Peptidyl-prolyl cis-trans isomerase

Overview
NamePeptidyl-prolyl cis-trans isomerase
Smed IDSMED30006388
Length (bp)560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidyl-prolyl cis-trans isomerase (SMED30006388) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30006388) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidyl-prolyl cis-trans isomerase (SMED30006388) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidyl-prolyl cis-trans isomerase (SMED30006388) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006388

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006388SMESG000006567.1 SmedASXL_008622SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006388SMESG000006567.1 dd_Smed_v4_1508_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006388SMESG000006567.1 Contig42664newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006388SMESG000006567.1 Contig42664uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIA (peptidylprolyl isomerase A [Source:HGNC Symbol;Acc:HGNC:9253])

HSP 1 Score: 210.305 bits (534), Expect = 1.092e-69
Identity = 114/158 (72.15%), Postives = 133/158 (84.18%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+ +G  +GR+ F+L+ D +PKTA+NFRAL TGEKGFGYKGS FHRII  FM QGGDFTR NGTGGKSIYGEKF+DE+F  KHT PG+LSMANAGPNTNGSQFFI T  T+WLDGKHVVFG+V+EGM IV+A+E+ GS +GK SK + I DCGQL
Sbjct:    7 FFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIF (peptidylprolyl isomerase F [Source:HGNC Symbol;Acc:HGNC:9259])

HSP 1 Score: 211.846 bits (538), Expect = 1.359e-69
Identity = 109/158 (68.99%), Postives = 127/158 (80.38%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + D+ ANG  +GR+V +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I SFM Q GDFT  NGTGGKSIYG +F DE+F  KH  PG+LSMANAGPNTNGSQFFI T+ T WLDGKHVVFG V+EGM++VK IE  GS SG+ SK ++I DCGQL
Sbjct:   49 YLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQL 206          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIAL4C (peptidylprolyl isomerase A like 4C [Source:HGNC Symbol;Acc:HGNC:33995])

HSP 1 Score: 189.504 bits (480), Expect = 1.894e-61
Identity = 107/158 (67.72%), Postives = 122/158 (77.22%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+ +G  +GRI  KL+ D IPKTA+NFRAL TGEKGF YKGS FHRII  FM QGGDFTR NGTG KSIYGEKFDDE+   KHT  G+LSMANAGPNTNGSQFFI T  T+WLDGKHV FG+V+E + IV+A+E  G  + K SK + I DCGQ 
Sbjct:    7 FFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIE (peptidylprolyl isomerase E [Source:HGNC Symbol;Acc:HGNC:9258])

HSP 1 Score: 189.889 bits (481), Expect = 1.897e-60
Identity = 105/168 (62.50%), Postives = 122/168 (72.62%), Query Frame = 3
Query:   42 MAKHISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            +AK      + + DI       GRI   L  D+ P TA+NFR LCT EKGFG+KGS FHRII  FM QGGDFT  NGTGGKSIYG+KFDDE+F  KHT PGLLSMAN+GPNTNGSQFF+T   T WLDGKHVVFGEV EG+++++ IE  GS  GKP + VII DCG+
Sbjct:   81 IAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGE 248          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Match: PPIAL4G (peptidylprolyl isomerase A like 4G [Source:HGNC Symbol;Acc:HGNC:33996])

HSP 1 Score: 186.808 bits (473), Expect = 2.096e-60
Identity = 105/158 (66.46%), Postives = 120/158 (75.95%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+ +G  +GRI  K + D IPKTA+NFRAL TGEKGF YKGS FHRII  FM QGGDFT  NGTG KSIYGEKFDDE+   KHT  G+LSMANAGPNTNGSQFFI T  T+WLDGKHV FG+V+E + IV+A+E  G  + K SK + I DCGQ 
Sbjct:    7 FFDITVDGKPLGRISIKQFADKIPKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTHPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAGPNTNGSQFFICTAKTEWLDGKHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQF 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-3 (Peptidyl-prolyl cis-trans isomerase 3 [Source:UniProtKB/Swiss-Prot;Acc:P52011])

HSP 1 Score: 209.534 bits (532), Expect = 1.244e-69
Identity = 117/168 (69.64%), Postives = 136/168 (80.95%), Query Frame = 3
Query:   66 TRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG-------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            ++ FFDI+  G + GRIV +LYDD+ PKTA NFRALCTGE G G       +KGSKFHRII +FM+QGGDFTRGNGTGG+SIYGEKF DE+FK KHT PG+LSMANAGPNTNGSQFF+ TV T+WLDGKHVVFG V EG+++VKA+E  GS SGKP K  +I DCGQL
Sbjct:    4 SKVFFDITIGGKASGRIVMELYDDVVPKTAGNFRALCTGENGIGKSGKPLHFKGSKFHRIIPNFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGRVVEGLDVVKAVESNGSQSGKPVKDCMIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 203.371 bits (516), Expect = 2.643e-67
Identity = 116/167 (69.46%), Postives = 130/167 (77.84%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG-------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDI+  G   GRIV +LY+DI PKTA+NFRALCTGEKG G       +KGSKFHRII  FM+QGGDFTRGNGTGG+SIYGEKF DE+FK KHT PG+LSMANAGPNTNGSQFF+ TV T WLDGKHVVFG V EG++IV  +E  GS SG P    +I DCGQL
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-7 (Peptidyl-prolyl cis-trans isomerase 7 [Source:UniProtKB/Swiss-Prot;Acc:P52015])

HSP 1 Score: 203.371 bits (516), Expect = 2.643e-67
Identity = 116/167 (69.46%), Postives = 130/167 (77.84%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG-------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDI+  G   GRIV +LY+DI PKTA+NFRALCTGEKG G       +KGSKFHRII  FM+QGGDFTRGNGTGG+SIYGEKF DE+FK KHT PG+LSMANAGPNTNGSQFF+ TV T WLDGKHVVFG V EG++IV  +E  GS SG P    +I DCGQL
Sbjct:    5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMIQGGDFTRGNGTGGESIYGEKFPDENFKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGKHVVFGRVVEGLDIVSKVEGNGSSSGTPKSECLIADCGQL 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-1 (Peptidyl-prolyl cis-trans isomerase 1 [Source:UniProtKB/Swiss-Prot;Acc:P52009])

HSP 1 Score: 200.675 bits (509), Expect = 7.498e-66
Identity = 111/171 (64.91%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG-------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            S+  + FFD+S      GR+  +L++D+ PKTA+NFRALCTGEKG G       +KGSKFHRII  FM+QGGDFTR NGTGG+SIYG KF DE+F  KHT PG LSMANAGPNTNGSQFFI TV T WLDG HVVFG+V +GM +VK IEK+GS SG P+K+V I DCG+L
Sbjct:   19 SQRPKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQGVALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAGPNTNGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGSRSGAPAKTVTIADCGEL 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Match: cyn-2 (Peptidyl-prolyl cis-trans isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:P52010])

HSP 1 Score: 189.119 bits (479), Expect = 1.495e-61
Identity = 112/168 (66.67%), Postives = 131/168 (77.98%), Query Frame = 3
Query:   66 TRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKG-------FGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
             + FFDI+  G   GRIV +LY+DI PKTA+NFRALCTGEKG         +KGSKFHRII  FM+QGGDFT GNGTGG+SI+GEKFDDE+FK KHT PG+LSMAN G NTNGSQFF+ TV T WLDGKHVVFG+V EGM++VKAIE  GS+ G PS   +I DCG++
Sbjct:    4 VKVFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQGGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCGANTNGSQFFLCTVKTTWLDGKHVVFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: Cyp1 (gene:FBgn0004432 transcript:FBtr0074238)

HSP 1 Score: 204.527 bits (519), Expect = 8.895e-67
Identity = 111/168 (66.07%), Postives = 131/168 (77.98%), Query Frame = 3
Query:   45 AKHISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            A  +S + R FFD++A+   +GRIV +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I +FM QGGDFT  NGTGGKSIYG KF DE+F+ KHT  G+LSMANAG NTNGSQFFI TV T WLD KHVVFGEV EG+++VK IE  GS SGK SK +I+ + G L
Sbjct:   60 ASKMSTLPRVFFDMTADNEPLGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPNFMCQGGDFTNHNGTGGKSIYGNKFPDENFELKHTGSGILSMANAGANTNGSQFFICTVKTAWLDNKHVVFGEVVEGLDVVKKIESYGSQSGKTSKKIIVANSGSL 227          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG7768 (gene:FBgn0036415 transcript:FBtr0075736)

HSP 1 Score: 201.83 bits (512), Expect = 1.169e-66
Identity = 109/162 (67.28%), Postives = 128/162 (79.01%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + R +FDI+A G  +GRIV +L  D+ PKTA+NFRALCTGEKG+GYKGS FHR+I +FM QGGDFT  NGTGG+SIYG KF DE+F+ KHT  G+LSMANAG NTNGSQFFI T  T WLD KHVVFG+V EGM+IV+ +E  GS  GK SK VII+DCG L
Sbjct:    3 LPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG7768 (gene:FBgn0036415 transcript:FBtr0075737)

HSP 1 Score: 201.83 bits (512), Expect = 1.169e-66
Identity = 109/162 (67.28%), Postives = 128/162 (79.01%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + R +FDI+A G  +GRIV +L  D+ PKTA+NFRALCTGEKG+GYKGS FHR+I +FM QGGDFT  NGTGG+SIYG KF DE+F+ KHT  G+LSMANAG NTNGSQFFI T  T WLD KHVVFG+V EGM+IV+ +E  GS  GK SK VII+DCG L
Sbjct:    3 LPRVYFDIAAGGEKLGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGNKFPDENFELKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVESYGSQDGKTSKKVIIEDCGAL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: cyp33 (gene:FBgn0028382 transcript:FBtr0086945)

HSP 1 Score: 178.718 bits (452), Expect = 8.681e-56
Identity = 98/163 (60.12%), Postives = 117/163 (71.78%), Query Frame = 3
Query:   60 KMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            +  + FFDI   G   GRIV  L  D+ PKTA+NFR LCT E+G+GYKG  FHR+I  FM QGGDFT  NGTGGKSIYG+KF+DE+F  KH   G LSMAN+G NTNGSQFFI T  T WLD KHVVFG V  G E+V+ +E+ GS SG PS+ ++I  CG+L
Sbjct:  137 RNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYGYKGCSFHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Match: CG2852 (gene:FBgn0034753 transcript:FBtr0071933)

HSP 1 Score: 159.458 bits (402), Expect = 2.385e-49
Identity = 92/161 (57.14%), Postives = 117/161 (72.67%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDS-GKPSKSVIIDDCGQL 545
            + FFDI+  G   GRI   L+   +PKT +NF+ L    +G GYKGSKFHRII  FM+QGGDFT+G+GTGG+SIYGE+F+DE+FK KH   G LSMANAG +TNGSQFFITT  T WLDG+HVVFG++  GM +V+ IE   +D+  +P K V+I + G L
Sbjct:   30 KVFFDITIGGEPAGRIEIGLFGKTVPKTVENFKELALKPQGEGYKGSKFHRIIKDFMIQGGDFTKGDGTGGRSIYGERFEDENFKLKHYGAGWLSMANAGKDTNGSQFFITTKQTSWLDGRHVVFGKILSGMNVVRQIENSATDARDRPVKDVVIANSGTL 190          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppiaa (peptidylprolyl isomerase Aa (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-8556])

HSP 1 Score: 201.06 bits (510), Expect = 2.894e-66
Identity = 104/160 (65.00%), Postives = 125/160 (78.12%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFD++A G  +GR+V +L  D+ P+TA+NFR LCTG+ G+GYKGS FHR+I  FM QGGDFT  NGTGGKSIYG KF DE+F  KHT  G LSMANAGPNTNGSQFFI T +T WLDGKHVVFG+V EG++++K +E  GS SGK S  +II DCGQL
Sbjct:    5 KVFFDLTAGGSPVGRVVMELRTDVVPRTAENFRQLCTGQPGYGYKGSSFHRVIPGFMCQGGDFTNHNGTGGKSIYGNKFADENFNLKHTGAGCLSMANAGPNTNGSQFFICTALTSWLDGKHVVFGQVVEGLDVIKKVEGFGSSSGKTSAKIIIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 202.216 bits (513), Expect = 3.155e-66
Identity = 105/158 (66.46%), Postives = 128/158 (81.01%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+A+   +GR+ F+L  D+ PKTA+NFRALCTGE GFGYKGS FHR+I  FM QGGDFT  NGTGGKSIYG +F DE+FK KHT PG+LSMANAG NTNGSQFFI T  T+WLDG+HVVFG V+EGM++V+ +E LGS SG+ ++ + I DCG+L
Sbjct:   34 FFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPQFMCQGGDFTNHNGTGGKSIYGPRFPDENFKLKHTGPGILSMANAGVNTNGSQFFICTAKTEWLDGRHVVFGSVKEGMDVVRKVEALGSRSGRTAQRISITDCGEL 191          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppiab (peptidylprolyl isomerase Ab (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-7459])

HSP 1 Score: 200.29 bits (508), Expect = 6.717e-66
Identity = 110/160 (68.75%), Postives = 126/160 (78.75%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFDI+ +G   GRIV +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FM QGGDFT  NGTGGKSIYG KF+DE+F  KH   G LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V +G+++V AIEK GS SGK S  V+I +CGQL
Sbjct:    5 KVFFDITIDGKEAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPQFMCQGGDFTNHNGTGGKSIYGNKFEDENFTLKHGGKGTLSMANAGPNTNGSQFFICTADTNWLDGKHVVFGKVVDGLDVVDAIEKKGSSSGKCSAKVVIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppifa (peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-GENE-040912-52])

HSP 1 Score: 193.356 bits (490), Expect = 7.790e-63
Identity = 106/160 (66.25%), Postives = 123/160 (76.88%), Query Frame = 3
Query:   72 TFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQLH 548
             F DI+A+G  +GRI+ +L+ D+ PKT  NFRALCTGE GFGYKGS FHRII  FM QGGDFT  NGTGGKSIYG+KF+DE+FK KHT  G+LSMAN+GPNTNGSQFFI T  T+WLDGKHVVFG+V+EGME V  +E  G   G   K V I DCG+L 
Sbjct:   30 VFMDIAADGEFIGRIIIELFADVVPKTVANFRALCTGEHGFGYKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFNDENFKLKHTGAGILSMANSGPNTNGSQFFICTAKTEWLDGKHVVFGQVKEGMETVSLMESYGLHDGGTVKKVAITDCGELQ 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 184.496 bits (467), Expect = 4.948e-57
Identity = 101/167 (60.48%), Postives = 125/167 (74.85%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG--------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            R FFD+      +GR+VF+L+ D+ PKTA+NFRALCTGEKG G        +KG  FHRII SFM+QGGDF+  NGTGG+SIYG+KF+DE+F YKH + GLLSMANAGPNTNGSQFFITTV T  LDGKHVVFG+V +GM +VK +E + +    P K  +I +CG+
Sbjct:   17 RVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPFHRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKMLEAMETKEDNPVKPCVIAECGE 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: ppia (peptidylprolyl isomerase A (cyclophilin A) [Source:NCBI gene;Acc:394470])

HSP 1 Score: 211.075 bits (536), Expect = 6.117e-70
Identity = 110/162 (67.90%), Postives = 130/162 (80.25%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + R FFDI+ +G  MGRI+ +L  D+ PKTA+NFRALCT EKGFGYK S FHRII  FM QGGDFT  NGTGGKSIYG KF DE+F+ +HT PG+LSMANAG NTNGSQFFI T  T WLDGKHVVFG V +GM++V+ +EKLGS SGKP+K ++I +CGQL
Sbjct:    3 LPRVFFDIAVDGCPMGRIIMELRSDVVPKTAENFRALCTNEKGFGYKNSGFHRIIPEFMCQGGDFTNHNGTGGKSIYGNKFADENFQLRHTGPGILSMANAGANTNGSQFFICTAKTSWLDGKHVVFGTVIDGMDVVRNMEKLGSQSGKPAKKIVIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: neurl4 (neuralized E3 ubiquitin protein ligase 4 [Source:Xenbase;Acc:XB-GENE-5825550])

HSP 1 Score: 197.593 bits (501), Expect = 3.093e-64
Identity = 104/163 (63.80%), Postives = 129/163 (79.14%), Query Frame = 3
Query:   60 KMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            K    + D+ A+   +GR+ F+L  D+ PKTA+NFRALCTGEKGFGYKGS FHRII +FM QGGDFT  NGTGGKSIYG +F DE+F  KHT PG++SMANAGPNTNGSQFFI TV T+WLD KHVVFG +++G +I+K IE  GS +G+PSK V++ +CG+L
Sbjct:   37 KNPMVYMDLVADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRIIPNFMCQGGDFTNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFICTVETEWLDNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECGEL 199          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: zbtb26 (zinc finger and BTB domain containing 26 [Source:Xenbase;Acc:XB-GENE-5891654])

HSP 1 Score: 187.963 bits (476), Expect = 6.044e-61
Identity = 103/159 (64.78%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDISAN + +GRIV ++         NF  LCTGE GFGYKG  FHRII SFM QGGDFT  NGTGGKSIYG KF+DE+F  KH+ PG+LSMANAGPN NGSQFFI+T+  +WL+GKHVVFG V EGME+VK +E  G +SGK SK ++I DCG L
Sbjct:    5 RVFFDISANDIPLGRIVMEV--------KNFLKLCTGECGFGYKGCTFHRIIPSFMCQGGDFTNHNGTGGKSIYGGKFEDENFNLKHSTPGVLSMANAGPNCNGSQFFISTIKAEWLNGKHVVFGHVVEGMEVVKKMESYGCNSGKTSKKILISDCGVL 155          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 189.119 bits (479), Expect = 2.125e-60
Identity = 106/167 (63.47%), Postives = 117/167 (70.06%), Query Frame = 3
Query:   45 AKHISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
             K +    + + DI       GRI F L  DI P T +NFR LC  EKGFGYKGS FHRII  FMLQ GDFT  NGTGGKSIYG KFDDE+F  KHT PGLLSMAN+G NTNGSQFFIT   T WLDGKHVVFGEV EGM++V+ IE  G   GKP + VII DCG+
Sbjct:   71 PKKVRANPQVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCGE 237          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Match: PPIE (peptidylprolyl isomerase E (cyclophilin E) [Source:NCBI gene;Acc:100495035])

HSP 1 Score: 189.504 bits (480), Expect = 6.623e-60
Identity = 106/167 (63.47%), Postives = 117/167 (70.06%), Query Frame = 3
Query:   45 AKHISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
             K +    + + DI       GRI F L  DI P T +NFR LC  EKGFGYKGS FHRII  FMLQ GDFT  NGTGGKSIYG KFDDE+F  KHT PGLLSMAN+G NTNGSQFFIT   T WLDGKHVVFGEV EGM++V+ IE  G   GKP + VII DCG+
Sbjct:  113 PKKVRANPQVYMDIKIGNKPAGRIRFLLRADIVPMTVENFRCLCNHEKGFGYKGSSFHRIIPQFMLQAGDFTNHNGTGGKSIYGRKFDDENFILKHTGPGLLSMANSGANTNGSQFFITCDKTDWLDGKHVVFGEVMEGMDVVRQIEAQGGKDGKPKQKVIISDCGE 279          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppia (peptidylprolyl isomerase A [Source:MGI Symbol;Acc:MGI:97749])

HSP 1 Score: 209.92 bits (533), Expect = 1.240e-69
Identity = 113/158 (71.52%), Postives = 133/158 (84.18%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+A+   +GR+ F+L+ D +PKTA+NFRAL TGEKGFGYKGS FHRII  FM QGGDFTR NGTGG+SIYGEKF+DE+F  KHT PG+LSMANAGPNTNGSQFFI T  T+WLDGKHVVFG+V+EGM IV+A+E+ GS +GK SK + I DCGQL
Sbjct:    7 FFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppif (peptidylprolyl isomerase F (cyclophilin F) [Source:MGI Symbol;Acc:MGI:2145814])

HSP 1 Score: 210.305 bits (534), Expect = 3.579e-69
Identity = 107/158 (67.72%), Postives = 127/158 (80.38%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + D+ A+G  +GR+V +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I +FM Q GDFT  NGTGG+SIYG +F DE+F  KH  PG+LSMANAGPNTNGSQFFI T+ T WLDGKHVVFG V+EGM++VK IE  GS SGK SK ++I DCGQL
Sbjct:   48 YLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQL 205          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppia (peptidylprolyl isomerase A [Source:MGI Symbol;Acc:MGI:97749])

HSP 1 Score: 197.208 bits (500), Expect = 7.798e-65
Identity = 106/154 (68.83%), Postives = 124/154 (80.52%), Query Frame = 3
Query:   84 ISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            +S   V + ++     D +PKTA+NFRAL TGEKGFGYKGS FHRII  FM QGGDFTR NGTGG+SIYGEKF+DE+F  KHT PG+LSMANAGPNTNGSQFFI T  T+WLDGKHVVFG+V+EGM IV+A+E+ GS +GK SK + I DCGQL
Sbjct:    3 LSVCTVKLQKLSLLFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL 156          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:MGI Symbol;Acc:MGI:1917118])

HSP 1 Score: 188.734 bits (478), Expect = 1.777e-59
Identity = 104/167 (62.28%), Postives = 121/167 (72.46%), Query Frame = 3
Query:   45 AKHISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            AK      + + DI       GRI   L  D+ P TA+NFR LCT EKGFG+KGS FHRII  FM QGGDFT  NGTGGKSIYG+KFDDE+F  KHT PGLLSMAN+GPNTNGSQFF+T   T WLDGKHVVFGEV EG+++++ IE  GS  GKP + V+I DCG+
Sbjct:  133 AKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGE 299          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Match: Ppid (peptidylprolyl isomerase D (cyclophilin D) [Source:MGI Symbol;Acc:MGI:1914988])

HSP 1 Score: 187.193 bits (474), Expect = 4.929e-58
Identity = 104/172 (60.47%), Postives = 128/172 (74.42%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG--------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            SK  R FFD+   G  +GRIV +L+ DI PKTA+NFRALCTGEKG G        +KG  FHRII  FM+QGGDF+  NGTGG+SIYGEKF+DE+F YKH + GLLSMANAGPNTNGSQFFITTV T  LDGKHVVFG+V +G+ + + +E +  +  KP+K  +I +CG+L
Sbjct:   13 SKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARTLENVEVNGEKPAKLCVIAECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P18253|CYPH_SCHPO (Peptidyl-prolyl cis-trans isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppi1 PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 7.416e-76
Identity = 121/162 (74.69%), Postives = 136/162 (83.95%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M+  FFD+ ANG  +GRIVFKL+DD+ PKTA NFRALCTGEKG+GY GS FHR+I  FMLQGGDFTRGNGTGGKSIYGEKF DE+F  KH KPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV EGM++VK +E LGS+SG     ++ID CG +
Sbjct:    1 MSNCFFDVIANGQPLGRIVFKLFDDVVPKTAANFRALCTGEKGYGYAGSTFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFPDENFALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFGEVTEGMDVVKKVESLGSNSGATRARIVIDKCGTV 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P14088|PPIA_ECHGR (Peptidyl-prolyl cis-trans isomerase OS=Echinococcus granulosus OX=6210 GN=CYP-1 PE=2 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 8.677e-74
Identity = 118/159 (74.21%), Postives = 133/159 (83.65%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFDIS  G   GRIVF L+DD+PKT +NFRALCTGEKGFGYKGSKFHRII  FM QGGDFT GNGTGGKSIYG KF+DE+F +KH+KP +LSMANAG NTNGSQFFITT VT WLDGKHVVFGEVE G ++VK +E +GS SGK S+ V+I DCGQL
Sbjct:    4 KCFFDISIGGKPAGRIVFALFDDVPKTVENFRALCTGEKGFGYKGSKFHRIIPGFMCQGGDFTAGNGTGGKSIYGSKFEDENFNHKHSKPMMLSMANAGKNTNGSQFFITTAVTSWLDGKHVVFGEVESGEDVVKDMEAVGSSSGKTSQEVLITDCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P22011|PPIA_CANAL (Peptidyl-prolyl cis-trans isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CYP1 PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.356e-71
Identity = 115/162 (70.99%), Postives = 134/162 (82.72%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M+  +FD+SA+G  +G+I FKLYDD+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FMLQGGDFT  NGTGGKSIYG KF DE+F  +H +PGLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEV +G++IVK IE  GS SG  SK ++I++ GQL
Sbjct:    1 MSTVYFDVSADGQKLGKITFKLYDDVVPKTAENFRALCTGEKGFGYKGSIFHRVIPQFMLQGGDFTNFNGTGGKSIYGTKFADENFVKRHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTDGLDIVKKIESFGSGSGATSKKIVIEESGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P91791|PPIA_HEMPU (Peptidyl-prolyl cis-trans isomerase OS=Hemicentrotus pulcherrimus OX=7650 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.838e-71
Identity = 115/160 (71.88%), Postives = 132/160 (82.50%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFD+ ANG ++GRIV +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FM QGGDFTR NGTGGKSIYGEKF DE+F  KHT+PG+LSMANAG NTNGSQFFI T VT WLDGKHVVFG V +G++I+K +E  GSDSGK SK + I DCGQL
Sbjct:    5 QVFFDLQANGENLGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPGFMCQGGDFTRHNGTGGKSIYGEKFADENFTLKHTQPGILSMANAGVNTNGSQFFICTAVTSWLDGKHVVFGAVTQGLDIIKKVESYGSDSGKTSKKITIADCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Match: sp|P10111|PPIA_RAT (Peptidyl-prolyl cis-trans isomerase A OS=Rattus norvegicus OX=10116 GN=Ppia PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 1.864e-70
Identity = 115/158 (72.78%), Postives = 134/158 (84.81%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            FFDI+A+G  +GR+ F+L+ D +PKTA+NFRAL TGEKGFGYKGS FHRII  FM QGGDFTR NGTGGKSIYGEKF+DE+F  KHT PG+LSMANAGPNTNGSQFFI T  T+WLDGKHVVFG+V+EGM IV+A+E+ GS +GK SK + I DCGQL
Sbjct:    7 FFDITADGEPLGRVCFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMSIVEAMERFGSRNGKTSKKITISDCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A4S2LI26 (Peptidyl-prolyl cis-trans isomerase OS=Opisthorchis felineus OX=147828 GN=CRM22_007025 PE=3 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 7.199e-78
Identity = 124/160 (77.50%), Postives = 140/160 (87.50%), Query Frame = 3
Query:   66 TRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            TR FFDI+A+G  +GRI+F+LY D+PKT +NFRALCTGE GFGYKGSKFHRII  FM QGGDFT GNGTGGKSIYG KFDDE+FK+KHTKPGLLSMANAGPNTNGSQFFITTV   WLD KHVVFGEV+EGM++VK +E LGS SG+ SK+V+I DCGQL
Sbjct:    3 TRVFFDITADGSQLGRIIFELYADVPKTVENFRALCTGEMGFGYKGSKFHRIIPQFMCQGGDFTAGNGTGGKSIYGNKFDDENFKHKHTKPGLLSMANAGPNTNGSQFFITTVPCSWLDDKHVVFGEVKEGMDVVKKMEALGSSSGRTSKTVVIADCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A074ZXV6 (Peptidyl-prolyl cis-trans isomerase OS=Opisthorchis viverrini OX=6198 GN=T265_01694 PE=3 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 9.061e-78
Identity = 124/160 (77.50%), Postives = 140/160 (87.50%), Query Frame = 3
Query:   66 TRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            TR FFDI+A+G  +GRI+F+LY D+PKT +NFRALCTGE G+GYKGSKFHRII  FM QGGDFT GNGTGGKSIYG KFDDE+FK+KHTKPGLLSMANAGPNTNGSQFFITTV   WLD KHVVFGEV+EGM++VK +E LGS SGK SK+V+I DCGQL
Sbjct:    3 TRVFFDITADGSQLGRIIFELYADVPKTVENFRALCTGEMGYGYKGSKFHRIIPQFMCQGGDFTAGNGTGGKSIYGNKFDDENFKHKHTKPGLLSMANAGPNTNGSQFFITTVPCSWLDDKHVVFGEVKEGMDVVKKMEALGSSSGKTSKTVVIADCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A2C6A2A9 (Peptidyl-prolyl cis-trans isomerase OS=Cordyceps sp. RAO-2017 OX=2004951 GN=CDD83_10551 PE=3 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.113e-76
Identity = 125/162 (77.16%), Postives = 140/162 (86.42%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M++ +F++SA+   +G+IV KLYDD+ PKTA+NFRAL TGEKGFGY GS FHR+I+ FMLQGGDFT  NGTGGKSIYGEKF DE+FK KHTKPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV EGM++VK IE LGS SGK SK VIID CGQL
Sbjct:    1 MSQVYFEVSADKKPLGKIVMKLYDDVVPKTAENFRALATGEKGFGYAGSSFHRVITDFMLQGGDFTNHNGTGGKSIYGEKFADENFKLKHTKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVTEGMDVVKQIEALGSQSGKTSKKVIIDKCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: A0A0E9NJT9 (Peptidyl-prolyl cis-trans isomerase OS=Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) OX=698492 GN=G7K_4282-t1 PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.764e-76
Identity = 127/162 (78.40%), Postives = 137/162 (84.57%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCG 539
            +KM+  FFD SANG S+GRI FKLYD++ PKTA NFRALCTGEKGFGYKGS FHR+I  FMLQGGDFTRGNGTGGKSIYGEKF DE+F  +HTKPGLLSMANAGPNTNGSQFFITTVVT WLDGKHVVFGEV  GM+IVK IE LGS SG     + IDDCG
Sbjct:   20 AKMSNVFFDTSANGTSLGRIEFKLYDEVVPKTAANFRALCTGEKGFGYKGSAFHRVIPQFMLQGGDFTRGNGTGGKSIYGEKFADENFNLRHTKPGLLSMANAGPNTNGSQFFITTVVTSWLDGKHVVFGEVVSGMDIVKKIEGLGSQSGATRAKITIDDCG 181          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Match: F1ASZ6 (Peptidyl-prolyl cis-trans isomerase OS=Clonorchis sinensis OX=79923 GN=CPA PE=2 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 4.233e-76
Identity = 123/160 (76.88%), Postives = 138/160 (86.25%), Query Frame = 3
Query:   66 TRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            TR FFDI+A+G  +GRI+F+LY D+PKT +NFRALCTGE GFGYKGSKF RII  FM QGGDFT GNGTGGKSIYG KFD E+FK+KHTKPGLLSMANAGPNTNGSQFFITTV   WLD KHVVFGEV+EGM++VK +E LGS SGK SK+V+I DCGQL
Sbjct:    3 TRVFFDITADGSQLGRIIFELYSDVPKTVENFRALCTGEMGFGYKGSKFRRIIPQFMCQGGDFTAGNGTGGKSIYGNKFDGENFKHKHTKPGLLSMANAGPNTNGSQFFITTVPCSWLDDKHVVFGEVKEGMDVVKKMEALGSSSGKTSKTVVIADCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifb (peptidyl-prolyl cis-trans isomerase A-like [Source:NCBI gene;Acc:103040813])

HSP 1 Score: 204.142 bits (518), Expect = 4.403e-67
Identity = 105/158 (66.46%), Postives = 129/158 (81.65%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            +FDI+A+   +GR+ F+L  D+ PKTA+NFRALCTGE G+GYKGS FHR+I  FM QGGDFT  NGTGGKSIYG +F DE+FK +HT PG+LSMANAGPNTNGSQFFI TV T+WLDG+HVVFG V++G+++VK +E  GS SGK SK + I DCG+L
Sbjct:   36 YFDIAADNQPLGRVTFELNADVVPKTAENFRALCTGEHGYGYKGSIFHRVIPQFMCQGGDFTHHNGTGGKSIYGPRFHDENFKLRHTGPGILSMANAGPNTNGSQFFICTVKTEWLDGRHVVFGSVKDGLDVVKQVEAFGSRSGKTSKRITITDCGEL 193          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppiab (peptidylprolyl isomerase Ab (cyclophilin A) [Source:ZFIN;Acc:ZDB-GENE-030131-7459])

HSP 1 Score: 198.364 bits (503), Expect = 2.725e-65
Identity = 111/159 (69.81%), Postives = 124/159 (77.99%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDI+ NG S GRIV ++ D+      NFRALCTGEKGFGYKGS FHRII  FM QGGDFT+ NGTGGKSIYGEKF DE+F  KH   G LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V EG+++V+A+EK GS SGK S  V+I DCGQL
Sbjct:    5 RVFFDITVNGTSAGRIVIEVSDE------NFRALCTGEKGFGYKGSGFHRIIPGFMCQGGDFTKHNGTGGKSIYGEKFADENFTLKHQGLGTLSMANAGPNTNGSQFFICTADTAWLDGKHVVFGKVVEGIDVVEAVEKKGSSSGKCSAKVLIADCGQL 157          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppifa (peptidyl-prolyl cis-trans isomerase F, mitochondrial [Source:NCBI gene;Acc:103029282])

HSP 1 Score: 196.438 bits (498), Expect = 3.697e-64
Identity = 108/158 (68.35%), Postives = 124/158 (78.48%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            F D+SA+G  +GRIV +L+ D+ PKTA+NFRALCTGE GFGYKGS FHRII  FM QGGDFT  NGTGGKSIYG+KF DE+FK KHT PG+LSMAN+GPNTNGSQFFI TV T+ LDGKHVVFG V EGME V  +E  G   G   K ++I DCG+L
Sbjct:   31 FLDVSADGEFIGRIVIELHADVVPKTAENFRALCTGEHGFGYKGSVFHRIIPEFMCQGGDFTNHNGTGGKSIYGKKFSDENFKLKHTGPGVLSMANSGPNTNGSQFFICTVKTECLDGKHVVFGHVTEGMETVSVMESYGLHDGGTVKKIVITDCGEL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppie (peptidylprolyl isomerase E (cyclophilin E) [Source:ZFIN;Acc:ZDB-GENE-050417-167])

HSP 1 Score: 184.111 bits (466), Expect = 7.968e-58
Identity = 101/159 (63.52%), Postives = 118/159 (74.21%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            + + DI       GR+ F L  D+ P TA+NFR LCT EKGFG+KGS FHR+I  FM QGGDFT  NGTGGKSIYG KFDDE+F  KHT PG LSMAN+G NTNGSQFFIT   T WLDGKHVVFGE+ EGM++V+A+E  G+  GKP + VII DCG+
Sbjct:  138 QVYMDIKIGNKPAGRLRFLLRADVVPMTAENFRCLCTHEKGFGFKGSSFHRVIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTGPGQLSMANSGTNTNGSQFFITCDKTDWLDGKHVVFGELMEGMDVVRAMEAQGTKDGKPKQKVIISDCGE 296          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Match: ppid (peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GENE-040625-34])

HSP 1 Score: 183.341 bits (464), Expect = 9.236e-57
Identity = 101/167 (60.48%), Postives = 126/167 (75.45%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG--------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            R +FD+   G  +GR+VF+L+ D+ PKTA+NFRALCTGEKG G        +KG  FHRII  FM+QGGDF+  NGTGG+SIYG+KF+DE+F YKH K GLLSMANAGPNTNGSQFFITTV T  LDGKHVVFG+V +GM +VK +E + ++   P K  +I +CG+
Sbjct:   17 RVYFDVDIGGERVGRVVFELFADVVPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFHRIIKKFMVQGGDFSNQNGTGGESIYGDKFEDENFHYKHDKEGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGMGVVKILEGIETNEDTPVKPCVIAECGE 183          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010135.1 (pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 gene:ENSPMAG00000009125.1 transcript:ENSPMAT00000010135.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 203.371 bits (516), Expect = 6.367e-68
Identity = 106/160 (66.25%), Postives = 131/160 (81.88%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFD++A+G S+GR+V +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FM QGGDFT+GNGTGGKSIYG KF+DE+F  KH  PG+LSMANAGPNTNGSQFFI T  T WLD KHVVFG+V  G++++K +E  G+ SGK SK +++ DCG+L
Sbjct:    5 QVFFDLTADGASVGRVVMELRGDVVPKTAENFRALCTGEKGFGYKGSTFHRVIPDFMCQGGDFTKGNGTGGKSIYGNKFEDENFTLKHEGPGILSMANAGPNTNGSQFFICTAKTAWLDNKHVVFGKVISGLDVIKKVESYGAASGKTSKKIVVADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppifb (peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-GENE-051030-126])

HSP 1 Score: 187.578 bits (475), Expect = 1.452e-61
Identity = 107/158 (67.72%), Postives = 120/158 (75.95%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            F D+SA+   +GRI  KL  D+ PKTA+NFRALCTGE GFGYKGS FHRII +FM QGGDFTR NGTGG SIYG  F DE+F  KHT PG+LSMANAG NTNGSQFFI T +T WLDGKHVVFG V  GM+IVK +EKLGS  G     V I DCG++
Sbjct:   17 FMDVSADSGPLGRITLKLRADVVPKTAENFRALCTGEHGFGYKGSIFHRIIPNFMCQGGDFTRNNGTGGVSIYGTTFRDENFILKHTGPGILSMANAGKNTNGSQFFICTELTNWLDGKHVVFGHVTSGMDIVKKMEKLGSSKGDVKGRVEITDCGEV 174          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004654.1 (pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 gene:ENSPMAG00000004243.1 transcript:ENSPMAT00000004654.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 7.029e-52
Identity = 88/158 (55.70%), Postives = 116/158 (73.42%), Query Frame = 3
Query:   75 FFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            F D++A+   +GRI  +L+ ++ P+TA+NFRALCT E GFGY+ S  HR+I  FM QGGDFT  NGTGG+SIY + F+DESFK  H++ G+LSMAN+G NTN SQFFIT   T  LD KHV FG V  GM IV+A+E+LGS SG  +K +++ D G++
Sbjct:   59 FLDVAADDEPLGRISIELFANVVPRTAENFRALCTHEHGFGYRNSTIHRVIPGFMCQGGDFTNHNGTGGRSIYEKPFEDESFKILHSRAGILSMANSGRNTNTSQFFITLRATSHLDHKHVAFGAVRSGMSIVRAMEELGSQSGNTTKKIVVTDSGEV 216          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppig (peptidylprolyl isomerase G (cyclophilin G) [Source:ZFIN;Acc:ZDB-GENE-040426-2822])

HSP 1 Score: 148.673 bits (374), Expect = 3.336e-42
Identity = 86/175 (49.14%), Postives = 119/175 (68.00%), Query Frame = 3
Query:   54 ISKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG--------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGK-PSKSVIIDDCGQLH 548
            + +  R FFDI+ N +  GRIVF+L+ D+ PKT +NFR LCTGE+G G        ++ + FHRI+ +FM+QGGDF+ GNG GG+SIYG  F+DE+F+ KH +  LLSMAN G +TNGSQFFITT     LDG+HVVFG V  G +++K IE   +D+   P   + +  CG+++
Sbjct:    3 VKQRPRCFFDIAINRIPAGRIVFELFFDVCPKTCENFRCLCTGERGIGKITRKPLHFRSTSFHRIVKNFMVQGGDFSEGNGRGGESIYGGFFEDENFQLKHDQEFLLSMANRGKDTNGSQFFITTKPAPHLDGEHVVFGRVLSGQDLLKEIENQKTDANSLPYADIRVVHCGEVN 177          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Match: ppil1 (peptidylprolyl isomerase (cyclophilin)-like 1 [Source:ZFIN;Acc:ZDB-GENE-051009-1])

HSP 1 Score: 116.316 bits (290), Expect = 1.181e-33
Identity = 73/151 (48.34%), Postives = 91/151 (60.26%), Query Frame = 3
Query:   99 VSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFK-YKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAI---EKLGSDSGKPSKSVIIDDC 536
             +MG +V +LY    P+T  NF  L    +G+ Y G++FHRII  FM+QGGD T   G GG SIYG+ F+DE     KHT  G++SMAN+GPNTNGSQFFIT   T+WLDGKH +F  V  GM  V  I   E +  D      S+I   C
Sbjct:   18 TTMGTVVLELYWMHAPRTCRNFAELA--RRGY-YNGTRFHRIIRGFMIQGGDPTGTAGRGGASIYGKHFEDEIHPDLKHTGAGIISMANSGPNTNGSQFFITLGPTQWLDGKHSIFARVARGMSTVNRIGLVETVAQDRPVEEISIIRATC 165          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR1 (Cytoplasmic peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds the drug cyclosporin A; N-terminally propionylated in vivo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002562])

HSP 1 Score: 209.149 bits (531), Expect = 2.183e-70
Identity = 112/162 (69.14%), Postives = 131/162 (80.86%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M++ +FD+ A+G  +GR+VFKLY+DI PKTA+NFRALCTGEKGFGY GS FHR+I  FMLQGGDFT GNGTGGKSIYG KF DE+FK  H +PGLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEV +G +IVK +E LGS SG     +++   G+L
Sbjct:    1 MSQVYFDVEADGQPIGRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGKFPDENFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKVESLGSPSGATKARIVVAKSGEL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR3 (Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria [Source:SGD;Acc:S000004543])

HSP 1 Score: 208.379 bits (529), Expect = 9.633e-70
Identity = 109/160 (68.12%), Postives = 127/160 (79.38%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFD + NG  +GRI F+LYD++ PKTA+NFRALCTGEKG+GYKG  FHRII  FM+QGGD    NG GGKSIYG KF DE+F  KH K GLLSMANAGPNTNGSQFFITTV   WLDGKHVVFGEV +GM+IVKAIE  G+ SGKP   ++I++ G+L
Sbjct:   23 KVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL 182          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR6 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; plays a role in determining prion variants; binds to Hsp82p and contributes to chaperone activity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004206])

HSP 1 Score: 172.94 bits (437), Expect = 1.383e-53
Identity = 108/175 (61.71%), Postives = 119/175 (68.00%), Query Frame = 3
Query:   63 MTR--TFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFG---------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSD--SGKPSKSVIIDDCGQL 545
            MTR  TFFDIS  G   GRIVF+LY+DI PKTA+NF  LC G  G           YKGS FHR+I  FM Q GDFT  NGTGG+SIY EKF+DE+F  KH KP LLSMANAGPNTNGSQ FIT V T  LDGKHVVFGEV +G  IV+ IE    D  + KP + V IDDCG L
Sbjct:    1 MTRPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVL 175          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR5 (Peptidyl-prolyl cis-trans isomerase (cyclophilin) of the ER; catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; transcriptionally induced in response to unfolded proteins in the ER; CPR5 has a paralog, CPR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002712])

HSP 1 Score: 146.747 bits (369), Expect = 5.448e-45
Identity = 90/165 (54.55%), Postives = 111/165 (67.27%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYD-DIPKTADNFRALC-TGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDS-GKPSKSVIIDDCGQLHWV 554
            + +FDI+     +GRIV  LY    P+T +NF  L  + +   GY  S FHR+I +FM+QGGDFT  +G GGKSI+G  F DE+F  KH KPG LSMAN G NTNGSQFFITTV   WLDGKHVVFGEV +GM++V  IE + +DS   P K VII + G+L  V
Sbjct:   35 KVYFDINHGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGGKSIFGNTFKDENFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVIIVESGELETV 199          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Match: CPR2 (Peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; potential role in the secretory pathway; seamless-GFP and mCherry fusion proteins localize to the vacuole, while SWAT-GFP fusion localizes to both the endoplasmic reticulum and vacuole; suppresses toxicity of slow-folding human Z-type alpha1-antitrypsin variant associated with liver cirrhosis and emphysema [Source:SGD;Acc:S000001099])

HSP 1 Score: 135.191 bits (339), Expect = 8.940e-41
Identity = 87/162 (53.70%), Postives = 108/162 (66.67%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGF-GYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTV-VTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSG-KPSKSVIIDDCGQ 542
            + FFDI      +GRIV  LY  + PKTA NF  L T      G+ GS FHR+I +FM+QGGDFT G G GGKSIYG+ F DE+F  KH + G LSMAN G +TNGSQFFITT     WLDGKHVVFG+V +GM++V  I+ +  D+  KP ++V I  CG+
Sbjct:   37 KVFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGE 198          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO31539 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SXN2])

HSP 1 Score: 209.92 bits (533), Expect = 3.675e-70
Identity = 114/159 (71.70%), Postives = 130/159 (81.76%), Query Frame = 3
Query:   72 TFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            T+FDI   G   GRIV +L DD+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FM QGGDFTRG+GTGGKSIYG KF DE+F  KHT PG+LSMANAGP TNGSQFF+ T  T WLDGKHVVFG V++GM++VK IEK+GSDSGK SK V+I D G+L
Sbjct:    5 TYFDIEIGGAPAGRIVMELRDDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPGFMCQGGDFTRGDGTGGKSIYGAKFADENFNLKHTGPGILSMANAGPGTNGSQFFLCTAKTSWLDGKHVVFGSVKDGMDVVKKIEKVGSDSGKTSKKVVIADSGEL 163          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO38777 (Peptidyl-prolyl cis-trans isomerase E [Source:UniProtKB/TrEMBL;Acc:A7SBW4])

HSP 1 Score: 199.519 bits (506), Expect = 3.096e-64
Identity = 109/160 (68.12%), Postives = 126/160 (78.75%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDI+    S GRIV +L  D+ P TA+NFR LCT EKGFGYKGS FHRII  FM QGGDFT+ NGTGGKSIYG KF+DE+F  KHT  G+LSMAN+GPNTNGSQFF+TT  T WLDGKHVVFG V EG ++V+ +E +GS SGK SK V+IDDCG+L
Sbjct:  138 RVFFDITIGERSAGRIVMELRSDVVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTKHNGTGGKSIYGAKFEDENFVLKHTGAGVLSMANSGPNTNGSQFFLTTEKTDWLDGKHVVFGNVIEGFDVVRKMEAVGSQSGKASKKVVIDDCGEL 297          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO41747 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3C4])

HSP 1 Score: 191.815 bits (486), Expect = 2.115e-60
Identity = 103/168 (61.31%), Postives = 126/168 (75.00%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFG--------YKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFD++  G  +GR++F+L+ D +PKTA+NFRALCTGEKG G        YKG  FHRII  FM+QGGDF+  NGTGG+SIYGEKF DE F YKH KPGLLSMAN+GPNTNGSQFFITTV T  LDG+HVVFG+V +GM++V+ +E    D   P    II++CG+L
Sbjct:   17 RCFFDVTIGGEKVGRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGCPFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQFFITTVPTPHLDGRHVVFGKVLKGMDVVRELEATPVDDSSPKSPCIIEECGEL 184          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34629 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV4])

HSP 1 Score: 182.57 bits (462), Expect = 6.846e-59
Identity = 98/160 (61.25%), Postives = 122/160 (76.25%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + +FD+S  G  +GRIVF ++   +PKTA NF+ L TGEKG+GYKGS FHRII  FM+QGGDF   +GTGG+SIYG++FDDE+FK KH  PG LSMANAG +TNGSQFFITTV T WLDGKHVVFG+V EGM++V+ +E +      P K+ +IDD G L
Sbjct:   37 KIYFDVSIGGDKIGRIVFGIFGKTVPKTAKNFKLLATGEKGYGYKGSIFHRIIKDFMIQGGDFINKDGTGGRSIYGDRFDDENFKLKHYGPGWLSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVRKLENVNVKGSTPVKTCMIDDSGTL 196          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Match: EDO34613 (Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:A7SNV5])

HSP 1 Score: 169.474 bits (428), Expect = 1.058e-53
Identity = 99/161 (61.49%), Postives = 121/161 (75.16%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDD-IPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSG-KPSKSVIIDDCGQL 545
            + FFDI+  G   GRI   L+   +PKTA+NF  L TGEKGFGYK S FHR+I  FM+QGGDFT+G+GTGGKSIYG+KF DE+FK +H   G LSMANAG +TNGSQFFITTV T WLDG+HVVFG+V +GM++V+ IEK  +D G +P K V + D G L
Sbjct:   28 KVFFDITIGGEKAGRIEIGLFGKAVPKTAENFFQLATGEKGFGYKNSIFHRVIQDFMIQGGDFTKGDGTGGKSIYGQKFADENFKLQHYGAGWLSMANAGKDTNGSQFFITTVKTPWLDGRHVVFGKVLKGMDVVRKIEKSKTDHGDRPVKEVKVADSGSL 188          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppiaa (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101156984])

HSP 1 Score: 206.838 bits (525), Expect = 1.396e-68
Identity = 111/160 (69.38%), Postives = 126/160 (78.75%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            R FFDI+ +G   GRIV +L  D+ PKTA+NFRALCTGEKGFGYKGS FHR+I  FM QGGDFT  NGTGGKSIYG KF DE+F   HT PG+LSMANAGPNTNGSQFFI T  T WLDGKHVVFG+V EGM++V+ +E LGS SGK S  + I +CGQL
Sbjct:    5 RVFFDIAVDGSPAGRIVMELRADVVPKTAENFRALCTGEKGFGYKGSGFHRVIPRFMCQGGDFTNHNGTGGKSIYGNKFADENFTLTHTGPGILSMANAGPNTNGSQFFICTEKTAWLDGKHVVFGQVVEGMDVVRKMESLGSQSGKTSAKITIANCGQL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000001785.2 (peptidyl-prolyl cis-trans isomerase [Source:NCBI gene;Acc:101163424])

HSP 1 Score: 201.83 bits (512), Expect = 1.224e-66
Identity = 110/160 (68.75%), Postives = 126/160 (78.75%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDD-IPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            + FFDIS +G + GRIV +L  D +PKTA+NFRALCTGEKGFG+KGS FHRII  FM QGGDFT  +GTGGKSIYGE F DE+F+ KH   G LSMANAGPNTNGSQFFI T  T WL+GKHVVFG V EG+++VKA+EK GS SG P   VII DCG+L
Sbjct:    5 KVFFDISIDGANAGRIVMELRADAVPKTAENFRALCTGEKGFGFKGSSFHRIIPKFMCQGGDFTNHDGTGGKSIYGETFPDENFQLKHKGMGTLSMANAGPNTNGSQFFICTASTDWLNGKHVVFGSVLEGIDVVKAMEKHGSKSGTPKAKVIIADCGEL 164          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: PPIF (peptidylprolyl isomerase F [Source:NCBI gene;Acc:101156535])

HSP 1 Score: 199.904 bits (507), Expect = 2.005e-65
Identity = 106/164 (64.63%), Postives = 127/164 (77.44%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            +K    +FDI+A    +GR+ F+L  D+ PKTA+NFRALCTGE GFGYKGS FHR+I  FM QGGDFT  NGTGGKSIYG KF DE+F  KHT PG+LSMANAGPNTNGSQFFI T  T+WLDG+HVVFG V++GM +VK +E  GS SG+ S+ + I DCG+L
Sbjct:   29 NKNPTVYFDIAAGSEPLGRVTFELSADVVPKTAENFRALCTGEHGFGYKGSIFHRVIPKFMCQGGDFTNHNGTGGKSIYGLKFPDENFVLKHTGPGILSMANAGPNTNGSQFFICTSKTEWLDGRHVVFGRVKDGMSVVKKVESFGSQSGRTSQKITITDCGEL 192          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ENSORLT00000030005.1 (peptidylprolyl isomerase E [Source:NCBI gene;Acc:101158811])

HSP 1 Score: 191.815 bits (486), Expect = 9.285e-61
Identity = 105/159 (66.04%), Postives = 120/159 (75.47%), Query Frame = 3
Query:   69 RTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQ 542
            + + DI     + GR+ F L  DI P TA+NFR LCT EKGFGYKGS FHRII  FM QGGDFT  NGTGGKSIYG KFDDE+F  KHT PG LSMAN+GPNTNGSQFFIT   T WLDGKHVVFGE+ EGM++V+A+E  G+  GKP + VII DCG+
Sbjct:  142 QVYMDIKIGNKAAGRLRFLLRADIVPMTAENFRCLCTHEKGFGYKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGRKFDDENFVLKHTAPGQLSMANSGPNTNGSQFFITNDKTDWLDGKHVVFGELVEGMDVVRAMEAQGTKDGKPKQKVIISDCGE 300          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Match: ppifa (peptidyl-prolyl cis-trans isomerase A [Source:NCBI gene;Acc:101175187])

HSP 1 Score: 187.578 bits (475), Expect = 1.109e-60
Identity = 104/164 (63.41%), Postives = 121/164 (73.78%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            S+    F DI A+   +GRIV +L  D+ PKTA+N RALCTGE GFGYKG  FHRI+  FM QGGDFT  NGTGGKSIYG+ F DE+FK KHT PG LSMAN+GPNTN SQFFI T  T+WLDGKHVVFG+V+EGME+V  +E  G   G   K V+I DCG+L
Sbjct:   26 SRNPLVFLDIEADSEPLGRIVIELNADVVPKTAENCRALCTGEYGFGYKGCVFHRILPEFMCQGGDFTHNNGTGGKSIYGKTFKDENFKLKHTGPGTLSMANSGPNTNASQFFICTTKTEWLDGKHVVFGQVKEGMEVVTKMESFGLHDGGVLKKVVIVDCGEL 189          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006567.1 (SMESG000006567.1)

HSP 1 Score: 315.079 bits (806), Expect = 1.945e-111
Identity = 167/168 (99.40%), Postives = 168/168 (100.00%), Query Frame = 3
Query:   42 MAKHISKMTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            MAKHISKMTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSV+IDDCGQL
Sbjct:    1 MAKHISKMTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVVIDDCGQL 168          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006567.1 (SMESG000006567.1)

HSP 1 Score: 300.442 bits (768), Expect = 9.883e-106
Identity = 160/161 (99.38%), Postives = 161/161 (100.00%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            MTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSV+IDDCGQL
Sbjct:    1 MTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVVIDDCGQL 161          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052204.1 (SMESG000052204.1)

HSP 1 Score: 242.276 bits (617), Expect = 9.956e-83
Identity = 129/162 (79.63%), Postives = 145/162 (89.51%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M +T+FDIS +G  +GRIVF LY  D+PKT +NFRALCTGEKGFG+KGSKFHR+I +FMLQGGDFTRGNGTGGKSIYGEKF+DE+FK KHTKPGLLSMANAGPNTNGSQFFITTV+T WLDGKHVVFGEV EGM+IV+ +EKLGS SGK SK+V I DCGQL
Sbjct:    1 MVQTYFDISVDGAKLGRIVFNLYVKDVPKTVENFRALCTGEKGFGFKGSKFHRVIPNFMLQGGDFTRGNGTGGKSIYGEKFEDENFKIKHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSKTVSITDCGQL 162          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000006596.1 (SMESG000006596.1)

HSP 1 Score: 204.527 bits (519), Expect = 4.782e-68
Identity = 103/162 (63.58%), Postives = 121/162 (74.69%), Query Frame = 3
Query:   63 MTRTFFDISANGVSMGRIVFKLY-DDIPKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            M +T+FDIS +G  +GRIVF LY  D+PKT +NFRALCTGEKGFG+KGSKFHR+I     +            ++I  E+ +      KHTKPGLLSMANAGPNTNGSQFFITTV+T WLDGKHVVFGEV EGM+IV+ +EKLGS SGK SK+V I DCGQL
Sbjct:    1 MVQTYFDISVDGAKLGRIVFNLYVKDVPKTVENFRALCTGEKGFGFKGSKFHRVIQILCFK------------EAILLEEMEPVE---KHTKPGLLSMANAGPNTNGSQFFITTVITNWLDGKHVVFGEVAEGMDIVQKVEKLGSASGKTSKTVSITDCGQL 147          
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Match: SMESG000052090.1 (SMESG000052090.1)

HSP 1 Score: 181.8 bits (460), Expect = 6.165e-57
Identity = 101/164 (61.59%), Postives = 121/164 (73.78%), Query Frame = 3
Query:   57 SKMTRTFFDISANGVSMGRIVFKLYDDI-PKTADNFRALCTGEKGFGYKGSKFHRIISSFMLQXXXXXXXXXXXXKSIYGEKFDDESFKYKHTKPGLLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLGSDSGKPSKSVIIDDCGQL 545
            S++ + +FDIS     +GRIV +L  D+ P+T +NF +L T  KGFG+KGSKFHRII  FM QGGDFT G+GTGGKSIYG KFDDE+F  +H   G+LSMAN GPNTNGSQFFI    T WLDGKHVVFG V EGM + K +E +GS SG P+  V+I DCGQL
Sbjct:  144 SELPQVYFDISIRNQQIGRIVIQLRKDVVPRTCENFISLSTHAKGFGFKGSKFHRIIPDFMCQGGDFTMGDGTGGKSIYGMKFDDENFILRHDAAGVLSMANTGPNTNGSQFFICLNKTPWLDGKHVVFGHVVEGMNVCKKMEAVGSKSGTPNDPVVITDCGQL 307          
The following BLAST results are available for this feature:
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPIA1.092e-6972.15peptidylprolyl isomerase A [Source:HGNC Symbol;Acc... [more]
PPIF1.359e-6968.99peptidylprolyl isomerase F [Source:HGNC Symbol;Acc... [more]
PPIAL4C1.894e-6167.72peptidylprolyl isomerase A like 4C [Source:HGNC Sy... [more]
PPIE1.897e-6062.50peptidylprolyl isomerase E [Source:HGNC Symbol;Acc... [more]
PPIAL4G2.096e-6066.46peptidylprolyl isomerase A like 4G [Source:HGNC Sy... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyn-31.244e-6969.64Peptidyl-prolyl cis-trans isomerase 3 [Source:Uni... [more]
cyn-72.643e-6769.46Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-72.643e-6769.46Peptidyl-prolyl cis-trans isomerase 7 [Source:Uni... [more]
cyn-17.498e-6664.91Peptidyl-prolyl cis-trans isomerase 1 [Source:Uni... [more]
cyn-21.495e-6166.67Peptidyl-prolyl cis-trans isomerase 2 [Source:Uni... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyp18.895e-6766.07gene:FBgn0004432 transcript:FBtr0074238[more]
CG77681.169e-6667.28gene:FBgn0036415 transcript:FBtr0075736[more]
CG77681.169e-6667.28gene:FBgn0036415 transcript:FBtr0075737[more]
cyp338.681e-5660.12gene:FBgn0028382 transcript:FBtr0086945[more]
CG28522.385e-4957.14gene:FBgn0034753 transcript:FBtr0071933[more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppiaa2.894e-6665.00peptidylprolyl isomerase Aa (cyclophilin A) [Sourc... [more]
ppifb3.155e-6666.46peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ppiab6.717e-6668.75peptidylprolyl isomerase Ab (cyclophilin A) [Sourc... [more]
ppifa7.790e-6366.25peptidylprolyl isomerase Fa [Source:ZFIN;Acc:ZDB-G... [more]
ppid4.948e-5760.48peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppia6.117e-7067.90peptidylprolyl isomerase A (cyclophilin A) [Source... [more]
neurl43.093e-6463.80neuralized E3 ubiquitin protein ligase 4 [Source:X... [more]
zbtb266.044e-6164.78zinc finger and BTB domain containing 26 [Source:X... [more]
PPIE2.125e-6063.47peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
PPIE6.623e-6063.47peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppia1.240e-6971.52peptidylprolyl isomerase A [Source:MGI Symbol;Acc:... [more]
Ppif3.579e-6967.72peptidylprolyl isomerase F (cyclophilin F) [Source... [more]
Ppia7.798e-6568.83peptidylprolyl isomerase A [Source:MGI Symbol;Acc:... [more]
Ppie1.777e-5962.28peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
Ppid4.929e-5860.47peptidylprolyl isomerase D (cyclophilin D) [Source... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18253|CYPH_SCHPO7.416e-7674.69Peptidyl-prolyl cis-trans isomerase OS=Schizosacch... [more]
sp|P14088|PPIA_ECHGR8.677e-7474.21Peptidyl-prolyl cis-trans isomerase OS=Echinococcu... [more]
sp|P22011|PPIA_CANAL2.356e-7170.99Peptidyl-prolyl cis-trans isomerase OS=Candida alb... [more]
sp|P91791|PPIA_HEMPU2.838e-7171.88Peptidyl-prolyl cis-trans isomerase OS=Hemicentrot... [more]
sp|P10111|PPIA_RAT1.864e-7072.78Peptidyl-prolyl cis-trans isomerase A OS=Rattus no... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LI267.199e-7877.50Peptidyl-prolyl cis-trans isomerase OS=Opisthorchi... [more]
A0A074ZXV69.061e-7877.50Peptidyl-prolyl cis-trans isomerase OS=Opisthorchi... [more]
A0A2C6A2A91.113e-7677.16Peptidyl-prolyl cis-trans isomerase OS=Cordyceps s... [more]
A0A0E9NJT92.764e-7678.40Peptidyl-prolyl cis-trans isomerase OS=Saitoella c... [more]
F1ASZ64.233e-7676.88Peptidyl-prolyl cis-trans isomerase OS=Clonorchis ... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppifb4.403e-6766.46peptidyl-prolyl cis-trans isomerase A-like [Source... [more]
ppiab2.725e-6569.81peptidylprolyl isomerase Ab (cyclophilin A) [Sourc... [more]
ppifa3.697e-6468.35peptidyl-prolyl cis-trans isomerase F, mitochondri... [more]
ppie7.968e-5863.52peptidylprolyl isomerase E (cyclophilin E) [Source... [more]
ppid9.236e-5760.48peptidylprolyl isomerase D [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010135.16.367e-6866.25pep scaffold:Pmarinus_7.0:GL476417:32947:40880:1 g... [more]
ppifb1.452e-6167.72peptidylprolyl isomerase Fb [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000004654.17.029e-5255.70pep scaffold:Pmarinus_7.0:GL489343:42315:43690:-1 ... [more]
ppig3.336e-4249.14peptidylprolyl isomerase G (cyclophilin G) [Source... [more]
ppil11.181e-3348.34peptidylprolyl isomerase (cyclophilin)-like 1 [Sou... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CPR12.183e-7069.14Cytoplasmic peptidyl-prolyl cis-trans isomerase (c... [more]
CPR39.633e-7068.13Mitochondrial peptidyl-prolyl cis-trans isomerase ... [more]
CPR61.383e-5361.71Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
CPR55.448e-4554.55Peptidyl-prolyl cis-trans isomerase (cyclophilin) ... [more]
CPR28.940e-4153.70Peptidyl-prolyl cis-trans isomerase (cyclophilin);... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO315393.675e-7071.70Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO387773.096e-6468.13Peptidyl-prolyl cis-trans isomerase E [Source:Uni... [more]
EDO417472.115e-6061.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346296.846e-5961.25Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
EDO346131.058e-5361.49Peptidyl-prolyl cis-trans isomerase [Source:UniPr... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppiaa1.396e-6869.38peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
ENSORLT00000001785.21.224e-6668.75peptidyl-prolyl cis-trans isomerase [Source:NCBI g... [more]
PPIF2.005e-6564.63peptidylprolyl isomerase F [Source:NCBI gene;Acc:1... [more]
ENSORLT00000030005.19.285e-6166.04peptidylprolyl isomerase E [Source:NCBI gene;Acc:1... [more]
ppifa1.109e-6063.41peptidyl-prolyl cis-trans isomerase A [Source:NCBI... [more]
back to top
BLAST of Peptidyl-prolyl cis-trans isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006567.11.945e-11199.40SMESG000006567.1[more]
SMESG000006567.19.883e-10699.38SMESG000006567.1[more]
SMESG000052204.19.956e-8379.63SMESG000052204.1[more]
SMESG000006596.14.782e-6863.58SMESG000006596.1[more]
SMESG000052090.16.165e-5761.59SMESG000052090.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006388 ID=SMED30006388|Name=Peptidyl-prolyl cis-trans isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=560bp
ATTAATTAAATTAAAAATAATTGTTTATATAATAAAAATTCATGGCTAAA
CACATTTCTAAAATGACAAGAACTTTCTTCGACATCTCCGCTAATGGAGT
TAGCATGGGCAGAATTGTCTTCAAGCTTTACGATGATATTCCCAAAACTG
CTGACAATTTCCGTGCCTTGTGCACCGGTGAAAAAGGATTTGGATATAAA
GGAAGTAAATTCCACAGAATTATTTCATCTTTCATGCTTCAAGGTGGAGA
TTTCACCAGAGGAAATGGAACAGGGGGAAAAAGTATTTATGGTGAGAAAT
TTGACGATGAAAGCTTTAAATATAAACATACCAAACCTGGACTTTTGTCA
ATGGCCAATGCTGGTCCAAATACAAACGGATCTCAATTCTTTATCACAAC
CGTTGTTACTAAATGGTTAGATGGTAAACACGTTGTTTTTGGTGAAGTTG
AAGAAGGAATGGAAATTGTCAAAGCCATTGAAAAATTAGGTTCAGATAGT
GGCAAGCCATCAAAATCTGTTATTATTGATGACTGTGGACAATTACATTG
GGTCTGATCG
back to top

protein sequence of SMED30006388-orf-1

>SMED30006388-orf-1 ID=SMED30006388-orf-1|Name=SMED30006388-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MAKHISKMTRTFFDISANGVSMGRIVFKLYDDIPKTADNFRALCTGEKGF
GYKGSKFHRIISSFMLQGGDFTRGNGTGGKSIYGEKFDDESFKYKHTKPG
LLSMANAGPNTNGSQFFITTVVTKWLDGKHVVFGEVEEGMEIVKAIEKLG
SDSGKPSKSVIIDDCGQLHWV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR002130Cyclophilin-type_PPIase_dom
IPR024936Cyclophilin-type_PPIase
IPR029000Cyclophilin-like_dom_sf
IPR020892Cyclophilin-type_PPIase_CS
Vocabulary: biological process
TermDefinition
GO:0000413protein peptidyl-prolyl isomerization
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0003755peptidyl-prolyl cis-trans isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPRINTSPR00153CSAPPISMRASEcoord: 28..43
score: 50.19
coord: 100..115
score: 84.35
coord: 128..143
score: 63.76
coord: 57..69
score: 71.2
coord: 115..127
score: 68.34
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPFAMPF00160Pro_isomerasecoord: 14..166
e-value: 8.1E-47
score: 159.4
IPR002130Cyclophilin-type peptidyl-prolyl cis-trans isomerase domainPROSITEPS50072CSA_PPIASE_2coord: 12..167
score: 46.166
IPR024936Cyclophilin-type peptidyl-prolyl cis-trans isomerasePIRSFPIRSF001467Peptidylpro_ismrsecoord: 1..170
e-value: 4.1E-77
score: 255.4
IPR029000Cyclophilin-like domain superfamilyGENE3DG3DSA:2.40.100.10coord: 1..170
e-value: 4.2E-79
score: 266.5
IPR029000Cyclophilin-like domain superfamilySUPERFAMILYSSF50891Cyclophilin-likecoord: 6..168
NoneNo IPR availablePANTHERPTHR11071PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 5..168
NoneNo IPR availablePANTHERPTHR11071:SF434PEPTIDYL-PROLYL CIS-TRANS ISOMERASEcoord: 5..168
NoneNo IPR availableCDDcd01926cyclophilin_ABH_likecoord: 10..166
e-value: 1.19483E-106
score: 299.943
IPR020892Cyclophilin-type peptidyl-prolyl cis-trans isomerase, conserved sitePROSITEPS00170CSA_PPIASE_1coord: 52..69