Cyclic nucleotide-binding domain-containing protein

Overview
NameCyclic nucleotide-binding domain-containing protein
Smed IDSMED30006397
Length (bp)782
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006397

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30006397SMESG000005563.1 SmedASXL_003767SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006397SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006397SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006397SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006397SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v4_19613_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006397SMESG000040419.1 SMESG000040416.1 SMESG000005563.1 dd_Smed_v6_19613_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 48.521 bits (114), Expect = 6.130e-6
Identity = 36/123 (29.27%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  220 TFEFRIFI--ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFG 561
            TF+   FI  E   P +   I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FG
Sbjct:   71 TFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFG 188          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 48.521 bits (114), Expect = 6.225e-6
Identity = 36/123 (29.27%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  220 TFEFRIFI--ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFG 561
            TF+   FI  E   P +   I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FG
Sbjct:   71 TFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFG 188          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Human
Match: CNBD2 (cyclic nucleotide binding domain containing 2 [Source:HGNC Symbol;Acc:HGNC:16145])

HSP 1 Score: 48.521 bits (114), Expect = 6.297e-6
Identity = 36/123 (29.27%), Postives = 65/123 (52.85%), Query Frame = 1
Query:  220 TFEFRIFI--ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFG 561
            TF+   FI  E   P +   I++K+   +T+DE++ V   L+ + + R Y   +Q  +AK   +E++  +R+++++G + +SFY I  G+V +     TK   G  A+L+       KG  FG
Sbjct:   71 TFDTMDFIAEEGHFPPKAIQIMQKKPSWRTEDEIQAVCNILQVLDSYRNYAEPLQLLLAKVMRFERFGRRRVIIKKGQKGNSFYFIYLGTVAI-----TKDEDGSSAFLDPHPKLLHKGSCFG 188          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Xenopus
Match: bmp4 (bone morphogenetic protein 4 [Source:Xenbase;Acc:XB-GENE-483058])

HSP 1 Score: 57.3806 bits (137), Expect = 6.008e-9
Identity = 33/114 (28.95%), Postives = 60/114 (52.63%), Query Frame = 1
Query:  241 IELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLE-------KGQSFG 561
            ++   PE+   +  +  + +++ +++ +   + GI + R Y  +MQ  +A+  YY ++   R++VR+GHR  SFY + SG     V+  T+ V G  A L+       KG SFG
Sbjct:    1 MQFTFPEKAIEVALRRPEQRSEQDIRFIRSMMMGILSFRRYSSQMQLMLARVVYYRRFGRGRVIVRKGHRGDSFYFVFSG-----VIAVTQDVDGSSALLDPEPILLHKGASFG 109          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Match: A0A1S3JVK5 (cyclic nucleotide-binding domain-containing protein 2 OS=Lingula unguis OX=7574 GN=LOC106176324 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.913e-21
Identity = 55/112 (49.11%), Postives = 79/112 (70.54%), Query Frame = 1
Query:  226 EFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +F+   +L++ EE K IL K   ++T+ EL  VEI L+ I+A  +Y +RMQRKIA+ G YE++  KRI+VRQ H  ++FYI+LSGSVVVVVM+    V   VA L++G++FG
Sbjct:  244 DFKANRQLRLSEEAKRILTKPSGERTEQELNYVEISLRNIKAYSDYTVRMQRKIAEVGMYERFEAKRIIVRQSHPPNAFYILLSGSVVVVVMDQETRVAKPVAILKRGRAFG 355          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Match: A0A1S3KD41 (uncharacterized protein LOC106180909 OS=Lingula unguis OX=7574 GN=LOC106180909 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.738e-20
Identity = 55/112 (49.11%), Postives = 79/112 (70.54%), Query Frame = 1
Query:  226 EFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +F+   +L++ EE K IL K   ++T+ EL  VEI L+ I+A  +Y +RMQRKIA+ G YE++  KRI+VRQ H  ++FYI+LSGSVVVVVM+    V   VA L++G++FG
Sbjct:  258 DFKANRQLRLSEEAKRILTKPSGERTEQELNYVEISLRNIKAYSDYTVRMQRKIAEVGMYERFEAKRIIVRQSHPPNAFYILLSGSVVVVVMDQETRVAKPVAILKRGRAFG 369          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Match: A0A3S1A9N7 (Cyclic nucleotide-binding domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_006018 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 2.146e-20
Identity = 51/112 (45.54%), Postives = 76/112 (67.86%), Query Frame = 1
Query:  226 EFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +F+   E ++ +E   I+ K V ++T  E+   +I L+ I   +++P RMQ+KIA+ G YEK+N KR+LVRQGHRAS +Y ILSG+V V+V++  +     VAYL KGQ+FG
Sbjct:  239 KFKANKESRITDEFVRIMSKMVWERTPQEIYYAQIALRNIECFQDFPARMQQKIAERGMYEKFNAKRVLVRQGHRASCYYFILSGAVAVMVLDQGEAFAKPVAYLTKGQTFG 350          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Match: A0A210QUY8 (Cyclic nucleotide-binding domain-containing protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11411 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.962e-18
Identity = 48/111 (43.24%), Postives = 75/111 (67.57%), Query Frame = 1
Query:  229 FRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            F+    ++VPEE K IL    +++T+ E+ V +I L+ I+A+ +YP  MQ KIA+ G YE+Y  KRI++RQGH AS++Y +LSG  VV+VM++++T      ++ KG  FG
Sbjct:  277 FKANKSMRVPEETKKILCTIPRNRTEREIYVAQIALRNIKAIADYPQNMQLKIAQVGQYERYEAKRIVLRQGHPASAYYFVLSGEAVVMVMDESRTYARPAFHINKGGDFG 387          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Match: A0A1S3K4R0 (uncharacterized protein LOC106178564 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106178564 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.232e-17
Identity = 46/111 (41.44%), Postives = 73/111 (65.77%), Query Frame = 1
Query:  229 FRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            F++    ++P+E K IL+K+ + +T+ ELK + I L+ I++  EYPIRMQ+++    +YE Y  KR +VRQGH  S+FY ILSG+VV+ V+ +   V   + +L +G  FG
Sbjct:   97 FKVKQAERIPQEAKRILQKQPERRTEKELKYLLIMLRTIKSFSEYPIRMQKRMCSVSWYEGYESKRAIVRQGHPPSAFYFILSGTVVITVLEENSHVPRTICFLHRGMEFG 207          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005682.1 (pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1 gene:ENSPMAG00000005146.1 transcript:ENSPMAT00000005682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 9.453e-7
Identity = 31/105 (29.52%), Postives = 52/105 (49.52%), Query Frame = 1
Query:  253 VPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFG 561
            +PE+      K   +++D E+  +   L+G+ + R Y   +Q  +A    YEK+  +R++V++GH    FY + SG V V   ND  +  +      L KG  FG
Sbjct:    1 LPEKAVRAALKPPSERSDTEVIFLRGLLRGLSSFRRYTAHLQLMLAGVVRYEKFGRRRVIVKKGHYGRRFYFVFSGLVAVTKDNDGSSAFIDPEPILLRKGAGFG 105          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO48124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK87])

HSP 1 Score: 83.1889 bits (204), Expect = 2.941e-18
Identity = 42/106 (39.62%), Postives = 65/106 (61.32%), Query Frame = 1
Query:  244 ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +++V  E+KNIL+   + +T+ +   V   L+ IRA  EYP R+Q K+   G+YE ++ KR ++RQG    +FY +LSGS VV V+ +  T    V +L +G SFG
Sbjct:  147 KMRVSAEVKNILQSPQEQRTEQQCAKVLFSLRSIRAFAEYPQRIQHKLINVGWYESHSSKRAILRQGQIPQAFYFVLSGSAVVTVLGEHDTFARTVHFLRRGDSFG 252          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO37972 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE96])

HSP 1 Score: 77.411 bits (189), Expect = 1.215e-17
Identity = 42/111 (37.84%), Postives = 66/111 (59.46%), Query Frame = 1
Query:  244 ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKG-IRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFG 561
            E+K+ ++   IL      +TD++L+   + LK  + A  EYP++MQ++  K G+YE +  KR+++RQGH A +FY ILSG+ +V ++      G      VA L KG SFG
Sbjct:   14 EIKLSQDAVQILSMSPGTRTDEQLQGALVALKASVPAFGEYPLKMQQQPVKVGWYESFEAKRVIIRQGHPAENFYFILSGTALVTLLFVDPVTGEQRSNTVAVLGKGSSFG 124          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO49748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFM7])

HSP 1 Score: 71.633 bits (174), Expect = 1.279e-15
Identity = 40/129 (31.01%), Postives = 73/129 (56.59%), Query Frame = 1
Query:  247 LKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKT--VGGVVAYLEKGQSFGVRFYFENTYDF*KISHILIKIP 627
            +++ +E+K+IL    +++  ++L+ V   L+ + +  E P+ MQ  + K  +++     +I+V+QGH A +FY I+SGSV VV  ND  +  V   VA L +G SFG     +N     + + ++ K+P
Sbjct:    1 IQISKEVKSILSLRPEERNTEQLQTVLYALQTMSSFAELPLHMQESVCKVAWHQSLPANKIIVKQGHLAENFYFIMSGSVTVVSENDPTSGQVFASVATLRRGASFGDLAILKNCT---RTATVVSKVP 126          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO32932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN2])

HSP 1 Score: 66.2402 bits (160), Expect = 1.042e-13
Identity = 37/104 (35.58%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  262 EIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFG 561
            E+KN+LKK   +++ +E+ +V   +K ++  + YP+ ++R++AK  YY+ Y   R++++QGH   SFY I+SGSVVV  + + +T G     +++ +  G SFG
Sbjct:    1 EVKNVLKKLSYNRSVEEVDMVLQIVKRMKGFQRYPMYVKRELAKVLYYDVYEQDRVIIKQGHIGVSFYFIVSGSVVVQRVEEDRTTGEKHNQIISEMTGGDSFG 104          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO32940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN1])

HSP 1 Score: 60.8474 bits (146), Expect = 1.279e-11
Identity = 38/108 (35.19%), Postives = 66/108 (61.11%), Query Frame = 1
Query:  253 VPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRA-SSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFG 561
            + ++ KN+ KK    +T +++KV+   +  ++A ++Y +  +R +AK  YYE++   R++V+QGH+  SS Y ILSG+V+V V  + KT G     +V  +  G SFG
Sbjct:    1 MSDKAKNLFKKPPWLRTSEDIKVIGGVVDKLKAFKKYSVLERRGLAKVVYYEQFEDGRVVVQQGHKGISSLYFILSGAVLVQVAEEDKTTGKITEHIVGEMFAGDSFG 108          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000005563.1 (SMESG000005563.1)

HSP 1 Score: 145.206 bits (365), Expect = 1.022e-43
Identity = 85/106 (80.19%), Postives = 90/106 (84.91%), Query Frame = 1
Query:  244 ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +LKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKY+    L  +G+       I+   VVVVVMNDTKTVGGVVAYLEKGQSFG
Sbjct:   12 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYS----LCLRGY-------IICILVVVVVMNDTKTVGGVVAYLEKGQSFG 106          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000005563.1 (SMESG000005563.1)

HSP 1 Score: 140.969 bits (354), Expect = 4.484e-42
Identity = 84/106 (79.25%), Postives = 89/106 (83.96%), Query Frame = 1
Query:  244 ELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +LKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEK   +  L  +G+       I+   VVVVVMNDTKTVGGVVAYLEKGQSFG
Sbjct:   12 QLKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREYPIRMQRKIAKYGYYEK--IRYSLCLRGY-------IICILVVVVVMNDTKTVGGVVAYLEKGQSFG 108          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 77.411 bits (189), Expect = 5.836e-16
Identity = 44/117 (37.61%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  226 EFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYL-KGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSG----SXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +FR   E  +  E   ILK     +T  +++ V + L + + A  E+PI MQ  +  +G+YEKYN K++++RQGH A +FY I+SG    SV     +  ++ G  VA+L+KG SFG
Sbjct:  266 DFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFG 382          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000069771.1 (SMESG000069771.1)

HSP 1 Score: 77.411 bits (189), Expect = 5.841e-16
Identity = 44/117 (37.61%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  226 EFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYL-KGIRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSG----SXXXXXMNDTKTVGGVVAYLEKGQSFG 561
            +FR   E  +  E   ILK     +T  +++ V + L + + A  E+PI MQ  +  +G+YEKYN K++++RQGH A +FY I+SG    SV     +  ++ G  VA+L+KG SFG
Sbjct:  266 DFRALKEKTLNIEAAKILKTHKSLRTPHQIRSVVLALTETVEAFSEFPISMQEALVCHGWYEKYNPKQVIIRQGHAAQNFYFIISGKTMVSVARKNNSSGESYGETVAFLKKGNSFG 382          
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000078298.1 (SMESG000078298.1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.794e-13
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 1
Query:  343 IRAVREYPIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSXXXXXMNDTKTVG----GVVAYLEKGQSFG 561
            + A  E+P+ MQ  + + G+YEK+  KRI++RQGH A +FY I+SG   V V    K  G      VA+L+KG SFG
Sbjct:  314 VEAFSEFPLNMQTSLIERGWYEKFEAKRIIIRQGHSALNFYFIISGITTVSVARTNKATGETYSETVAFLKKGNSFG 390          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CNBD26.130e-629.27cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD26.225e-629.27cyclic nucleotide binding domain containing 2 [Sou... [more]
CNBD26.297e-629.27cyclic nucleotide binding domain containing 2 [Sou... [more]
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bmp46.008e-928.95bone morphogenetic protein 4 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JVK59.913e-2149.11cyclic nucleotide-binding domain-containing protei... [more]
A0A1S3KD411.738e-2049.11uncharacterized protein LOC106180909 OS=Lingula un... [more]
A0A3S1A9N72.146e-2045.54Cyclic nucleotide-binding domain-containing protei... [more]
A0A210QUY84.962e-1843.24Cyclic nucleotide-binding domain-containing protei... [more]
A0A1S3K4R01.232e-1741.44uncharacterized protein LOC106178564 isoform X2 OS... [more]
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005682.19.453e-729.52pep scaffold:Pmarinus_7.0:GL476331:764222:769958:1... [more]
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481242.941e-1839.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379721.215e-1737.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497481.279e-1531.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329321.042e-1335.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329401.279e-1135.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005563.11.022e-4380.19SMESG000005563.1[more]
SMESG000005563.14.484e-4279.25SMESG000005563.1[more]
SMESG000069771.15.836e-1637.61SMESG000069771.1[more]
SMESG000069771.15.841e-1637.61SMESG000069771.1[more]
SMESG000078298.15.794e-1344.16SMESG000078298.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006397 ID=SMED30006397|Name=Cyclic nucleotide-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=782bp
CAATCAGAACGAGTGATAAACAAATATAATTGTTTACCTTTGTTAAAGCC
AGAATTGAAATTGACATTTATCCGGAGAAACAAAACCATTATAACTACGA
TCTCTAAAAAATGTTGCTCACAATTCATCTGAAGAATCGTTTAGAAAAAG
CCGATCTAGTTCAAAAGTTCGACCAAAACTTCATTTTAAAAGCTTAGTCA
AGCTTATCCTCGAATGCCAACGTTTGAATTCAGAATATTCATTGAGCTCA
AAGTTCCTGAAGAAATTAAAAATATATTGAAAAAAGAAGTGAAAGACAAA
ACTGATGACGAATTAAAAGTAGTTGAAATTTATCTGAAGGGTATCCGTGC
AGTGAGAGAATATCCAATACGAATGCAGAGGAAAATTGCAAAATATGGAT
ATTATGAAAAATATAACTGTAAGAGGATTTTGGTGAGACAGGGCCATCGA
GCATCGTCTTTTTATATCATTTTATCAGGATCAGTTGTTGTCGTCGTTAT
GAATGACACAAAAACTGTCGGTGGAGTTGTTGCATATCTAGAAAAAGGGC
AATCTTTTGGAGTTAGGTTTTATTTTGAAAATACATATGATTTTTAAAAG
ATTTCTCATATTTTGATTAAGATACCTCAATCTCGGTTAAAACTAGTGAT
AAGCATTTGCCGTCTTTTTTTGTTCCCGGGAAACGGGAAATTTTTCCTCA
GATCTGGGGAATCTCGAGAATTCACTATCATGAAGGGTCCCTAGAAAAGG
TTATAATGAAAATACAAACTGATTAAAATTAA
back to top

protein sequence of SMED30006397-orf-1

>SMED30006397-orf-1 ID=SMED30006397-orf-1|Name=SMED30006397-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
MPTFEFRIFIELKVPEEIKNILKKEVKDKTDDELKVVEIYLKGIRAVREY
PIRMQRKIAKYGYYEKYNCKRILVRQGHRASSFYIILSGSVVVVVMNDTK
TVGGVVAYLEKGQSFGVRFYFENTYDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014710RmlC-like_jellyroll
IPR000595cNMP-bd_dom
IPR018490cNMP-bd-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 67..122
e-value: 3.0E-7
score: 30.4
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 46..116
score: 12.155
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 56..124
e-value: 9.28577E-10
score: 50.4022
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 5..124
e-value: 7.8E-22
score: 79.4
NoneNo IPR availablePANTHERPTHR23011:SF31coord: 11..118
NoneNo IPR availablePANTHERPTHR23011UNCHARACTERIZEDcoord: 11..118
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 23..124