E3 ubiquitin-protein ligase RGLG1

Overview
NameE3 ubiquitin-protein ligase RGLG1
Smed IDSMED30006371
Length (bp)1821
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase RGLG1 (SMED30006371) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RGLG1 (SMED30006371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase RGLG1 (SMED30006371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RGLG1 (SMED30006371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30006371SMESG000001281.1 dd_Smed_v4_5911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006371SMESG000001281.1 dd_Smed_v4_5911_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Match: MIB1 (mindbomb E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:21086])

HSP 1 Score: 64.3142 bits (155), Expect = 4.635e-10
Identity = 61/223 (27.35%), Postives = 100/223 (44.84%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.695e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 54.299 bits (129), Expect = 8.517e-8
Identity = 21/58 (36.21%), Postives = 37/58 (63.79%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVF-QCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +++++   E   C +C D  V+IVF  CGHL C+ CA  ++ CP+C+A + +R + +L
Sbjct:  135 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL 192          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 55.0694 bits (131), Expect = 1.534e-7
Identity = 21/58 (36.21%), Postives = 37/58 (63.79%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVF-QCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +++++   E   C +C D  V+IVF  CGHL C+ CA  ++ CP+C+A + +R + +L
Sbjct:  240 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL 297          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Match: BIRC7 (baculoviral IAP repeat containing 7 [Source:HGNC Symbol;Acc:HGNC:13702])

HSP 1 Score: 54.6842 bits (130), Expect = 1.788e-7
Identity = 21/58 (36.21%), Postives = 37/58 (63.79%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVF-QCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +++++   E   C +C D  V+IVF  CGHL C+ CA  ++ CP+C+A + +R + +L
Sbjct:  222 EAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL 279          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Match: MIB2 (mindbomb E3 ubiquitin protein ligase 2 [Source:HGNC Symbol;Acc:HGNC:30577])

HSP 1 Score: 54.299 bits (129), Expect = 5.678e-7
Identity = 20/57 (35.09%), Postives = 34/57 (59.65%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC D+ + +VFQCGH  C+ C   +  CP+C+  I  R ++++
Sbjct:  863 QSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV 919          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0333578)

HSP 1 Score: 58.151 bits (139), Expect = 1.912e-8
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 1521 AEIERFHKNNVKKSK--IKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            + +  F  ++V+K K  +++  E+ MC +C D + N+VF CGH  C +C D++  CP+C+  +  R  ++
Sbjct: 1046 SNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1115          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Fly
Match: mib1 (gene:FBgn0263601 transcript:FBtr0075520)

HSP 1 Score: 58.151 bits (139), Expect = 1.972e-8
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 1521 AEIERFHKNNVKKSK--IKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            + +  F  ++V+K K  +++  E+ MC +C D + N+VF CGH  C +C D++  CP+C+  +  R  ++
Sbjct: 1157 SNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 63.5438 bits (153), Expect = 6.080e-10
Identity = 58/221 (26.24%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  654 NHVEVAELLVHQGNAN--LDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 872          

HSP 2 Score: 60.8474 bits (146), Expect = 3.781e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  976 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1041          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 63.1586 bits (152), Expect = 6.951e-10
Identity = 58/221 (26.24%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGNAN--LDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 60.8474 bits (146), Expect = 4.106e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  965 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 56.9954 bits (136), Expect = 5.769e-8
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  973 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1038          

HSP 2 Score: 56.6102 bits (135), Expect = 9.163e-8
Identity = 87/410 (21.22%), Postives = 153/410 (37.32%), Query Frame = 3
Query:  657 CKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFS---SSDFQTAFTKQWFNYAEILINI--LPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAV---NSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNL----PANHKPKMISVIKSAILLG--------------------ADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            C   + +   S N  + +  +L+KH  ++ A   +G      AS  +  +++  L     DLN  +    +    A  K      + L++    P    +   T     +S K D  L  LL   +   +        L  A    N   + +    L    +V +    G          N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +S +    P+ +  +    +K  + LG                    AD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  462 CAGHTAMQAASQNGHVDVLKLLLKHSVDLEAEDKDGDRAVHHASFGDEGSVIEVLHRGGADLNARNKRRQTPLHIAVNKGHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDMLSVLLEAGADVTITNNNGFNALHHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGN--ANLDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTVRTEKCLKLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 869          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 53.5286 bits (127), Expect = 1.932e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  168 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 233          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:ZFIN;Acc:ZDB-GENE-050628-1])

HSP 1 Score: 54.6842 bits (130), Expect = 2.672e-7
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct:  833 QSRYRQMEERITCPICIDNHIRLVFQCGHASCIDCSSALKTCPICRQTIRERIQLFV 889          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 67.0106 bits (162), Expect = 7.442e-11
Identity = 60/223 (26.91%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-------KSKIKNDNER-GMCNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +  +    +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK            S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  655 NHVEVAELLVHQGNAN--LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGSHSPSMISNDSETLEECMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 875          

HSP 2 Score: 60.8474 bits (146), Expect = 6.083e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  981 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1046          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:100170182])

HSP 1 Score: 66.6254 bits (161), Expect = 8.884e-11
Identity = 60/223 (26.91%), Postives = 101/223 (45.29%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-------KSKIKNDNER-GMCNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +  +    +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK            S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGNAN--LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGSHSPSMISNDSETLEECMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 60.4622 bits (145), Expect = 6.559e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 53.5286 bits (127), Expect = 9.660e-7
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +++ +   ER  C IC DN + +VFQCGH  C+ C+  +  CP+C+  I  R ++++
Sbjct:  905 QNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIFV 961          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Match: ANK2 (ankyrin 2, neuronal [Source:NCBI gene;Acc:100494806])

HSP 1 Score: 51.9878 bits (123), Expect = 3.214e-6
Identity = 43/135 (31.85%), Postives = 66/135 (48.89%), Query Frame = 3
Query:  462 HRTLFSCFLNRLDSQSSNVHDGDKNSL--LHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSS 860
            H  + +  LN+     +N+H G KN L  LHLA +  R  + + L K GAN+D+    G SPL+ + C   +          I + N L+ HGAN+NA + NG T    A+     +++  LL N    N  +S+
Sbjct:  674 HADMVTLLLNK----QANIHVGTKNGLTPLHLAAQEDRVIVGEILSKNGANLDAQTKLGYSPLI-VACHYGN----------IKMVNFLLNHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQNGAKPNVTTSN 793          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Match: coa7 (cytochrome c oxidase assembly factor 7 (putative) [Source:Xenbase;Acc:XB-GENE-6258829])

HSP 1 Score: 51.9878 bits (123), Expect = 3.223e-6
Identity = 20/57 (35.09%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +++ +   ER  C IC DN + +VFQCGH  C+ C+  +  CP+C+  I  R ++++
Sbjct:  895 QNRYRQMEERITCPICIDNHIKLVFQCGHGSCTECSTSLTACPICRQLIRERIQIFV 951          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 63.929 bits (154), Expect = 3.491e-10
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-------KSKIKNDNER-GMCNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C +  +   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  278 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 498          

HSP 2 Score: 56.225 bits (134), Expect = 9.104e-8
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  576 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 641          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 64.3142 bits (155), Expect = 4.082e-10
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C +  +   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.125e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Match: Mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:MGI Symbol;Acc:MGI:2443157])

HSP 1 Score: 64.3142 bits (155), Expect = 4.082e-10
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C +  +   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 1.125e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 53.9138 bits (128), Expect = 4.269e-7
Identity = 66/276 (23.91%), Postives = 109/276 (39.49%), Query Frame = 3
Query:  543 LHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQ--TAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVL 1364
            LHLA K    G+ + LL  G++VDS    GN+ L       Q++           +  +L+K GANINA S NG T    A+     +++  LL N  + +  +   F       +Q  N A   + IL E      + L    ++ + D        D  S  +       LL +  N+D        ++++++V +  ++G            V  A  LLN    V F      N   PL +A +    ++V  L+    ++D +   G T L
Sbjct:   83 LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAE-----------VVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQA---VAILLENDTKGKVRLPALHIAARKD--------DTKSAAL-------LLQNDHNAD--------VQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFT---ARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPL 318          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Match: Mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:MGI Symbol;Acc:MGI:2679684])

HSP 1 Score: 53.9138 bits (128), Expect = 5.496e-7
Identity = 20/57 (35.09%), Postives = 34/57 (59.65%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC D+ + +VFQCGH  C+ C   +  CP+C+  I  R ++++
Sbjct:  865 QSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALNACPICRQPIRDRIQIFV 921          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Match: sp|Q86YT6|MIB1_HUMAN (E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.226e-9
Identity = 61/223 (27.35%), Postives = 100/223 (44.84%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 8.141e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Match: sp|Q80SY4|MIB1_MOUSE (E3 ubiquitin-protein ligase MIB1 OS=Mus musculus OX=10090 GN=Mib1 PE=1 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.855e-9
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C +  +   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPSLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 863          

HSP 2 Score: 56.225 bits (134), Expect = 7.867e-7
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Match: sp|Q804S5|MIB1_DANRE (E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.248e-9
Identity = 58/221 (26.24%), Postives = 98/221 (44.34%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  643 NHVEVAELLVHQGNAN--LDVQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 861          

HSP 2 Score: 60.8474 bits (146), Expect = 3.100e-8
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  965 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1030          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Match: sp|Q6GNY1|MIB1_XENLA (E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis OX=8355 GN=mib1 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 7.809e-9
Identity = 55/206 (26.70%), Postives = 91/206 (44.17%), Query Frame = 3
Query: 1230 VNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLML--KISNL-------------PANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-------KSKIKNDNER-GMCNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L   +    +S L                 +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK            S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C LCK ++ +RTK+
Sbjct:  659 LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDTTTWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLAVRNKKGQSPLDLCPDPNLCKTLAKCHKEKSSGQVGSHSPSMINNDSETLEECMVCSDLKRDTLFGPCGHIATCSLCSPRVKKCLLCKEQVQSRTKI 864          

HSP 2 Score: 60.4622 bits (145), Expect = 3.506e-8
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  942 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1007          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Match: sp|Q9VUX2|MIB_DROME (E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster OX=7227 GN=mib1 PE=1 SV=3)

HSP 1 Score: 58.151 bits (139), Expect = 1.977e-7
Identity = 22/70 (31.43%), Postives = 42/70 (60.00%), Query Frame = 3
Query: 1521 AEIERFHKNNVKKSK--IKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            + +  F  ++V+K K  +++  E+ MC +C D + N+VF CGH  C +C D++  CP+C+  +  R  ++
Sbjct: 1157 SNVNNFQMDDVQKLKQQLQDIKEQTMCPVCFDRIKNMVFLCGHGTCQMCGDQIEGCPICRKTVEKRILLF 1226          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Match: A0A3M6TB20 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00008393 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.963e-9
Identity = 61/219 (27.85%), Postives = 100/219 (45.66%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVL---------------------TRLMLKISNLPANHKPKMISVIKSAILL---GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKN---------DNERGM--CNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L+      K  +++N+N Q PL LA+E +   +V  L+ ES +LD +D  G T L                      +L++ +    A+ K    S    A+ L   GAD+      GQ  +D C + H+   + + HK     ++  N         D   G+  C +C+D   +++F  CGH+  CS+C+ RV+ C +CK  + +RTK+
Sbjct:  669 NHVEVAELLVKQAKANK--DIQNTNLQTPLHLAVERQHTQIVRLLVRESAKLDVQDKDGDTPLHESLRHHTLSQLRQLQDMQDVGKLLMGLGTQGADKK----SSASIALFLAANGADLNVKNKKGQTPLDLCPDPHLCKALAKCHKERSSSNQKNNANATILADVDENEGLDECMVCSDMKRDMLFGPCGHVATCSLCSPRVKKCLMCKETVQSRTKI 881          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Match: A0A2B4RR14 (E3 ubiquitin-protein ligase MIB1 OS=Stylophora pistillata OX=50429 GN=MIB1 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 9.863e-9
Identity = 60/219 (27.40%), Postives = 100/219 (45.66%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVL---------------------TRLMLKISNLPANHKPKMISVIKSAILL---GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKN---------DNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L+      K  +++N+N Q PL LA+E +   +V  L+ E+ +LD +D  G T L                      +L++ +    A+ K    S    A+ L   GAD+      GQ  +D C + H+   + + HK     ++  N         D   G+  C +C+D   +++F  CGH+  CS+C+ RV+ C +CK  + +RTK+
Sbjct:  664 NHVEVAELLVKQAKANK--DIQNTNLQTPLHLAVERQHTQIVRLLVRENAKLDVQDKDGDTPLHESLRHHTLSQLRQLQDMQDVGKLLMGLGTQGADKK----SSASIALFLAANGADLNVKNRKGQTPLDLCPDPHLCKALAKCHKERASDNQKNNSNATILVDVDENEGLDECMVCSDMKRDMLFGPCGHVATCSLCSPRVKKCLMCKETVQSRTKI 876          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Match: A0A341CN44 (LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase MIB2 OS=Neophocaena asiaeorientalis asiaeorientalis OX=1706337 GN=MIB2 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.284e-8
Identity = 85/407 (20.88%), Postives = 151/407 (37.10%), Query Frame = 3
Query:  702 IIIANILIKHGANINAISSNGITVFQFASI---IESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINI-----LPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHF-LKTEIL-VPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFV---------NLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLP-----ANHKPKMISV----------------IKSAI-----LLGADIYKMTSNGQRIIDSCTESHV----KAEIERFHKNNVK----------------KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            + +  +L++  A ++     G T   +A++    E+  ++L+       LN   SS    A  + +     +L        LP+    + +  A     T A + ++++L +          +  +   A NS    L  H  LK   L V +IL     L     ++         LN   +V  V         N++N   Q PL LA++   + LV  L+      + ED  G T L   + +   LP     A   P  + +                + +A+     L GAD+      G+  +D   E  +    +   +RF    V                 +S+ +   ER  C IC D+ + +VFQCGH  C+ C   +  CP+C+  I  R ++++
Sbjct:  490 VELVRLLLQARAGVDLPDDEGSTALHYAALGNQPEAARVLLSWGCGANTLNGTQSSALHVAVQRGFLEVVRVLCECGCDVNLPDAHADTPLHCA-ISAGTGA-SGIVEVLTE----------VPGIDVTATNSQGFTLLHHASLKGHTLAVRRILARARQLVDAKKEDGFTALHLAALNDHREVAQVLIREGHCDVNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSANAEDEEGDTALHVALQRHQLLPLATDGAGGDPGALQLLSRLQASGLPGSMELTVGAAVACFLALEGADLSYANHRGRSPLDLAAEGRLLKALQGCAQRFRCTEVVSAAPAPGPPRQLVEELQSRYRQMEERITCPICIDSHIRLVFQCGHGACAPCGAALSACPICRQPIRDRIQIFV 884          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Match: A0A433TSC9 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_007724 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.268e-7
Identity = 93/403 (23.08%), Postives = 155/403 (38.46%), Query Frame = 3
Query:  666 QSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFS---SSDFQTAFTKQWFNYAEILINILPETFLT-SNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEH-----------FLKTEILVPKILKT----GENLFTFILKENKVEFAWKLLNSINQVKF-VNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVL---------------------TRLMLKISNLPANHKPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNN-------VKKSKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
             + L   S N  I +  +LIKH  N+     +G      A+  +   ++  L     DLN  +    +       K        L+++     L  S    A  D  +K    +I LL +     +    I        N++  +   H            L T++  P I+      G          N VE A +LL  ++Q K  ++++N N Q PL LA+E +   +V  L+ E   L+  D  G T L                      +L++ +   P   K    S+       GAD+      GQ  +D C + ++   + + HK            + I+ND E    C +C+D   + +F  CGH+C CS+C+ RV+ C +CK  + +RTK+
Sbjct:  499 HTALQAASQNGHIEVIKVLIKHDVNMEVEDKDGDRAVHHAAFGDEPAVIELLHRGGADLNARNKRRQTPLHIGVNKGHIGVVRSLLDLGSHPSLQDSEGDTALHDAISKKRDDMISLLLE----HVADITI-------TNNNGFNALHHAALRGNPSAMRILLTKLPRPWIVDEKKDDGYTALHLASLNNHVEVA-ELL--VHQGKANMDMQNVNLQTPLHLAVERQHTQIVRLLVREGCNLNIPDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKLLMGLGT-PGADKKSSASIACFLAANGADLNLKNKKGQTPLDLCPDPNLCKALAKCHKERNSPALTAPNAAIIRNDQESLEECMVCSDQKRDTLFGPCGHICTCSLCSPRVKKCLMCKDPVQSRTKI 886          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Match: A0A2K5YG43 (Mindbomb E3 ubiquitin protein ligase 1 OS=Mandrillus leucophaeus OX=9568 GN=MIB1 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.009e-7
Identity = 61/223 (27.35%), Postives = 100/223 (44.84%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRL--------------MLKISNLPANHKPKMISVI----------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKK-------SKIKNDNER-GMCNICTDNLVNIVFQ-CGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T L                 M  +  + A  +P   ++I          KSA  +       GAD+      GQ  +D C + ++   + + HK  V         S I ND+E    C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  589 NHVEVAELLVHQGN--ANLDIQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQDMQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLCPDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 809          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 62.003 bits (149), Expect = 1.388e-9
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 1230 VNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  656 LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 858          

HSP 2 Score: 60.8474 bits (146), Expect = 3.447e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  962 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1027          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:352910])

HSP 1 Score: 62.003 bits (149), Expect = 1.583e-9
Identity = 52/203 (25.62%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 1230 VNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C +  +   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  659 LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPSLCKALAKCHKEKTSGQVGSRSPSLNSNNETLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKDQVQSRTKI 861          

HSP 2 Score: 60.8474 bits (146), Expect = 3.576e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  941 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1006          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 56.6102 bits (135), Expect = 6.181e-8
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct:  961 QSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLFV 1017          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 56.6102 bits (135), Expect = 6.224e-8
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct:  955 QSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLFV 1011          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:103034310])

HSP 1 Score: 56.6102 bits (135), Expect = 6.543e-8
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct:  891 QSRYRQMEERITCPICIDNQIKLVFQCGHASCIDCSAALKTCPICRQTIRERIQLFV 947          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Nematostella
Match: EDO30381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0Y6])

HSP 1 Score: 51.9878 bits (123), Expect = 3.568e-7
Identity = 25/60 (41.67%), Postives = 35/60 (58.33%), Query Frame = 3
Query: 1554 KKSKIKNDNERGMCNICTDNLVNIVF-QCGHL-CCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +K K++   E  +C IC D  V IVF  CGHL CC  CA+ +  CP+C+A I    + +L
Sbjct:  272 EKQKLERMQEERLCKICMDAEVGIVFLPCGHLSCCPGCAEGMELCPMCRAPIRETIRTFL 331          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Nematostella
Match: EDO43423 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU6])

HSP 1 Score: 48.9062 bits (115), Expect = 5.707e-6
Identity = 21/47 (44.68%), Postives = 29/47 (61.70%), Query Frame = 3
Query: 1593 CNICTDNLVNIV-FQCGHLCC-SVCADRVRFCPLCKAEIITRTKMYL 1727
            C IC DN  ++V   CGH+CC S CA  V  CP+C+  +  R +MY+
Sbjct:  698 CVICLDNRSDVVMLPCGHVCCCSNCAGAVSACPICRQTLSQRVRMYI 744          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 64.3142 bits (155), Expect = 2.585e-10
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C + ++   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  644 NHVEVAELLVHQGNAS--LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Medaka
Match: mib1 (mindbomb E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:101158637])

HSP 1 Score: 63.929 bits (154), Expect = 3.640e-10
Identity = 58/221 (26.24%), Postives = 99/221 (44.80%), Query Frame = 3
Query: 1176 NKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKT---------VLTRL-----MLKISNLPANHKPKMISVI---------KSAILL-------GADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK-----KSKIKNDNERGM--CNICTDNLVNIVF-QCGHLC-CSVCADRVRFCPLCKAEIITRTKM 1721
            N VE A  L++  N    ++++N N Q  L LA+E +   +V  L+    +LD +D  G T          L++L     M  +S +      K   ++         KSA  +       GAD+      GQ  +D C + ++   + + HK         +S   N N   +  C +C+D   + +F  CGH+  CS+C+ RV+ C +CK ++ +RTK+
Sbjct:  644 NHVEVAELLVHQGNAS--LDIQNVNQQTALHLAVERQHTQIVRLLVRAEAKLDVQDKDGDTPLHEALRHHTLSQLRQLQDMQDVSKVEPWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLTIRNKKGQSPLDLCPDPNLCKALAKCHKEKSSGQVGTRSPSLNSNMESLEECMVCSDMKRDTLFGPCGHIATCSLCSPRVKKCLICKEQVQSRTKI 862          

HSP 2 Score: 60.8474 bits (146), Expect = 3.390e-9
Identity = 23/72 (31.94%), Postives = 43/72 (59.72%), Query Frame = 3
Query: 1509 SHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMY 1724
            ++V A++++  +      ++++  E+ MC +C D L N++F CGH  C +C DR+  CP+C+  I  R  +Y
Sbjct:  955 TNVNADVQKLQQ------QLQDIKEQTMCPVCLDRLKNMIFMCGHGTCQLCGDRMSECPICRKAIERRILLY 1020          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 56.9954 bits (136), Expect = 4.831e-8
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct: 1028 QSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLFV 1084          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Medaka
Match: mib2 (mindbomb E3 ubiquitin protein ligase 2 [Source:NCBI gene;Acc:101175479])

HSP 1 Score: 56.9954 bits (136), Expect = 5.325e-8
Identity = 21/57 (36.84%), Postives = 35/57 (61.40%), Query Frame = 3
Query: 1557 KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +S+ +   ER  C IC DN + +VFQCGH  C  C+  ++ CP+C+  I  R ++++
Sbjct:  972 QSRYRQMEERITCPICIDNHIKLVFQCGHASCIECSAALKTCPICRQTIRERIQLFV 1028          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Match: SMESG000001281.1 (SMESG000001281.1)

HSP 1 Score: 900.197 bits (2325), Expect = 0.000e+0
Identity = 444/447 (99.33%), Postives = 445/447 (99.55%), Query Frame = 3
Query:  390 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLPANHKPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYLI 1730
            AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIII NILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFL SNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLPANHKPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKA+IITRTKMYLI
Sbjct:  442 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIITNILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLVSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLPANHKPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVKKSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAKIITRTKMYLI 888          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Match: SMESG000010348.1 (SMESG000010348.1)

HSP 1 Score: 512.301 bits (1318), Expect = 5.582e-178
Identity = 268/450 (59.56%), Postives = 332/450 (73.78%), Query Frame = 3
Query:  390 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNL-PANHKPKMISVIKSAILLGADIYKMTSNGQ-RIIDSCTESHVKAEIERFHKNNVKKSKIKN--DNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
             IPF +S I LT  EN+LT S+KFHRT+F CFL +L+  SSN HDGD NSLLHLAVKCL+P IC SLL AGA VDSVN +GNSPLLE+F   +  + + +LN +I I NILI  GA++N  SSNGI+VFQ AS IESE LM+AL+SN+P L  FSS+DFQTAF  QWF YAE+LI +LP+ FL+  I+  TF     A T LIKLLF KSS  +QQ++IE LL  AVNS+D++LF+HF++TEI  PK L  GENL TFIL+E K+EFAWKLL+S+N+ KFV L+N NNQIPLQ+AIE+EEMDLV+ LI E+ + D E+  G   LT+L+ KIS     N + K+IS IKS I  G DIYKMTS GQ RIID+CT+S  K EIER+H+NN K S  +N  DN + MCNIC D  VNI FQCGHL   +C+D++  C  CKA+I+TRTKM+ 
Sbjct:   15 TIPFAQSFISLTVIENSLTLSLKFHRTIFPCFLKKLNLNSSNAHDGDNNSLLHLAVKCLQPDICSSLLNAGAQVDSVNNFGNSPLLELFADREIPVDDDTLNILIGITNILIVKGADVNFKSSNGISVFQSASNIESEKLMVALMSNHPRLINFSSNDFQTAFLNQWFIYAELLIELLPDDFLSFAISNDTFQSCESAGTNLIKLLFSKSSSALQQSVIENLLYKAVNSNDVELFDHFIRTEISAPKSLGNGENLLTFILQERKIEFAWKLLDSVNRGKFVKLRNINNQIPLQIAIEIEEMDLVNALIIETKDCDSENEGGTCALTQLLEKISIFNNVNFRRKLISAIKSIISFGGDIYKMTSCGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNVKAMCNICKDKQVNIGFQCGHLTYDLCSDQLFECTFCKADIVTRTKMFF 464          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Match: SMESG000010348.1 (SMESG000010348.1)

HSP 1 Score: 511.916 bits (1317), Expect = 8.030e-178
Identity = 268/450 (59.56%), Postives = 332/450 (73.78%), Query Frame = 3
Query:  390 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNL-PANHKPKMISVIKSAILLGADIYKMTSNGQ-RIIDSCTESHVKAEIERFHKNNVKKSKIKN--DNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
             IPF +S I LT  EN+LT S+KFHRT+F CFL +L+  SSN HDGD NSLLHLAVKCL+P IC SLL AGA VDSVN +GNSPLLE+F   +  + + +LN +I I NILI  GA++N  SSNGI+VFQ AS IESE LM+AL+SN+P L  FSS+DFQTAF  QWF YAE+LI +LP+ FL+  I+  TF     A T LIKLLF KSS  +QQ++IE LL  AVNS+D++LF+HF++TEI  PK L  GENL TFIL+E K+EFAWKLL+S+N+ KFV L+N NNQIPLQ+AIE+EEMDLV+ LI E+ + D E+  G   LT+L+ KIS     N + K+IS IKS I  G DIYKMTS GQ RIID+CT+S  K EIER+H+NN K S  +N  DN + MCNIC D  VNI FQCGHL   +C+D++  C  CKA+I+TRTKM+ 
Sbjct:   12 TIPFAQSFISLTVIENSLTLSLKFHRTIFPCFLKKLNLNSSNAHDGDNNSLLHLAVKCLQPDICSSLLNAGAQVDSVNNFGNSPLLELFADREIPVDDDTLNILIGITNILIVKGADVNFKSSNGISVFQSASNIESEKLMVALMSNHPRLINFSSNDFQTAFLNQWFIYAELLIELLPDDFLSFAISNDTFQSCESAGTNLIKLLFSKSSSALQQSVIENLLYKAVNSNDVELFDHFIRTEISAPKSLGNGENLLTFILQERKIEFAWKLLDSVNRGKFVKLRNINNQIPLQIAIEIEEMDLVNALIIETKDCDSENEGGTCALTQLLEKISIFNNVNFRRKLISAIKSIISFGGDIYKMTSCGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNVKAMCNICKDKQVNIGFQCGHLTYDLCSDQLFECTFCKADIVTRTKMFF 461          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Match: SMESG000010348.1 (SMESG000010348.1)

HSP 1 Score: 512.301 bits (1318), Expect = 8.867e-178
Identity = 268/450 (59.56%), Postives = 332/450 (73.78%), Query Frame = 3
Query:  390 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNL-PANHKPKMISVIKSAILLGADIYKMTSNGQ-RIIDSCTESHVKAEIERFHKNNVKKSKIKN--DNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
             IPF +S I LT  EN+LT S+KFHRT+F CFL +L+  SSN HDGD NSLLHLAVKCL+P IC SLL AGA VDSVN +GNSPLLE+F   +  + + +LN +I I NILI  GA++N  SSNGI+VFQ AS IESE LM+AL+SN+P L  FSS+DFQTAF  QWF YAE+LI +LP+ FL+  I+  TF     A T LIKLLF KSS  +QQ++IE LL  AVNS+D++LF+HF++TEI  PK L  GENL TFIL+E K+EFAWKLL+S+N+ KFV L+N NNQIPLQ+AIE+EEMDLV+ LI E+ + D E+  G   LT+L+ KIS     N + K+IS IKS I  G DIYKMTS GQ RIID+CT+S  K EIER+H+NN K S  +N  DN + MCNIC D  VNI FQCGHL   +C+D++  C  CKA+I+TRTKM+ 
Sbjct:   23 TIPFAQSFISLTVIENSLTLSLKFHRTIFPCFLKKLNLNSSNAHDGDNNSLLHLAVKCLQPDICSSLLNAGAQVDSVNNFGNSPLLELFADREIPVDDDTLNILIGITNILIVKGADVNFKSSNGISVFQSASNIESEKLMVALMSNHPRLINFSSNDFQTAFLNQWFIYAELLIELLPDDFLSFAISNDTFQSCESAGTNLIKLLFSKSSSALQQSVIENLLYKAVNSNDVELFDHFIRTEISAPKSLGNGENLLTFILQERKIEFAWKLLDSVNRGKFVKLRNINNQIPLQIAIEIEEMDLVNALIIETKDCDSENEGGTCALTQLLEKISIFNNVNFRRKLISAIKSIISFGGDIYKMTSCGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNVKAMCNICKDKQVNIGFQCGHLTYDLCSDQLFECTFCKADIVTRTKMFF 472          
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Match: SMESG000019776.1 (SMESG000019776.1)

HSP 1 Score: 516.153 bits (1328), Expect = 5.227e-177
Identity = 269/450 (59.78%), Postives = 332/450 (73.78%), Query Frame = 3
Query:  390 AIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQSSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMFCKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESENLMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITLATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFLKTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQIPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKIS-NLPANHKPKMISVIKSAILLGADIYKMTSNGQ-RIIDSCTESHVKAEIERFHKNNVKKSKIKN--DNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEIITRTKMYL 1727
            +IPF +  I LT  EN+LT S+KFHRT+F CFL +LD  SSN HDGD NSLLHLAVKCL+P IC SLL AGA VDSVN +GNSPLLE+F   +  +   +LNK+I I  ILI  GA++N  SSNGIT FQ AS IE+E LM+AL+SN+P L  FSS+DFQTAF  QWF YAE+LI +LP+ FL+  I+  TF     A   LIKLLF+KSS  +QQ++IE LL  AVNS+D++LF+H ++TEI  PK L  GENLFTFIL+E K+EFAWKLL+S+N  KFV L+N NNQIPLQ+AIE+EEMDLV+ LI E+ + D ED  G   LT+L++KIS +   N K K+I  IKS I LG DIYKMTS GQ RIID+CT+S  K EIER+H+NN K S  +N  DNE  MC IC +  VNI FQCGHL C +C+D++  CP CKA+I+TRTKM+ 
Sbjct:  179 SIPFAQPFISLTVIENSLTLSLKFHRTIFPCFLKKLDLNSSNAHDGDNNSLLHLAVKCLQPDICSSLLNAGARVDSVNNFGNSPLLELFADREIPVDVDTLNKLIDITKILIVKGADVNFKSSNGITAFQSASNIENEKLMVALVSNHPRLINFSSNDFQTAFLNQWFIYAELLIELLPDDFLSFAISNDTFQSCESAGANLIKLLFNKSSSALQQSVIENLLYKAVNSNDVELFDHLIRTEISAPKSLGNGENLFTFILQERKIEFAWKLLDSVNLRKFVKLRNVNNQIPLQIAIEIEEMDLVNALIIETKDCDSEDEGGTCALTQLLVKISISNNVNFKRKLILAIKSIISLGGDIYKMTSRGQHRIIDACTDSVAKEEIERYHRNNTKPSTEENKPDNEIAMCKICQNKQVNIGFQCGHLTCDLCSDQLFECPFCKADIVTRTKMFF 628          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIB14.635e-1027.35mindbomb E3 ubiquitin protein ligase 1 [Source:HGN... [more]
BIRC78.517e-836.21baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
BIRC71.534e-736.21baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
BIRC71.788e-736.21baculoviral IAP repeat containing 7 [Source:HGNC S... [more]
MIB25.678e-735.09mindbomb E3 ubiquitin protein ligase 2 [Source:HGN... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mib11.912e-831.43gene:FBgn0263601 transcript:FBtr0333578[more]
mib11.972e-831.43gene:FBgn0263601 transcript:FBtr0075520[more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib16.080e-1026.24mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib16.951e-1026.24mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib15.769e-831.94mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.932e-731.94mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib22.672e-736.84mindbomb E3 ubiquitin protein ligase 2 [Source:ZFI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib17.442e-1126.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib18.884e-1126.91mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
coa79.660e-735.09cytochrome c oxidase assembly factor 7 (putative) ... [more]
ANK23.214e-631.85ankyrin 2, neuronal [Source:NCBI gene;Acc:10049480... [more]
coa73.223e-635.09cytochrome c oxidase assembly factor 7 (putative) ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mib13.491e-1027.35mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib14.082e-1027.35mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Mib14.082e-1027.35mindbomb E3 ubiquitin protein ligase 1 [Source:MGI... [more]
Ank24.269e-723.91ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Mib25.496e-735.09mindbomb E3 ubiquitin protein ligase 2 [Source:MGI... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86YT6|MIB1_HUMAN2.226e-927.35E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens O... [more]
sp|Q80SY4|MIB1_MOUSE2.855e-927.35E3 ubiquitin-protein ligase MIB1 OS=Mus musculus O... [more]
sp|Q804S5|MIB1_DANRE5.248e-926.24E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX... [more]
sp|Q6GNY1|MIB1_XENLA7.809e-926.70E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis... [more]
sp|Q9VUX2|MIB_DROME1.977e-731.43E3 ubiquitin-protein ligase mind-bomb OS=Drosophil... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M6TB204.963e-927.85Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A2B4RR149.863e-927.40E3 ubiquitin-protein ligase MIB1 OS=Stylophora pis... [more]
A0A341CN441.284e-820.88LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase M... [more]
A0A433TSC91.268e-723.08Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A2K5YG433.009e-727.35Mindbomb E3 ubiquitin protein ligase 1 OS=Mandrill... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mib11.388e-925.62mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib11.583e-925.62mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib26.181e-836.84mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib26.224e-836.84mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib26.543e-836.84mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO303813.568e-741.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434235.707e-644.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mib12.585e-1026.24mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib13.640e-1026.24mindbomb E3 ubiquitin protein ligase 1 [Source:NCB... [more]
mib24.831e-836.84mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
mib25.325e-836.84mindbomb E3 ubiquitin protein ligase 2 [Source:NCB... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001281.10.000e+099.33SMESG000001281.1[more]
SMESG000010348.15.582e-17859.56SMESG000010348.1[more]
SMESG000010348.18.030e-17859.56SMESG000010348.1[more]
SMESG000010348.18.867e-17859.56SMESG000010348.1[more]
SMESG000019776.15.227e-17759.78SMESG000019776.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006371 ID=SMED30006371|Name=E3 ubiquitin-protein ligase RGLG1|organism=Schmidtea mediterranea sexual|type=transcript|length=1821bp
GACATATATACAAAGTTAAGTTAGAAGAGGGTAATTTGCTTGAATTGAGT
GTTAGTTCGTAGTATTTTTAGTTGGTTTTGAACACCTTTTTATTGAGATT
TTATTTAATTTATCGATCACATAATATCATATTTTTTTTAAATCGGTAAT
TATGTAATTTTTAAAATTGCATATTCCTCCATCAATTATGAAATTCATCA
AGAATTTTTGATTTTTATGTGTGTCTGATTTAATCCTTGTTTTAATGCAC
TTATACCTTTACCGCAATTTTAAACTTTGAATATATGTCTGACTTGTTAT
TTAAGCTTTGTATATTCTGACTTTGGCGAACAAAGATAAATTTTAAAAAT
AAGTTAATGAATTTATTTACAATACATTGGATATTTCCAGCAATTCCATT
CATCCGATCAATTATTCCATTGACTAACTCAGAAAATGCCCTAACTTTTT
CGATGAAATTTCATAGAACACTTTTTTCCTGTTTCCTGAATAGACTCGAT
TCACAGAGCTCTAACGTGCATGACGGTGATAAAAATTCGTTGCTTCACTT
GGCAGTGAAATGTTTAAGACCTGGGATATGCAAATCACTACTTAAAGCTG
GCGCCAATGTTGACAGTGTAAACTATTGGGGAAACTCTCCTTTACTTGAA
ATGTTTTGCAAACCCCAATCAAAATTGACCAATAAAAGCCTAAATAAAAT
GATAATTATCGCAAACATTCTGATTAAACATGGAGCTAATATCAATGCAA
TTTCATCCAATGGAATCACCGTATTTCAATTTGCATCGATTATTGAGAGT
GAAAACCTAATGCTAGCTCTCCTATCGAATAATCCGGATTTAAACTTTTT
CTCTTCAAGCGATTTTCAAACGGCTTTCACCAAACAATGGTTTAATTATG
CAGAAATACTGATCAATATTTTGCCGGAAACTTTTCTCACCTCAAATATC
ACATTGGCAACATTTGATTTATCTACTAAAGCCGACACTAAACTGATTAA
ACTATTATTCGATAAATCAAGTTGTGAAATGCAGCAAGCAATTATAGAAA
AGCTTCTCTGTGATGCTGTAAATAGTGATGACATTGATCTATTTGAACAT
TTCTTGAAAACAGAAATATTGGTACCGAAAATATTGAAAACCGGCGAAAA
CTTATTCACCTTTATTCTGAAAGAAAATAAAGTTGAATTTGCGTGGAAAT
TGTTGAATTCAATAAATCAAGTGAAATTTGTCAACTTAAAAAACAGTAAC
AATCAAATTCCGCTTCAATTAGCAATCGAATTAGAAGAAATGGATCTAGT
TGATACGCTGATACATGAATCCGATGAGTTGGATTGTGAAGACGCCGCTG
GGAAAACCGTATTGACGCGATTGATGCTGAAAATCTCCAATTTACCAGCA
AATCACAAACCAAAGATGATATCTGTAATTAAATCGGCAATTCTATTAGG
TGCCGATATATATAAGATGACATCGAATGGTCAACGGATAATTGATTCTT
GCACAGAAAGTCATGTCAAAGCGGAAATTGAGAGATTTCACAAAAATAAT
GTTAAAAAATCTAAAATTAAAAATGATAATGAAAGAGGAATGTGTAACAT
TTGCACTGATAATCTCGTGAATATAGTTTTCCAGTGCGGTCATTTGTGTT
GCTCGGTTTGTGCAGATCGAGTTCGATTTTGCCCTCTTTGCAAAGCTGAA
ATCATAACTAGAACAAAAATGTATTTAATTTAATTGCGTGGAAATCAAGA
TTTTGACAGAATTTTATATTTGTTAAATTTGTTTTCAATAATAAAATGCT
TCATGTTTTGTTAAAAAAAAA
back to top

protein sequence of SMED30006371-orf-1

>SMED30006371-orf-1 ID=SMED30006371-orf-1|Name=SMED30006371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=459bp
MNLFTIHWIFPAIPFIRSIIPLTNSENALTFSMKFHRTLFSCFLNRLDSQ
SSNVHDGDKNSLLHLAVKCLRPGICKSLLKAGANVDSVNYWGNSPLLEMF
CKPQSKLTNKSLNKMIIIANILIKHGANINAISSNGITVFQFASIIESEN
LMLALLSNNPDLNFFSSSDFQTAFTKQWFNYAEILINILPETFLTSNITL
ATFDLSTKADTKLIKLLFDKSSCEMQQAIIEKLLCDAVNSDDIDLFEHFL
KTEILVPKILKTGENLFTFILKENKVEFAWKLLNSINQVKFVNLKNSNNQ
IPLQLAIELEEMDLVDTLIHESDELDCEDAAGKTVLTRLMLKISNLPANH
KPKMISVIKSAILLGADIYKMTSNGQRIIDSCTESHVKAEIERFHKNNVK
KSKIKNDNERGMCNICTDNLVNIVFQCGHLCCSVCADRVRFCPLCKAEII
TRTKMYLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR013083Znf_RING/FYVE/PHD
IPR020683Ankyrin_rpt-contain_dom
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0016874ligase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 58..87
e-value: 0.078
score: 22.1
coord: 298..327
e-value: 270.0
score: 9.3
coord: 91..131
e-value: 310.0
score: 8.8
coord: 135..164
e-value: 180.0
score: 10.6
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 59..89
e-value: 0.0044
score: 17.4
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 58..90
score: 9.057
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 391..457
e-value: 2.1E-12
score: 48.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 42..108
e-value: 8.0E-8
score: 34.2
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 220..390
e-value: 5.0E-9
score: 37.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 109..219
e-value: 8.6E-6
score: 27.4
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 32..336
NoneNo IPR availablePFAMPF13920zf-C3HC4_3coord: 410..450
e-value: 5.6E-8
score: 32.5
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 365..451
NoneNo IPR availablePANTHERPTHR24202:SF4E3 UBIQUITIN-PROTEIN LIGASE MIB2coord: 365..451
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 401..452
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 292..336
score: 8.985
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 58..167
score: 16.733
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 413..446
score: 10.97