), Expect = 8.000e-15
Identity = 47/170 (27.65%), Postives = 73/170 (42.94%), Query Frame = 3
Query:  276 FIDKSIICYKCNKVGHIARNCE--------SESAVCYGCGKEGHLFKECVSSSKKV----------------------CYNCNSTEHLVKDCPVNETEEHISN---YVDATSH---------TDEVSFRNDQCYNCKDFGHIARNCPKKSNKESVCYRCNRPGHLARNCN 659
               + + CY C K GH++R+C           S  C+ CG+ GH+ +EC  +  +                       CYNC+ + H+ ++CP   +    SN       + H         +D    R  +CYNC   GH++R CP     E  CY+CN+ GH++R CN
Sbjct:    1 MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN-GQSEKKCYKCNKIGHMSRECN 169          

HSP 3 Score: 60.8474 bits (146), Expect = 9.624e-11
Identity = 42/161 (26.09%), Postives = 66/161 (40.99%), Query Frame = 3
Query:  144 STCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKSIICYKCNKVGHIARNCESE------SAVCYGCGKEGHLFKECVSSSKK-------VCYNCNSTEHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNC 587
              CF CG  GH++R C  + S      G +       R  +      +   CY C++ GH++R C  +      S  CY CG+ GH+ ++C              CYNCN   H+ ++CP  ++E+                    +CY C   GH++R C
Sbjct:   34 GACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQ------RGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEK--------------------KCYKCNKIGHMSREC 168          
The following BLAST results are available for this feature:
BLAST of SMED30006417 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBP9.079e-2333.33CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP5.538e-2233.69CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.555e-2133.51CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.565e-2132.40CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP2.482e-2132.97CCHC-type zinc finger nucleic acid binding protein... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
K08D12.39.020e-829.37pep chromosome:WBcel235:IV:1710265:1711127:1 gene:... [more]
F40F12.91.097e-645.45pep chromosome:WBcel235:III:9913021:9913625:1 gene... [more]
F40F12.93.130e-645.24pep chromosome:WBcel235:III:9913021:9913730:1 gene... [more]
F40F12.93.130e-645.24pep chromosome:WBcel235:III:9913021:9914075:1 gene... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CNBP1.410e-2133.90gene:FBgn0034802 transcript:FBtr0303464[more]
CNBP1.410e-2133.90gene:FBgn0034802 transcript:FBtr0071994[more]
back to top
BLAST of SMED30006417 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnbpa1.823e-2030.39CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa1.823e-2030.39CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa1.823e-2030.39CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb1.101e-1930.17CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb1.101e-1930.17CCHC-type zinc finger, nucleic acid binding protei... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stk251.355e-725.32serine/threonine kinase 25 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000025799.11.659e-625.00pep primary_assembly:Xenopus_tropicalis_v9.1:8:975... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnbp6.233e-2333.33cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp6.233e-2333.33cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp3.802e-2233.69cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp3.927e-2233.89cellular nucleic acid binding protein [Source:MGI ... [more]
Zcchc137.806e-2233.33zinc finger, CCHC domain containing 13 [Source:MGI... [more]
back to top
BLAST of SMED30006417 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62634|CNBP_RAT4.360e-2233.33Cellular nucleic acid-binding protein OS=Rattus no... [more]
sp|Q5R5R5|CNBP_PONAB4.360e-2233.33Cellular nucleic acid-binding protein OS=Pongo abe... [more]
sp|P62633|CNBP_HUMAN4.360e-2233.33Cellular nucleic acid-binding protein OS=Homo sapi... [more]
sp|P53996|CNBP_MOUSE2.659e-2133.69Cellular nucleic acid-binding protein OS=Mus muscu... [more]
sp|Q3T0Q6|CNBP_BOVIN1.192e-2032.97Cellular nucleic acid-binding protein OS=Bos tauru... [more]
back to top
BLAST of SMED30006417 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482WHT19.284e-2537.14Uncharacterized protein OS=Laodelphax striatellus ... [more]
A0A2A4K6G82.659e-2435.20Uncharacterized protein OS=Heliothis virescens OX=... [more]
A0A087T1Y24.678e-2436.67Cellular nucleic acid-binding protein (Fragment) O... [more]
A0A1E1WT252.272e-2333.52Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A5E4R3L52.771e-2335.43Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000005562.25.329e-2030.73cellular nucleic acid-binding protein [Source:NCBI... [more]
cnbpa1.832e-1830.00cellular nucleic acid-binding protein-like [Source... [more]
ENSAMXT00000049641.12.350e-833.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000047897.12.041e-636.84pep primary_assembly:Astyanax_mexicanus-2.0:15:109... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003739.14.344e-1426.88pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gen... [more]
ENSPMAT00000010393.11.803e-1127.61pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 g... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIS21.906e-1727.27Translational activator for mRNAs with internal ri... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO277082.089e-1130.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361762.138e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288139.285e-829.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456182.227e-729.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30006417 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cnbpa8.361e-1929.55CCHC-type zinc finger nucleic acid binding protein... [more]
cnbpa2.346e-1531.64CCHC-type zinc finger nucleic acid binding protein... [more]
ENSORLT00000032413.12.786e-731.67zinc finger CCHC-type containing 7 [Source:NCBI ge... [more]
back to top
BLAST of SMED30006417 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020671.13.151e-122100.00SMESG000020671.1[more]
SMESG000008610.12.524e-1932.46SMESG000008610.1[more]
SMESG000059266.12.393e-1830.21SMESG000059266.1[more]
SMESG000059254.12.393e-1830.21SMESG000059254.1[more]
SMESG000059283.11.003e-1533.33SMESG000059283.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006417 ID=SMED30006417|Name=SMED30006417|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
AGAGTTAAAATAATAACTCATAGTTTAAAAATTTTCATTTGTAGAAAATA
TGAACCATTGTTTCATAGACTCCTGATTTTCTATTGTCTATTTTCACTGC
AGATTATTTAAGAGAAATTCTATAATTTTTGATTTTAAACATGAGCACTT
GTTTCAAATGTGGAACTATAGGTCACATTGCCAGAAATTGCACAAATAGT
CAATCTTATTCAGAATCAATTAATGGTAATTTTGTCACCGGACGCGTTTT
CGTAAGAAATAAAAGGAACCAAAACTTTATAGATAAAAGTATTATTTGTT
ATAAATGCAATAAAGTTGGGCATATTGCTAGAAATTGTGAATCTGAAAGT
GCAGTTTGTTACGGTTGTGGGAAAGAAGGTCATTTGTTTAAGGAATGTGT
TTCATCATCTAAAAAAGTGTGTTATAATTGTAATAGTACAGAACACTTAG
TAAAAGATTGTCCAGTAAATGAAACAGAAGAGCATATTTCAAATTACGTT
GATGCAACTTCTCACACTGATGAGGTTTCTTTTCGCAATGATCAGTGCTA
CAACTGTAAAGATTTCGGTCATATTGCTCGAAACTGTCCAAAGAAATCAA
ATAAGGAATCAGTTTGTTACCGTTGCAATAGACCGGGACATCTAGCACGG
AATTGCAACTTCAACTAATTATTATTCTAGAGCTCTCCATAATAATATTA
GGAACCGTTTCTCGATTCGTGTCACTCAAATCTTCATCATTACCACGTGT
TTCATATTTATACATCTATTTATTTGATCCATTTTCTTTTCTTTTTTTCT
CCAATAGGCTTTATGCGATTTTCTCAGAGATGGATCTTATATCAATTGAT
CCGTTTTAGTTATTTGCACTTATTCAGTTCAATTCGATCAAACAATTACT
ATTTTATTACCATTGATTTTTAATGACATTTTAGTATTTTTTGATAAAAC
ATTGATTTTTTTGTTTGATTTTTGATAGATTTTGTGATTTTAAAAAACGT
TTCAGTGATTATTATTGCTTACTGGTGGCTTCTCTATTATTGAAACGTAA
CTTTCTGTTTTCTTTACAGCAATATGGTCAATAGACACTTTCACTTTTAT
TATTACAGTTGGCAAGGACAAATGGGAAAATTGCAAGGACGAATTGTTGC
AGTTTGCGAAACGAACATTTTTTAAATTTCATTATTCGTGTCGTCTAATT
TAAGTGAAAATTGTTCTTAGCGATTTTGGACTGTGTGTTCATTTAACGTG
TTTATAACATTAATTTTTATCAAAATTTAATCATAGAATATTGAACAATT
AGTGGCGAAGAAAAGATTTTGGAATACTGTTTTATATCGATGCCAATTTT
CCAATTTCCTGCAAGAAATAAAATTGTAATGTCTCTG
back to top

protein sequence of SMED30006417-orf-1

>SMED30006417-orf-1 ID=SMED30006417-orf-1|Name=SMED30006417-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=176bp
MSTCFKCGTIGHIARNCTNSQSYSESINGNFVTGRVFVRNKRNQNFIDKS
IICYKCNKVGHIARNCESESAVCYGCGKEGHLFKECVSSSKKVCYNCNST
EHLVKDCPVNETEEHISNYVDATSHTDEVSFRNDQCYNCKDFGHIARNCP
KKSNKESVCYRCNRPGHLARNCNFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036875Znf_CCHC_sf
IPR001878Znf_CCHC
IPR025836Zn_knuckle_CX2CX4HX4C
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001878Zinc finger, CCHC-typeSMARTSM00343c2hcfinal6coord: 3..19
e-value: 1.0E-4
score: 31.7
coord: 135..151
e-value: 4.5E-5
score: 32.9
coord: 52..68
e-value: 3.6E-4
score: 29.9
coord: 93..109
e-value: 0.0033
score: 26.5
coord: 72..88
e-value: 0.012
score: 23.0
coord: 158..174
e-value: 0.0053
score: 25.3
IPR001878Zinc finger, CCHC-typePFAMPF00098zf-CCHCcoord: 3..19
e-value: 6.5E-7
score: 29.1
coord: 52..66
e-value: 3.3E-6
score: 26.9
coord: 93..108
e-value: 3.7E-6
score: 26.7
coord: 135..151
e-value: 1.9E-6
score: 27.7
coord: 158..172
e-value: 7.9E-6
score: 25.7
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 4..19
score: 10.213
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 159..172
score: 10.345
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 136..151
score: 10.131
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 53..68
score: 10.197
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 94..108
score: 9.026
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 73..86
score: 10.015
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 123..154
e-value: 3.0E-9
score: 38.6
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 155..175
e-value: 2.3E-5
score: 26.5
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 70..122
e-value: 1.6E-13
score: 52.1
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 2..26
e-value: 3.6E-6
score: 28.5
coord: 41..69
e-value: 6.0E-6
score: 27.8
NoneNo IPR availablePANTHERPTHR23002:SF89CELLULAR NUCLEIC ACID-BINDING PROTEINcoord: 4..89
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 4..89
NoneNo IPR availablePANTHERPTHR23002:SF89CELLULAR NUCLEIC ACID-BINDING PROTEINcoord: 91..172
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 91..172
IPR025836Zinc knuckle CX2CX4HX4CPFAMPF14392zf-CCHC_4coord: 72..86
e-value: 4.2
score: 7.2
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 70..110
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 131..173
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 3..23
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 42..67