Integrin beta

Overview
NameIntegrin beta
Smed IDSMED30006369
Length (bp)2863
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrin beta (SMED30006369) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrin beta (SMED30006369) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrin beta (SMED30006369) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrin beta (SMED30006369) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006369

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30006369SMESG000045564.1 dd_Smed_v4_2017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006369SMESG000045564.1 dd_Smed_v4_2017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006369SMESG000045564.1 dd_Smed_v4_2017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006369SMESG000045564.1 dd_Smed_v6_2017_0_1dd_Smed_v6PMID:28126842
Bonar et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006369SMESG000045564.1 dd_Smed_v6_2017_0_1dd_Smed_v6PMID:28126842
Bonar et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
whole organismSMED30006369SMESG000045564.1 KU961518.1smed_ncbi_20200123PMID:28893948
Abnave et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30006369SMESG000045564.1 KU961518.1smed_ncbi_20200123PMID:28893948
Abnave et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30006369SMESG000045564.1 KU961518smed_ncbi_20200123PMID:28137894
Seebeck et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
stem cellSMED30006369SMESG000045564.1 KU961518smed_ncbi_20200123PMID:28137894
Seebeck et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30006369SMESG000045564.1 KU961518smed_ncbi_20200123PMID:28137894
Seebeck et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrin beta vs. Ensembl Human
Match: ITGB1 (integrin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6153])

HSP 1 Score: 387.882 bits (995), Expect = 1.560e-120
Identity = 285/827 (34.46%), Postives = 426/827 (51.51%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC    IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT+    F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        N++  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I + + KC K ++ S  ++  G  +   +I++  C C+     S  I  SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C+    ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +    +  S  C   +  +C  Y TY     +    ++++      ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECE---CQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTSTCE---ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCTQECSYFNITKVESRDKLPQPVQPDPVSH-CKEKDVDDCWFYFTYS----VNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. Ensembl Human
Match: ITGB1 (integrin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6153])

HSP 1 Score: 387.882 bits (995), Expect = 1.560e-120
Identity = 285/827 (34.46%), Postives = 426/827 (51.51%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC    IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT+    F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        N++  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I + + KC K ++ S  ++  G  +   +I++  C C+     S  I  SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C+    ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +    +  S  C   +  +C  Y TY     +    ++++      ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECE---CQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTSTCE---ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCTQECSYFNITKVESRDKLPQPVQPDPVSH-CKEKDVDDCWFYFTYS----VNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. Ensembl Human
Match: ITGB1 (integrin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6153])

HSP 1 Score: 384.415 bits (986), Expect = 3.146e-119
Identity = 282/825 (34.18%), Postives = 424/825 (51.39%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC    IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT+    F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        N++  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I + + KC K ++ S  ++  G  +   +I++  C C+     S  I  SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C+    ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +    +  S  C   +  +C  Y TY     +    ++++      ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T+ENPI+K P+   KNP Y
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECE---CQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTSTCE---ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCTQECSYFNITKVESRDKLPQPVQPDPVSH-CKEKDVDDCWFYFTYS----VNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPNY 795          
BLAST of Integrin beta vs. Ensembl Human
Match: ITGB2 (integrin subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:6155])

HSP 1 Score: 363.999 bits (933), Expect = 7.607e-112
Identity = 280/817 (34.27%), Postives = 410/817 (50.18%), Query Frame = 3
Query:   99 EECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPG----FRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTD--KTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT-----GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            +EC+K   ++C+ C+E  P C WC    F     GPG     RC +   L+ RGC    I    S  ++Q +      +  + QL P   +  +RPG      +T++    YP+DLYYL DLSYSM DDL+ V  +   +   L  +T+  R+GFG FVDK V PF+N +PD LRNPC N E   ++C PPF ++H+L LT+N   FQ        SGNLD+PEGGLDA++QVA C + I W  N  ++++F +D GFH AGDG+L  ++ P   +C L        ++L    +  S E DYPSVG++A  L E  I  IFA        YEKL E +P +AVG   + SSN+V L+K  Y K+ S+V +        + +   + C +     +  +  C    I+  I +++KV   +C + E S +++  G  D  T+ +   C C +C   S   D S  C+GKG   CG C C  G+ G  CEC T    ++ +++  C+K  +  +CSG G C CG+C C  S        G YCECD + C+R   + +VCGG  RG+C C G C C  G++G  C C  + + C NP       CSG G C C  C C SGY    CQ   G     C     K ++ C  C              L+ EK P   N   C   C    +  + +K   +   E  SE C          +V Y T E+   + + L+     +EC    ++  I+ G + GIV++GI+LL+IWK ++ + D RE   ++++   ++W   +NP+FK   TTV NP +
Sbjct:   23 QECTKFKVSSCRECIESGPGCTWCQKLNF----TGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDH-----NGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKE---KECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWR-NVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHL-------EDNL----YKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQ-EQSFVIRALGFTDIVTVQVLPQCEC-RCRDQSR--DRS-LCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQ-ELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERY--NGQVCGGPGRGLCFC-GKCRCHPGFEGSACQCERTTEGCLNPRRVE---CSGRGRCRCNVCECHSGYQLPLCQECPG-----CPSPCGKYIS-CAEC--------------LKFEKGPFGKN---CSAACPGLQLSNNPVK--GRTCKERDSEGC----------WVAY-TLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQW-NNDNPLFKSATTTVMNPKF 766          
BLAST of Integrin beta vs. Ensembl Human
Match: ITGB2 (integrin subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:6155])

HSP 1 Score: 363.999 bits (933), Expect = 7.607e-112
Identity = 280/817 (34.27%), Postives = 410/817 (50.18%), Query Frame = 3
Query:   99 EECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPG----FRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTD--KTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT-----GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            +EC+K   ++C+ C+E  P C WC    F     GPG     RC +   L+ RGC    I    S  ++Q +      +  + QL P   +  +RPG      +T++    YP+DLYYL DLSYSM DDL+ V  +   +   L  +T+  R+GFG FVDK V PF+N +PD LRNPC N E   ++C PPF ++H+L LT+N   FQ        SGNLD+PEGGLDA++QVA C + I W  N  ++++F +D GFH AGDG+L  ++ P   +C L        ++L    +  S E DYPSVG++A  L E  I  IFA        YEKL E +P +AVG   + SSN+V L+K  Y K+ S+V +        + +   + C +     +  +  C    I+  I +++KV   +C + E S +++  G  D  T+ +   C C +C   S   D S  C+GKG   CG C C  G+ G  CEC T    ++ +++  C+K  +  +CSG G C CG+C C  S        G YCECD + C+R   + +VCGG  RG+C C G C C  G++G  C C  + + C NP       CSG G C C  C C SGY    CQ   G     C     K ++ C  C              L+ EK P   N   C   C    +  + +K   +   E  SE C          +V Y T E+   + + L+     +EC    ++  I+ G + GIV++GI+LL+IWK ++ + D RE   ++++   ++W   +NP+FK   TTV NP +
Sbjct:   23 QECTKFKVSSCRECIESGPGCTWCQKLNF----TGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDH-----NGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKE---KECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWR-NVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHL-------EDNL----YKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQ-EQSFVIRALGFTDIVTVQVLPQCEC-RCRDQSR--DRS-LCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQ-ELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERY--NGQVCGGPGRGLCFC-GKCRCHPGFEGSACQCERTTEGCLNPRRVE---CSGRGRCRCNVCECHSGYQLPLCQECPG-----CPSPCGKYIS-CAEC--------------LKFEKGPFGKN---CSAACPGLQLSNNPVK--GRTCKERDSEGC----------WVAY-TLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQW-NNDNPLFKSATTTVMNPKF 766          
BLAST of Integrin beta vs. Ensembl Celegans
Match: pat-3 (Integrin beta pat-3 [Source:UniProtKB/Swiss-Prot;Acc:Q27874])

HSP 1 Score: 367.851 bits (943), Expect = 2.764e-113
Identity = 267/819 (32.60%), Postives = 412/819 (50.31%), Query Frame = 3
Query:  123 CQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLP--SAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTL-IDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXX-----XXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCL------YESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            C +C++   SC WC    F+++   P  RC S   LME GC  S IE   + +        S++ + +S+++ +Q+KP      IRP   +   +TY+   +YPVDLYYL DLSYSMKDD + +S +   ++E +  +TK  R+GFG F+DK + PFI+P  +   +PC         C  P+ +KH +SLT+N   F+        SGNLD+PEGG DA++Q   C + I W   ARK+++F++D GFH AGDGRLAG+++P    C L+ +            +  ++  DYPS+  +  ++ ++  NVIFA    N+ LY +L+  LP  S++VGV  + S NIVDL+++ Y KI  K+ ++   + +  + L   + C D     D   C    +  E+Q+++ ++   C   +   +L+IG  GL +   + +K  C+CD C      + +S  CNG G   CG C C+ G  G +CEC+     + A +  +CK+T +  +C GRG C CG+           + +G++CECD   C R   D K+C     G C C G C C  G+ G  C+C +S  +C    + +  +C+G G C CG C C     G++    K +    C   K     NC++C             D      +  E+LP L+ ++ C                       D ++ C  Y       Y    T      VRK        K+CP    ++ I++GVI GIVI+GI+LLL+WK++  + DR E A +  +   AKW+T ENPI+K   TT KNP+Y G
Sbjct:   50 CSACIQYHESCAWCGAPMFDEKK--PYARCDSRAKLMEHGCPNSYIEDPATKLDITEDSKLSDQGQVESEEEAVQIKPQEMYVEIRPKSRVRFNVTYRQAVDYPVDLYYLMDLSYSMKDDKQKLSELGDLLAERMRTVTKNFRLGFGSFIDKKLMPFIDPRIEKQLSPCPT------PCAEPYGFKHQMSLTTNTAKFKAEVDKAEISGNLDAPEGGFDAVVQALACNKTIGWRERARKMIVFSTDAGFHFAGDGRLAGVVEPNDGTCHLDREG----------YYTETLNQDYPSIALLHQMIKDRKANVIFAVTKNNQDLYTQLSNALPDVSSSVGVLANDSRNIVDLIEKEYLKISEKIIMVDNANASEGLKLTYRSMCLDGTTLKDTNVCEGIRVGDEVQFEVTLENTHCID-KRDFVLRIGPSGLDETLIVNVKVLCDCD-CERQDRIVTNSADCNG-GDMVCGVCRCKGGNVGKYCECNRPG-MSTAALNEKCKRTNESAICEGRGVCNCGRCECNPRANPEEQISGEFCECDNFNCPR--HDRKICA--EHGECNC-GKCICAPGWTGRACECPISTDSC---LSANGKICNGKGECICGRCRCFDSPDGNRYSGAKCEICPTCPT-KCVEYKNCVMCQQWQTGPLNETACDQCEFKVIPVEELPNLNETTPCQ--------------------FVDPADDCTFYYLY----YYDEATDNATVWVRK-------HKDCPPPVPVLAIVLGVIAGIVILGILLLLLWKLLTVLHDRSEYATFNNERLMAKWDTNENPIYKQATTTFKNPVYAG 806          
BLAST of Integrin beta vs. Ensembl Celegans
Match: C05D9.3 (Uncharacterized integrin beta-like protein C05D9.3 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYK2])

HSP 1 Score: 63.1586 bits (152), Expect = 4.350e-10
Identity = 70/223 (31.39%), Postives = 106/223 (47.53%), Query Frame = 3
Query: 1209 DTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDN--ATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTE--QNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAP 1865
            DT + LK    C  E   T       N I   +++KI+V    C      + L +G L+    A L + + C C+ C  +     +S  C+  G   CG C C +   GD CEC   +      ++++++C+      VCS  G+CKCG+C C+    TG +C+CD   C  A  + KVC G   GVC C G C C+ G++ + C C  ++ NC +   T AP
Sbjct:  148 DTPLQLKFFIVCDGELKETKSCRVQNNQI---VEFKIEVLVNSC-SSTGDITLSVGILRQRTIAGLYVTTICGCE-CEKHPEI--NSRLCHQNGHLVCGQCVCDQSRGGDKCECPLASHGVSKASELEDKCRFNSSSPVCSASGKCKCGQCQCNKPTVTGKFCQCDNDSCPLAV-NGKVCSG--NGVCDC-GVCKCEMGWERDDCSCSTASNNCVD-NGTPAP 358          
BLAST of Integrin beta vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 51.9878 bits (123), Expect = 2.559e-6
Identity = 42/159 (26.42%), Postives = 56/159 (35.22%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTGDFCE---CSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQC 1937
            CN +G+   G C C  GFTG  C+   C      N       C                        S + G  CE     C+ A      C G  RG C  +G C C  G+ GE C+     + C + +      C   G C  G C+C  G+ G+ C
Sbjct:  263 CNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGIC---------------------VCKSGFKGKECEMRHNWCEVAD-----CNG--RGRCDTDGRCRCNPGWTGEACEL----RACPHAS------CHDRGVCVNGTCYCMDGWRGNDC 383          

HSP 2 Score: 50.0618 bits (118), Expect = 9.804e-6
Identity = 53/222 (23.87%), Postives = 75/222 (33.78%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTG-------DFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC----DCLVSNKNCQN--------------------------------------------PTNTSAPLCSGHGSCDCGYCFCESGY-----TGDQCQNIKGD 1955
            C+G G F  G C C+ GF G       ++CE +    +   D   +C+                         +TG+ CE  L  C  A+     C   +RGVC+ NG C C +G++G  C    D +V     Q+                                            PT +S P CS HG      C CESG+     +   CQ + GD
Sbjct:  294 CSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPG---------------------WTGEACE--LRACPHAS-----C--HDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHP-CSAHGQLIDDICQCESGWDSVDCSQQACQCVNGD 483          
BLAST of Integrin beta vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 51.9878 bits (123), Expect = 2.663e-6
Identity = 42/159 (26.42%), Postives = 56/159 (35.22%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTGDFCE---CSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQC 1937
            CN +G+   G C C  GFTG  C+   C      N       C                        S + G  CE     C+ A      C G  RG C  +G C C  G+ GE C+     + C + +      C   G C  G C+C  G+ G+ C
Sbjct:  445 CNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGIC---------------------VCKSGFKGKECEMRHNWCEVAD-----CNG--RGRCDTDGRCRCNPGWTGEACEL----RACPHAS------CHDRGVCVNGTCYCMDGWRGNDC 565          

HSP 2 Score: 50.0618 bits (118), Expect = 9.613e-6
Identity = 53/222 (23.87%), Postives = 75/222 (33.78%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTG-------DFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC----DCLVSNKNCQN--------------------------------------------PTNTSAPLCSGHGSCDCGYCFCESGY-----TGDQCQNIKGD 1955
            C+G G F  G C C+ GF G       ++CE +    +   D   +C+                         +TG+ CE  L  C  A+     C   +RGVC+ NG C C +G++G  C    D +V     Q+                                            PT +S P CS HG      C CESG+     +   CQ + GD
Sbjct:  476 CSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPG---------------------WTGEACE--LRACPHAS-----C--HDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHP-CSAHGQLIDDICQCESGWDSVDCSQQACQCVNGD 665          
BLAST of Integrin beta vs. Ensembl Celegans
Match: ten-1 (Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ6])

HSP 1 Score: 51.9878 bits (123), Expect = 2.691e-6
Identity = 42/159 (26.42%), Postives = 56/159 (35.22%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTGDFCE---CSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQC 1937
            CN +G+   G C C  GFTG  C+   C      N       C                        S + G  CE     C+ A      C G  RG C  +G C C  G+ GE C+     + C + +      C   G C  G C+C  G+ G+ C
Sbjct:  524 CNQRGECVHGKCHCAPGFTGRTCDEAVCPVVCSGNGVFSGGIC---------------------VCKSGFKGKECEMRHNWCEVAD-----CNG--RGRCDTDGRCRCNPGWTGEACEL----RACPHAS------CHDRGVCVNGTCYCMDGWRGNDC 644          

HSP 2 Score: 50.0618 bits (118), Expect = 9.965e-6
Identity = 53/222 (23.87%), Postives = 75/222 (33.78%), Query Frame = 3
Query: 1470 CNGKGKFFCGSCTCQEGFTG-------DFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC----DCLVSNKNCQN--------------------------------------------PTNTSAPLCSGHGSCDCGYCFCESGY-----TGDQCQNIKGD 1955
            C+G G F  G C C+ GF G       ++CE +    +   D   +C+                         +TG+ CE  L  C  A+     C   +RGVC+ NG C C +G++G  C    D +V     Q+                                            PT +S P CS HG      C CESG+     +   CQ + GD
Sbjct:  555 CSGNGVFSGGICVCKSGFKGKECEMRHNWCEVADCNGRGRCDTDGRCRCNPG---------------------WTGEACE--LRACPHAS-----C--HDRGVCV-NGTCYCMDGWRGNDCSVFADAIVHVPQAQSPPRRGQEPTESSKTRKAQVKPTPTSEKKKESRELQKPIIATVQVPTESSHP-CSAHGQLIDDICQCESGWDSVDCSQQACQCVNGD 744          
BLAST of Integrin beta vs. Ensembl Fly
Match: mys (gene:FBgn0004657 transcript:FBtr0340137)

HSP 1 Score: 342.043 bits (876), Expect = 2.911e-103
Identity = 233/752 (30.98%), Postives = 372/752 (49.47%), Query Frame = 3
Query:  327 IQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKV--LTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKG--ETSVILQIGGLKDNATLIIK----SACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR------YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC----ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLC-LYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNT---SNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            +Q++P +   ++R     +I+++Y     YPVDLYYL DLS SM+DD   +S++  K+SE + R+T    +GFG FVDK + P+++  P  L +PC       E C  P+ Y++ + L +N   F    ++ T SGNLD+PEGG DA++Q   C+  I W   AR++++F++D GFH AGDG+L G+I P   +C L+ + +  ++ L+          DYPS+ ++   + +  IN+IFA       +YEKL E +  ++    ++ SSN+V+L+KE Y+KI S V +    D+   D+K+   + C         + C       ++ +  ++   KC +   + +  + I  +  N  + I+     +C C+   S    + ++  C+G G   CG C C + + G+ CECS T   ++      C+                        R       +G +CECD   C+R  + N++C G + G C C G C CK G+ G  C C  SN  C  P      +CSGHG+C+CG C C    +  ++G  C+      S RC   KD     C+ C +Y                K  EL N   C   C       V+   I  TK        ++C  +++ +C+    Y    E++         Q  KECP    M+ I++GVI  IV+VG+ +LL+WK++ TI DRRE A ++++  NAKW+T ENPI+K   +T KNP+Y G
Sbjct:  154 VQIQPQSMRLALRVNEKHNIKISYSQAEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKKLEHPC-------ENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQ----------DYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSVEM---KDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQAN-SCSGHGTSMCGICNCDDSYFGNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCER--NRNQLCSGPDHGTCEC-GRCKCKPGWTGSNCGCQESNDTCMPP--GGGEICSGHGTCECGVCKCTVNDQGRFSGRHCEKCP-TCSGRCQELKD-----CVQCQMY----------------KTGELKNGDDCARNCTQFVPVGVEKVEIDETKD------EQMCKFFDEDDCKFMFKYSEQGELHVYA------QENKECPAKVFMLGIVMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKNPMYAG 845          
BLAST of Integrin beta vs. Ensembl Fly
Match: mys (gene:FBgn0004657 transcript:FBtr0340136)

HSP 1 Score: 342.043 bits (876), Expect = 2.911e-103
Identity = 233/752 (30.98%), Postives = 372/752 (49.47%), Query Frame = 3
Query:  327 IQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKV--LTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKG--ETSVILQIGGLKDNATLIIK----SACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR------YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC----ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLC-LYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNT---SNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            +Q++P +   ++R     +I+++Y     YPVDLYYL DLS SM+DD   +S++  K+SE + R+T    +GFG FVDK + P+++  P  L +PC       E C  P+ Y++ + L +N   F    ++ T SGNLD+PEGG DA++Q   C+  I W   AR++++F++D GFH AGDG+L G+I P   +C L+ + +  ++ L+          DYPS+ ++   + +  IN+IFA       +YEKL E +  ++    ++ SSN+V+L+KE Y+KI S V +    D+   D+K+   + C         + C       ++ +  ++   KC +   + +  + I  +  N  + I+     +C C+   S    + ++  C+G G   CG C C + + G+ CECS T   ++      C+                        R       +G +CECD   C+R  + N++C G + G C C G C CK G+ G  C C  SN  C  P      +CSGHG+C+CG C C    +  ++G  C+      S RC   KD     C+ C +Y                K  EL N   C   C       V+   I  TK        ++C  +++ +C+    Y    E++         Q  KECP    M+ I++GVI  IV+VG+ +LL+WK++ TI DRRE A ++++  NAKW+T ENPI+K   +T KNP+Y G
Sbjct:  154 VQIQPQSMRLALRVNEKHNIKISYSQAEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKKLEHPC-------ENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQ----------DYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSVEM---KDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQAN-SCSGHGTSMCGICNCDDSYFGNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCER--NRNQLCSGPDHGTCEC-GRCKCKPGWTGSNCGCQESNDTCMPP--GGGEICSGHGTCECGVCKCTVNDQGRFSGRHCEKCP-TCSGRCQELKD-----CVQCQMY----------------KTGELKNGDDCARNCTQFVPVGVEKVEIDETKD------EQMCKFFDEDDCKFMFKYSEQGELHVYA------QENKECPAKVFMLGIVMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKNPMYAG 845          
BLAST of Integrin beta vs. Ensembl Fly
Match: mys (gene:FBgn0004657 transcript:FBtr0071105)

HSP 1 Score: 342.043 bits (876), Expect = 2.911e-103
Identity = 233/752 (30.98%), Postives = 372/752 (49.47%), Query Frame = 3
Query:  327 IQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKV--LTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKG--ETSVILQIGGLKDNATLIIK----SACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR------YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC----ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLC-LYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNT---SNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            +Q++P +   ++R     +I+++Y     YPVDLYYL DLS SM+DD   +S++  K+SE + R+T    +GFG FVDK + P+++  P  L +PC       E C  P+ Y++ + L +N   F    ++ T SGNLD+PEGG DA++Q   C+  I W   AR++++F++D GFH AGDG+L G+I P   +C L+ + +  ++ L+          DYPS+ ++   + +  IN+IFA       +YEKL E +  ++    ++ SSN+V+L+KE Y+KI S V +    D+   D+K+   + C         + C       ++ +  ++   KC +   + +  + I  +  N  + I+     +C C+   S    + ++  C+G G   CG C C + + G+ CECS T   ++      C+                        R       +G +CECD   C+R  + N++C G + G C C G C CK G+ G  C C  SN  C  P      +CSGHG+C+CG C C    +  ++G  C+      S RC   KD     C+ C +Y                K  EL N   C   C       V+   I  TK        ++C  +++ +C+    Y    E++         Q  KECP    M+ I++GVI  IV+VG+ +LL+WK++ TI DRRE A ++++  NAKW+T ENPI+K   +T KNP+Y G
Sbjct:  154 VQIQPQSMRLALRVNEKHNIKISYSQAEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKKLEHPC-------ENCKAPYGYQNHMPLNNNTESFSNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQ----------DYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSVEM---KDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQAN-SCSGHGTSMCGICNCDDSYFGNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCER--NRNQLCSGPDHGTCEC-GRCKCKPGWTGSNCGCQESNDTCMPP--GGGEICSGHGTCECGVCKCTVNDQGRFSGRHCEKCP-TCSGRCQELKD-----CVQCQMY----------------KTGELKNGDDCARNCTQFVPVGVEKVEIDETKD------EQMCKFFDEDDCKFMFKYSEQGELHVYA------QENKECPAKVFMLGIVMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKNPMYAG 845          
BLAST of Integrin beta vs. Ensembl Fly
Match: mys (gene:FBgn0004657 transcript:FBtr0340135)

HSP 1 Score: 340.502 bits (872), Expect = 1.131e-102
Identity = 233/752 (30.98%), Postives = 369/752 (49.07%), Query Frame = 3
Query:  327 IQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKV--LTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKG--ETSVILQIGGLKDNATLIIK----SACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR------YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC----ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLC-LYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNT---SNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            +Q++P +   ++R     +I+++Y     YPVDLYYL DLS SM+DD   +S++  K+SE + R+T    +GFG FVDK + P+++  P  L  PC N       C   + + H + L  N T F    ++ T SGNLD+PEGG DA++Q   C+  I W   AR++++F++D GFH AGDG+L G+I P   +C L+ + +  ++ L+          DYPS+ ++   + +  IN+IFA       +YEKL E +  ++    ++ SSN+V+L+KE Y+KI S V +    D+   D+K+   + C         + C       ++ +  ++   KC +   + +  + I  +  N  + I+     +C C+   S    + ++  C+G G   CG C C + + G+ CECS T   ++      C+                        R       +G +CECD   C+R  + N++C G + G C C G C CK G+ G  C C  SN  C  P      +CSGHG+C+CG C C    +  ++G  C+      S RC   KD     C+ C +Y                K  EL N   C   C       V+   I  TK        ++C  +++ +C+    Y    E++         Q  KECP    M+ I++GVI  IV+VG+ +LL+WK++ TI DRRE A ++++  NAKW+T ENPI+K   +T KNP+Y G
Sbjct:  154 VQIQPQSMRLALRVNEKHNIKISYSQAEGYPVDLYYLMDLSKSMEDDKAKLSTLGDKLSETMKRITNNFHLGFGSFVDKVLMPYVSTIPKNLVEPCAN-------CTATYGFHHQMVLDKNITQFTNEVKNATVSGNLDAPEGGFDAIMQAIACRSQIGWREQARRLLVFSTDAGFHYAGDGKLGGVIAPNDGECHLSPKGEYTHSTLQ----------DYPSISQINQKVKDNAINIIFAVTASQLSVYEKLVEHIQGSSAAKLDNDSSNVVELVKEEYRKISSSVEM---KDNATGDVKITYFSSCLSNGPEVQTSKCDNLKEGQQVSFTAQIQLLKCPEDPRDWTQTIHISPVGINEVMQIQLTMLCSCPCENPGSIGYQVQAN-SCSGHGTSMCGICNCDDSYFGNKCECSATDLTSKFANDTSCRADSTSTTDCSGRGHCVCGACECHKRPNPIEIISGKHCECDNFSCER--NRNQLCSGPDHGTCEC-GRCKCKPGWTGSNCGCQESNDTCMPP--GGGEICSGHGTCECGVCKCTVNDQGRFSGRHCEKCP-TCSGRCQELKD-----CVQCQMY----------------KTGELKNGDDCARNCTQFVPVGVEKVEIDETKD------EQMCKFFDEDDCKFMFKYSEQGELHVYA------QENKECPAKVFMLGIVMGVIAAIVLVGLAILLLWKLLTTIHDRREFARFEKERMNAKWDTGENPIYKQATSTFKNPMYAG 845          
BLAST of Integrin beta vs. Ensembl Fly
Match: Itgbn (gene:FBgn0010395 transcript:FBtr0346711)

HSP 1 Score: 263.462 bits (672), Expect = 4.899e-75
Identity = 182/614 (29.64%), Postives = 291/614 (47.39%), Query Frame = 3
Query:   96 DEECSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKR--QSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAA-VGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDE-ANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGET---SVILQIGGLKDNATLII--KSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCEC---STTTEQNEADMKNQCKKTKDD----EVXXXXXXXXXXXXXXXLSRYTGDYCEC-DLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGS 1886
            D++C  A +C+ C+     C WC D  ++      G+RC S + L+   C ++ I   +  +    ++  +  ++ D  +Q+ P      +  G    ++L+Y+   N P+DLY L DL+++M+DD KT+  +  ++S+ L  LT   R+GFG F DKP  P I P      NPC         C+P + Y+H LSLT +   F     ++  +GNLD+ EGGLDAL+QV  C + I W   ARK+V+  +DG  H+AGDG LAG+I+   +QC LN +A  +   L Y         DYPS+ E+   L  + INVIFA   E    Y +L+  +   + V +    SSNI++L+K++Y+ ++ +        D  ID+   T C  +  +   +  C    +  +I + + V  KK    +     + ++   L +   L +  +  C C + + +    +    C+ KG  +CG C C EG+TG +C C   +T    NEA +  +C++   D    E+                  YTG +CEC + L C     D           C C G C CK G+ G +C+C      C  PT     +CS  G+
Sbjct:   30 DDQCRHADSCERCLSAHLECAWCTDKEYQ-----VGYRCLSRRQLLNYNCSETDIYENQPVLDVLQDKPLKDYETSDQAVQVTPQRAYLKLVKGNTQRMKLSYRTARNNPLDLYVLMDLTWTMRDDKKTLEELGAQLSQTLKNLTGNYRLGFGSFADKPTLPMILPQ--HRENPCA---AERATCEPTYGYRHQLSLTDDIPAFTSAVANSKITGNLDNLEGGLDALMQVIVCTKEIGWKEQARKVVILVTDGFMHLAGDGLLAGIIQRNDKQCHLN-KAGEYTGSLNY---------DYPSLEEIYRELLRRKINVIFAVTEEVVSSYWELSALMKEISYVDILSADSSNILELIKKSYESLIKRTQFADNSPD-FIDMAYYTDCGGQFPSLQKRNYCNNVTLGKQIDFYVDVTLKKYPDNQVYTHKIRVEETSLSEFMDLDVELQRPCPCQE-TPDPENEEGRFLCDYKGYLYCGMCECDEGWTGTYCNCPTDATNVTSNEA-LLQKCRQPFSDKSTSELVCSNHGDCDCGTCLCDPGYTGPFCECRECLDCDEKLAD-----------CFC-GQCVCKYGWSGSKCNCDGDTDACVGPT---GEICSERGT 605          
BLAST of Integrin beta vs. Ensembl Zebrafish
Match: itgb2 (integrin, beta 2 [Source:ZFIN;Acc:ZDB-GENE-110411-4])

HSP 1 Score: 374.4 bits (960), Expect = 4.826e-116
Identity = 265/815 (32.52%), Postives = 409/815 (50.18%), Query Frame = 3
Query:   99 EECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXL---SRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEE----IYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            E+C KA+   C  C++  P C WC +  F         RC ++K+L++RGC K  I   ++  ++  N+    +  D +Q++P     ++RPG+P   +L +K    YPVDLYYL DLSYSMKDDL  V ++   I E+L R+T   R+GFG FVDK + P+ + N   L++PC +    NE C P F ++H+L LT+N  DF+E  +    SGNLD PEG LDA++Q A C + I W ++ R +VL T D GFH+AGDG+LA +++P    C+L+      N   K   W      DYPSVG+VA  L E+ I  IFA   + + +Y +L++ +P +AVGV  + S+N+V+L+ E Y  + S+V +        I +K  +KC     F+D   C    I  E+ + + V   +C   ++  I  + G  +   + +++ C C+ C          P C G+GK  CGSC C +GF G  CEC T  +++EA  K QC+K    E                      + G++CECD   C++   DNK C G   G C C G C C +GY+G  C C  S+  C+      + +C   G C C  C CE GY G  C+     +   C R   +   +C+ C                 +  P   N S+           +  IK+  +    D    C + +K  C  ++ +   EE    +Y+V  L       +ECP+  ++I I+ G + G+ ++G+++LLI K V+   D RE   +++  K+ K  +  NP+F+   TTV+NP + G
Sbjct:   23 EQCLKASVNTCGDCIKSGPGCAWCKELNFTKTGEQEAARCDTVKLLLDRGCSKENIINPQNIFQNVVNK-ALVAGKDPVQIQPQEIQLNLRPGMPQTFQLRFKRAEGYPVDLYYLMDLSYSMKDDLANVKNLGNDILEKLNRITGNARIGFGSFVDKTLLPYTDTNEAKLKHPCSD---KNEPCQPAFGFQHVLPLTANGNDFKELVKQQHISGNLDPPEGSLDAIMQAAVCLKEIGWGNSTRLLVLATDD-GFHMAGDGKLAAILEPNKETCQLDK-----NKYSKSNIW------DYPSVGQVARKLEEQNIQPIFAVTKKMETVYTELSKLIPKSAVGVLSEDSNNVVNLIVEAYNNLTSEVIMAHDALPNFISVKYSSKCTGGKTFSDNGKCDNVNIGLEVIFDVTVTVDRCINDQSFSIGPL-GFNEKLKVNVQTLCECN-CGDPPGV---HPHCKGQGKVVCGSCKCNDGFIGQLCEC-TIGKKDEASFKAQCRKDNGTECEGKGDCVCGRCQCHLTEGNGHFYGEHCECDDEHCEKF--DNKQCAG--HGKCKC-GKCECDDGYEGTACHCAKSDNECK----IDSHVCYNRGKCVCNQCECERGYKGPYCK-----TCPTCQRPCQQS-GSCVEC--------------FAFQSGPFEKNCSLA--------CKHLTIKIVDKLVKSD----CRVKDKEGC--WMAFTMTEELGFDLYSVSVLK-----DRECPEGPNIIAIVGGSLAGVALIGLLMLLIIKGVLYASDLREWRRFEKDRKHEK-TSGTNPLFQNATTTVQNPTFSG 766          
BLAST of Integrin beta vs. Ensembl Zebrafish
Match: itgb1a (integrin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-060803-2])

HSP 1 Score: 370.548 bits (950), Expect = 3.574e-114
Identity = 276/832 (33.17%), Postives = 421/832 (50.60%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIE--------FMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFK-GETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNV--DYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYK----TAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EC KA   +C  C++    CGWC DA F  +      RC  ++ L +RGC +  IE           + + ++    ++   +D  Q++P   S  +R G P +I+L +K   +YP+DLYYL DLSYSMKDDL+ V ++   + +E+ ++T   R+GFG FV+K V P+I+  P  L NPC      ++ C  PF YK++L LTSN   F         SGNLDSPEGG DA++QVA C +HI W  N  ++++F++D GFH AGDG+L G++ P   +C L        ND+  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   ++CK+      ++   C    I  E+ + I +  + C K G+T  I ++  G  +   + +   C C+    +  A+ +SP C NG G F CG+C C +G  G  CEC    E +  D+   C+K    ++CS       G C+C K      RY+G YCECD   C R+  +NK+CGG  R  C     C C   Y G  CDC +    C     ++  +C+G G C+CG C C +  + G  C+ I       C+  K+     C+ C           +    GEK         C   C+  N+     R KL +          C   +  +C  Y TY     T +E++ V+ +        ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   26 ECIKANALSCGECIQVGDKCGWCTDAEFLKQGEPTSARCDELESLKKRGCAEDKIENPHGSQRILKNTPVTNRKKGAEKLRPEDITQIQPQKLSLQLRSGEPQNIKLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMKEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLLNPCTG----DQNCTSPFSYKNVLKLTSNGQRFNSLVGQQQISGNLDSPEGGFDAIMQVAVCGEHIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGRCHL-------ENDMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVINLIVDAYNSLSSEVILENSKLPEGVTITYQSRCKNGVVNEGESGRKCSNISIGDEVSFNINITAQGCPKQGKTETIKIKPLGFTEEVEITLSFICECE---CHKHAMKNSPLCHNGNGSFECGACRCNKGRVGRQCECR-KDEVSTEDLDKNCRKDNGTDICSNNGECVCGTCECKKRENPEERYSGKYCECDNFNCDRS--NNKLCGGHGRCECRV---CVCDANYTGSACDCSLDTSTC---LASNKQICNGRGICECGTCRCTDPKFQGPTCE-ICPTCPGVCTEHKE-----CVQC-----------RAFGTGEK------KDTCKRDCSYFNLIEVEDRDKLPQPVQAFPLMH-CKERDARDCWFYYTYAVNNNTEKEVHVVKTM--------ECPPGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVINPKYEG 797          
BLAST of Integrin beta vs. Ensembl Zebrafish
Match: itgb1a (integrin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-060803-2])

HSP 1 Score: 365.54 bits (937), Expect = 2.638e-112
Identity = 272/830 (32.77%), Postives = 418/830 (50.36%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIE--------FMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFK-GETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNV--DYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYK----TAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            EC KA   +C  C++    CGWC DA F  +      RC  ++ L +RGC +  IE           + + ++    ++   +D  Q++P   S  +R G P +I+L +K   +YP+DLYYL DLSYSMKDDL+ V ++   + +E+ ++T   R+GFG FV+K V P+I+  P  L NPC      ++ C  PF YK++L LTSN   F         SGNLDSPEGG DA++QVA C +HI W  N  ++++F++D GFH AGDG+L G++ P   +C L        ND+  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   ++CK+      ++   C    I  E+ + I +  + C K G+T  I ++  G  +   + +   C C+    +  A+ +SP C NG G F CG+C C +G  G  CEC    E +  D+   C+K    ++CS       G C+C K      RY+G YCECD   C R+  +NK+CGG  R  C     C C   Y G  CDC +    C     ++  +C+G G C+CG C C +  + G  C+ I       C+  K+     C+ C           +    GEK         C   C+  N+     R KL +          C   +  +C  Y TY     T +E++ V+ +        ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K P+   +NP Y
Sbjct:   26 ECIKANALSCGECIQVGDKCGWCTDAEFLKQGEPTSARCDELESLKKRGCAEDKIENPHGSQRILKNTPVTNRKKGAEKLRPEDITQIQPQKLSLQLRSGEPQNIKLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMKEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLLNPCTG----DQNCTSPFSYKNVLKLTSNGQRFNSLVGQQQISGNLDSPEGGFDAIMQVAVCGEHIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGRCHL-------ENDMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVINLIVDAYNSLSSEVILENSKLPEGVTITYQSRCKNGVVNEGESGRKCSNISIGDEVSFNINITAQGCPKQGKTETIKIKPLGFTEEVEITLSFICECE---CHKHAMKNSPLCHNGNGSFECGACRCNKGRVGRQCECR-KDEVSTEDLDKNCRKDNGTDICSNNGECVCGTCECKKRENPEERYSGKYCECDNFNCDRS--NNKLCGGHGRCECRV---CVCDANYTGSACDCSLDTSTC---LASNKQICNGRGICECGTCRCTDPKFQGPTCE-ICPTCPGVCTEHKE-----CVQC-----------RAFGTGEK------KDTCKRDCSYFNLIEVEDRDKLPQPVQAFPLMH-CKERDARDCWFYYTYAVNNNTEKEVHVVKTM--------ECPPGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTTENPIYKSPINKFQNPNY 795          
BLAST of Integrin beta vs. Ensembl Zebrafish
Match: itgb1b.1 (integrin, beta 1b.1 [Source:ZFIN;Acc:ZDB-GENE-060803-3])

HSP 1 Score: 348.977 bits (894), Expect = 2.743e-106
Identity = 264/829 (31.85%), Postives = 411/829 (49.58%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR--IKRQSD-------DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFT--DKTSCLKNPIDGEIQYKIKVDTKKC-FKGETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNG-KGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXX-----XXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLY------ESLVVDDVPKYKLEGEKLPE-LSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A  C  C++  P C WC D  F+        RC  I+ + + GC    +E  + ++    N+    R++D       D+  Q++P   + ++R G      L +K   +YP+DLY+L DLS+SM  +L+ V  +  +++ E+  +TK L +GFG F++K V P+I   P  L+NPC         C  PF YK++LSLT N   F +       SGNLD+PE G DA++Q A C   I W  N  ++++F++D GFH+AGDG+L G+++P   +C L+      +N             DYP++ ++   L+   I  IFA   E + +Y++L+  +P +AVG+   SSSN++ L+ + Y  + S+V +        + +  ++ CK+  + T  +   C    I  E+ + I++  K C  KG+   I ++  G  +   +++   C C+    +   I +SPKC+G +G   CG C C EG  G  CECS   E    D+   C+     EVCS  G      C+C K      RY+G++CECD   C R+  +NK+CGG  R  C C   C C   Y G  CDC +    C   TN    +C+G G C+CG C C+  Y G  C+ I     + C+  KD     C+ C +      +    +D   Y ++  K  E L   ++ H  C   +VD   I  T     +DGS           ++YV                     +ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE   ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKTCGECIQIGPQCVWCKDPDFKPS------RCDDIESMAKAGCTADGVENPRGAVTIDKNKPVTNRKTDGGQNLRPDEITQIQPQKVTLNLRSGEAQKFTLKFKRAEDYPIDLYFLMDLSHSMVSNLENVKKLGTELANEMKDITKDLHIGFGSFLEKLVMPYILMTPKYLKNPC-----FPSDCTAPFSYKNVLSLTDNHGLFTQEVSKQKTSGNLDAPEAGFDAIMQAAVCTDVIGWR-NVTRLLVFSTDAGFHLAGDGKLGGIVRPNDGKCHLDNNMYTMSNYF-----------DYPTISQLVDTLSGNNIQTIFAVTEEIREIYQELSALIPKSAVGILSTSSSNVIKLIIDAYNSLSSEVILENSKLPDGVSISYVSHCKNGVSGTGDNGRKCSNISIGDEVLFDIEITAKGCPSKGKPETIKIKPLGFSEEVEILLNYICECE---CHKDGIKNSPKCSGGQGTLECGVCRCNEGRLGRLCECSHD-EVLADDLDANCRMNNGTEVCSNNGECVCGTCECKKRDNPEERYSGEFCECDNFSCDRS--NNKLCGGHGR--CECK-KCICDANYTGSACDCPLDTATCLASTNE---ICNGRGKCECGVCKCDENYEGPTCE-ICPTCPRICTERKD-----CVECRHFGTGSKQKTCEEDCKSYSIKKVKTKEDLPPPNINH--CKERDVDDCWIFFTSSIE-KDGS----------IQVYVAEN------------------RECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMVIHDRREFDKFEKEKNNAKWDTGENPIYKSAVTTVVNPRYEG 786          
BLAST of Integrin beta vs. Ensembl Zebrafish
Match: itgb7 (integrin, beta 7 [Source:ZFIN;Acc:ZDB-GENE-100728-2])

HSP 1 Score: 345.895 bits (886), Expect = 1.820e-105
Identity = 261/807 (32.34%), Postives = 403/807 (49.94%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQK-SLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKD--EAN-FTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEA-DMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            C    +C  C+ +SP C WC    F         RC S K L +RGC+   +I   K  +    N        + +QLKP   +  +R G+P +  + +K    YP+DLYYL DLSYSM+DDL+ + ++ +KI ++L  +T+ +R+GFG FVDK + P+++  P   +NPC N   +N  C   F+++++L LTS+  +F+        SGNLDSPE GLDA++Q A C+  I W  N  +I+++TSD  FH+AGDGRL G   P   QC        FN+   Y+G       DYPSVG V+ VL +  I +IFA   E    Y+ L+  +P + VGV +  SSN+VDL+ E Y  + S + +  +     + +   +KCKD   AN + +K  C +     +I ++++++   C K      +++ G+ +   + + + C CD C +   A  SS  CN KG   CG C+C EG+ G  C C    +QN+   M + C+      VCSG+G C+CG C C  + Y+G YCECD   C++   +   C GK  G C C G C C++ Y G  C+C  S   C+N       LCSG G C C  C C+ G  GD C             D  ++  +C+ C                      L  S  CH++C  + V +           E   E+  IY  ++    V  K + E+  V+   +   + K    TA +I      + GI+I GI++++I+++++ + D RE   + +     +W+  +NP+FK   TTV NPL+
Sbjct:   27 CQNQPSCSECI-RSPGCAWCTQMNFLKSGESNERRCDSPKSLKDRGCEDVRVINPGKHPLDYVKNNDLSNDSYNVVQLKPQNVNIKLRVGVPYEFTVEFKRAQGYPIDLYYLMDLSYSMQDDLEQIKTLGQKILKKLKDITETVRIGFGSFVDKEMLPYVSQLPPRRKNPCPNR--IN-TCQKAFMFQNVLPLTSDGREFEREVSKQNISGNLDSPEAGLDAIMQAAVCKDKIKW-GNVTRILVYTSDDTFHMAGDGRLGGAFLPHNGQC-------HFNDMGSYIG----KAYDYPSVGHVSRVLQDNNIQLIFAVTEEIYPAYKALSALIPQSVVGVLKKDSSNVVDLISEAYGNLSSTLVLEQEGAPAELMVSYRSKCKDNQAANEWREKGEC-QGIKHEKITFQVRLNATACLKEPQIFRIKMQGISEEVKITVDTECQCD-CGA---AEKSSEHCNHKGDLSCGMCSCDEGYLGQNCSC---VQQNDTIKMLDSCRPNNRSLVCSGQGSCECGNCVCR-NEYSGKYCECDPDSCEKR--NGVRCNGK--GKCEC-GKCECRDRYTGSACECSPSQDKCKNDWG----LCSGQGECVCNRCHCKPGVIGDYCSAF---------MDACELFKDCLAC---------------------HLEGSGSCHERCFNATVKH----------LEGTHELSCIYKHVS--YSVELKASGEV-NVKYADLPHTVDK----TAVII---GSSVSGIIITGIIIIIIYRLLLELYDYREYQSFVKMQNQTQWKEAQNPLFKGATTTVMNPLH 749          
BLAST of Integrin beta vs. Ensembl Xenopus
Match: ITGB2 (integrin subunit beta 2 [Source:NCBI gene;Acc:100492659])

HSP 1 Score: 387.882 bits (995), Expect = 5.148e-121
Identity = 272/825 (32.97%), Postives = 414/825 (50.18%), Query Frame = 3
Query:  111 KATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKS-SIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCEL--NLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTD-KTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPK---CNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT-----GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSR----------DKDKVLTNC-MLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            K +NC  C++  P C WC    F         RC + +VL +RGC++  I +  S S+     R+      D +QL P   S  +RPG   + ++T++    YPVDLYYL DLSYSM DDL+ V ++   + E L ++T   ++GFG FVDK V PF+N +P+ L+NPC      NE C PPF +KHIL LT +   FQ++      SGNLD+PEGGLDA++QVA C   I W  N  +++++ +D GFH+AGDG+LA ++ P   QC L  NL             +  S E DYPSVG++A  L+E  I  +FA        Y  L++ +P + VG     S N+V L+ + Y+ + S+V +        +++   + C  +      K  C    I  EI++K+KV   KC + ++  I  + G  D  T+ +++ C+C+         D +P+   CN  G   CG C+C EGF G  CEC T  + ++ +++  CKK     VCSG G C CG+C C  +  T     G YC+CD   C+    + ++C G+  G C C G C C EGY+G  C C  S  NC+N   +   +CSG G C+C  C C+ GY    C++  G  S  CS+           +D    NC  LC          P  K   E++ EL   ++C +K      D S   +      +DG +                          K  +++ +K+ECP+  + + I+ G   G++++G+  L+IWK++  I DR E   ++++ +N KW    NP++    TTV+NP + G
Sbjct:   20 KVSNCNECIQSGPFCAWCKQPNFTSAGEPDSVRCDTDEVLGKRGCKEVDIVYHDSRSVVKDRTRLS-----DRVQLTPREISLQLRPGKAAEFDVTFRRAQGYPVDLYYLMDLSYSMNDDLQNVKNLGSNLLEALNKITTSAQIGFGSFVDKTVLPFVNTHPEKLKNPC---PERNENCQPPFAFKHILKLTEDGKQFQDQVGKQGISGNLDAPEGGLDAMMQVAVCGDKIGWR-NVTRLLVYATDDGFHIAGDGKLASILIPNDGQCHLEDNL-------------YKRSNEFDYPSVGQLAQKLSENNIQAVFAVTSNMVQTYRNLSKLIPKSVVGELSSDSRNVVQLITDAYQALSSEVILDHGTTPDFLEILYDSLCPGDIKENQLKGMCSNVKIGEEIKFKVKVTASKCLQDQSFAIRPL-GFTDTLTVSVRTLCDCE--------CDETPRPGDCNSNGTIKCGICSCNEGFVGKNCECVTGGKTSQ-ELEQSCKKENGSAVCSGAGDCICGQCTCHTNEDTSKKIYGQYCQCDNWNCELF--EGRLCAGQ--GTCDC-GVCRCNEGYEGSACQCKRSTSNCKNAKGS---VCSGRGKCECNNCICKPGYLQPHCESCPGCPSP-CSKFGPCVECYINQEDGSTQNCSHLC----------PGVK--AERVEELKRETVCKEK------DSSNCWMQYVIVEDDGED--------------------------KFTITYTLKRECPEAPNFVAIVGGTTAGVILIGMACLIIWKIITEIKDRNEYNRFEKERQNCKWNQASNPLYHKATTTVQNPNFSG 759          
BLAST of Integrin beta vs. Ensembl Xenopus
Match: ITGB2 (integrin subunit beta 2 [Source:NCBI gene;Acc:100492659])

HSP 1 Score: 387.497 bits (994), Expect = 9.430e-121
Identity = 272/825 (32.97%), Postives = 414/825 (50.18%), Query Frame = 3
Query:  111 KATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKS-SIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCEL--NLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTD-KTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPK---CNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT-----GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSR----------DKDKVLTNC-MLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            K +NC  C++  P C WC    F         RC + +VL +RGC++  I +  S S+     R+      D +QL P   S  +RPG   + ++T++    YPVDLYYL DLSYSM DDL+ V ++   + E L ++T   ++GFG FVDK V PF+N +P+ L+NPC      NE C PPF +KHIL LT +   FQ++      SGNLD+PEGGLDA++QVA C   I W  N  +++++ +D GFH+AGDG+LA ++ P   QC L  NL             +  S E DYPSVG++A  L+E  I  +FA        Y  L++ +P + VG     S N+V L+ + Y+ + S+V +        +++   + C  +      K  C    I  EI++K+KV   KC + ++  I  + G  D  T+ +++ C+C+         D +P+   CN  G   CG C+C EGF G  CEC T  + ++ +++  CKK     VCSG G C CG+C C  +  T     G YC+CD   C+    + ++C G+  G C C G C C EGY+G  C C  S  NC+N   +   +CSG G C+C  C C+ GY    C++  G  S  CS+           +D    NC  LC          P  K   E++ EL   ++C +K      D S   +      +DG +                          K  +++ +K+ECP+  + + I+ G   G++++G+  L+IWK++  I DR E   ++++ +N KW    NP++    TTV+NP + G
Sbjct:   34 KVSNCNECIQSGPFCAWCKQPNFTSAGEPDSVRCDTDEVLGKRGCKEVDIVYHDSRSVVKDRTRLS-----DRVQLTPREISLQLRPGKAAEFDVTFRRAQGYPVDLYYLMDLSYSMNDDLQNVKNLGSNLLEALNKITTSAQIGFGSFVDKTVLPFVNTHPEKLKNPC---PERNENCQPPFAFKHILKLTEDGKQFQDQVGKQGISGNLDAPEGGLDAMMQVAVCGDKIGWR-NVTRLLVYATDDGFHIAGDGKLASILIPNDGQCHLEDNL-------------YKRSNEFDYPSVGQLAQKLSENNIQAVFAVTSNMVQTYRNLSKLIPKSVVGELSSDSRNVVQLITDAYQALSSEVILDHGTTPDFLEILYDSLCPGDIKENQLKGMCSNVKIGEEIKFKVKVTASKCLQDQSFAIRPL-GFTDTLTVSVRTLCDCE--------CDETPRPGDCNSNGTIKCGICSCNEGFVGKNCECVTGGKTSQ-ELEQSCKKENGSAVCSGAGDCICGQCTCHTNEDTSKKIYGQYCQCDNWNCELF--EGRLCAGQ--GTCDC-GVCRCNEGYEGSACQCKRSTSNCKNAKGS---VCSGRGKCECNNCICKPGYLQPHCESCPGCPSP-CSKFGPCVECYINQEDGSTQNCSHLC----------PGVK--AERVEELKRETVCKEK------DSSNCWMQYVIVEDDGED--------------------------KFTITYTLKRECPEAPNFVAIVGGTTAGVILIGMACLIIWKIITEIKDRNEYNRFEKERQNCKWNQASNPLYHKATTTVQNPNFSG 773          
BLAST of Integrin beta vs. Ensembl Xenopus
Match: itgb1 (integrin subunit beta 1 [Source:NCBI gene;Acc:394767])

HSP 1 Score: 368.237 bits (944), Expect = 2.624e-113
Identity = 279/832 (33.53%), Postives = 421/832 (50.60%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEF-------MKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKC-FKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EC KA   +C  C++  P+CGWC    F         RC  +  L  +GC +  I+        +K    +   + +R    +  Q++P      +R G P    LT++   +YP+DLYYL DLS+SMKDDL+ V S+   +  E+ ++T   R+GFG FV+K V P+I+  P  L NPC +    ++ C  PF YK++L+LTS+   F +       SGNLDSPEGG DA++QVA C + I W  N  ++++F++D GFH AGDG+L G++ P   +C  +L  + +     Y         DYPS+  +   L+E  I  IFA   + + +Y++L   +P +AVG    +SSN++ L+ ++Y  + S++ +    LP  +   I  K   K   +    D   C    I  +++++I V   KC  KG+  S+ ++  G  +   ++++  C CD C    T   +SP+C +G G F CG+C C EG  G  CECS T E N  DM   C++    E+CS       G+C C K       Y+G YCECD   C R+  +  +CGGK  GVC C   C C   Y G  CDC      C      +  +C+G G CDCG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK        +C ++C   N+    SR  L +    E  +  C   +  +C  Y TY     + +  ++L+    + ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   17 ECLKANAKSCGECIQAGPNCGWCTKVNFLQEGEPTSARCDDLAALKNKGCPEEDIQNPRGRKQKLKDIPITNKGKGERMDPANITQIRPQQLVFELRSGEPQTFNLTFRRAEDYPIDLYYLMDLSFSMKDDLENVKSLGTALMTEMEKITSDFRIGFGSFVEKTVMPYISTTPAKLINPCTS----DQNCTSPFSYKNVLNLTSDGKLFNDLVGKQQISGNLDSPEGGFDAIMQVAVCGEQIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC--HLHGNMYTMSHYY---------DYPSIAHLVQKLSENNIQTIFAVTEDFQPVYQELKNLIPKSAVGTLSSNSSNVIQLIIDSYNSLSSELILENSKLP--EGVTISYKSFCKNGVKGTGEDGRKCSNISIGDQVEFEISVTAHKCPKKGQAESIKIKPLGFTEEVEIVLQFICECD-CQEKGTP--NSPECHHGNGTFECGACRCNEGRIGKECECS-TDEVNSEDMDAYCRRENSSEICSNNGDCICGQCVCKKRDNPNEVYSGKYCECDNFNCDRS--NGLICGGK--GVCKCR-VCECFPNYSGSACDCSEDTSTCM---AKNGQICNGRGICDCGRCKCTDPKFQGPTCELCQTCVG----VCTEHKE-----CVQC-----------RAFQKGEK------QEVCLEQCMHFNISLVESREDLPQPGQAEALTH-CKEKDAEDCWFYFTYS----VDSKNEVLVHVVKEPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 787          
BLAST of Integrin beta vs. Ensembl Xenopus
Match: itgb1 (integrin subunit beta 1 [Source:NCBI gene;Acc:394767])

HSP 1 Score: 367.851 bits (943), Expect = 3.954e-113
Identity = 279/832 (33.53%), Postives = 421/832 (50.60%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEF-------MKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKC-FKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EC KA   +C  C++  P+CGWC    F         RC  +  L  +GC +  I+        +K    +   + +R    +  Q++P      +R G P    LT++   +YP+DLYYL DLS+SMKDDL+ V S+   +  E+ ++T   R+GFG FV+K V P+I+  P  L NPC +    ++ C  PF YK++L+LTS+   F +       SGNLDSPEGG DA++QVA C + I W  N  ++++F++D GFH AGDG+L G++ P   +C  +L  + +     Y         DYPS+  +   L+E  I  IFA   + + +Y++L   +P +AVG    +SSN++ L+ ++Y  + S++ +    LP  +   I  K   K   +    D   C    I  +++++I V   KC  KG+  S+ ++  G  +   ++++  C CD C    T   +SP+C +G G F CG+C C EG  G  CECS T E N  DM   C++    E+CS       G+C C K       Y+G YCECD   C R+  +  +CGGK  GVC C   C C   Y G  CDC      C      +  +C+G G CDCG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK        +C ++C   N+    SR  L +    E  +  C   +  +C  Y TY     + +  ++L+    + ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   18 ECLKANAKSCGECIQAGPNCGWCTKVNFLQEGEPTSARCDDLAALKNKGCPEEDIQNPRGRKQKLKDIPITNKGKGERMDPANITQIRPQQLVFELRSGEPQTFNLTFRRAEDYPIDLYYLMDLSFSMKDDLENVKSLGTALMTEMEKITSDFRIGFGSFVEKTVMPYISTTPAKLINPCTS----DQNCTSPFSYKNVLNLTSDGKLFNDLVGKQQISGNLDSPEGGFDAIMQVAVCGEQIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC--HLHGNMYTMSHYY---------DYPSIAHLVQKLSENNIQTIFAVTEDFQPVYQELKNLIPKSAVGTLSSNSSNVIQLIIDSYNSLSSELILENSKLP--EGVTISYKSFCKNGVKGTGEDGRKCSNISIGDQVEFEISVTAHKCPKKGQAESIKIKPLGFTEEVEIVLQFICECD-CQEKGTP--NSPECHHGNGTFECGACRCNEGRIGKECECS-TDEVNSEDMDAYCRRENSSEICSNNGDCICGQCVCKKRDNPNEVYSGKYCECDNFNCDRS--NGLICGGK--GVCKCR-VCECFPNYSGSACDCSEDTSTCM---AKNGQICNGRGICDCGRCKCTDPKFQGPTCELCQTCVG----VCTEHKE-----CVQC-----------RAFQKGEK------QEVCLEQCMHFNISLVESREDLPQPGQAEALTH-CKEKDAEDCWFYFTYS----VDSKNEVLVHVVKEPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 788          
BLAST of Integrin beta vs. Ensembl Xenopus
Match: itgb1 (integrin subunit beta 1 [Source:NCBI gene;Acc:394767])

HSP 1 Score: 367.851 bits (943), Expect = 5.622e-113
Identity = 279/832 (33.53%), Postives = 421/832 (50.60%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEF-------MKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKC-FKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EC KA   +C  C++  P+CGWC    F         RC  +  L  +GC +  I+        +K    +   + +R    +  Q++P      +R G P    LT++   +YP+DLYYL DLS+SMKDDL+ V S+   +  E+ ++T   R+GFG FV+K V P+I+  P  L NPC +    ++ C  PF YK++L+LTS+   F +       SGNLDSPEGG DA++QVA C + I W  N  ++++F++D GFH AGDG+L G++ P   +C  +L  + +     Y         DYPS+  +   L+E  I  IFA   + + +Y++L   +P +AVG    +SSN++ L+ ++Y  + S++ +    LP  +   I  K   K   +    D   C    I  +++++I V   KC  KG+  S+ ++  G  +   ++++  C CD C    T   +SP+C +G G F CG+C C EG  G  CECS T E N  DM   C++    E+CS       G+C C K       Y+G YCECD   C R+  +  +CGGK  GVC C   C C   Y G  CDC      C      +  +C+G G CDCG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK        +C ++C   N+    SR  L +    E  +  C   +  +C  Y TY     + +  ++L+    + ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   35 ECLKANAKSCGECIQAGPNCGWCTKVNFLQEGEPTSARCDDLAALKNKGCPEEDIQNPRGRKQKLKDIPITNKGKGERMDPANITQIRPQQLVFELRSGEPQTFNLTFRRAEDYPIDLYYLMDLSFSMKDDLENVKSLGTALMTEMEKITSDFRIGFGSFVEKTVMPYISTTPAKLINPCTS----DQNCTSPFSYKNVLNLTSDGKLFNDLVGKQQISGNLDSPEGGFDAIMQVAVCGEQIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKC--HLHGNMYTMSHYY---------DYPSIAHLVQKLSENNIQTIFAVTEDFQPVYQELKNLIPKSAVGTLSSNSSNVIQLIIDSYNSLSSELILENSKLP--EGVTISYKSFCKNGVKGTGEDGRKCSNISIGDQVEFEISVTAHKCPKKGQAESIKIKPLGFTEEVEIVLQFICECD-CQEKGTP--NSPECHHGNGTFECGACRCNEGRIGKECECS-TDEVNSEDMDAYCRRENSSEICSNNGDCICGQCVCKKRDNPNEVYSGKYCECDNFNCDRS--NGLICGGK--GVCKCR-VCECFPNYSGSACDCSEDTSTCM---AKNGQICNGRGICDCGRCKCTDPKFQGPTCELCQTCVG----VCTEHKE-----CVQC-----------RAFQKGEK------QEVCLEQCMHFNISLVESREDLPQPGQAEALTH-CKEKDAEDCWFYFTYS----VDSKNEVLVHVVKEPECPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 805          
BLAST of Integrin beta vs. Ensembl Mouse
Match: Itgb1 (integrin beta 1 (fibronectin receptor beta) [Source:MGI Symbol;Acc:MGI:96610])

HSP 1 Score: 387.497 bits (994), Expect = 1.189e-120
Identity = 292/831 (35.14%), Postives = 426/831 (51.26%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC +  F    +    RC  ++ L ++GCQ S IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT     F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L       NN      ++     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +    LP  D   I+ K  + CK+  N T +    C    I  E+Q++I +   KC   E+  I ++  G  +   ++++  C   KC+  S  I +SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C     ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +     D    C   +  +C  Y TY        +  ++ +     +CP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLE------NNVYTMSHYY-----DYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLP--DGVTINYK--SYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFIC---KCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGGN--GVCRCR-VCECYPNYTGSACDCSLDTGPC---LASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCAQECSHFNLTKVESREKLPQPVQV-DPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET----PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. Ensembl Mouse
Match: Itgb2 (integrin beta 2 [Source:MGI Symbol;Acc:MGI:96611])

HSP 1 Score: 364.77 bits (935), Expect = 2.352e-112
Identity = 275/817 (33.66%), Postives = 406/817 (49.69%), Query Frame = 3
Query:   99 EECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPG----FRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLS-----RYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            +EC+K   ++C+ C++  P C WC    F     GPG     RC +   L+ +GC    I   +S    + ++  ++      QL P   +  +RPG      +T++    YP+DLYYL DLSYSM DDL  V  +   + + L  +T+  R+GFG FVDK V PF+N +P+ LRNPC N E   + C PPF ++H+L LT N   FQ        SGNLD+PEGGLDA++QVA C + I W  N  ++++F +D GFH AGDG+L  ++ P   +C L               +  S E DYPSVG++A  L+E  I  IFA   +    YEKL E +P +AVG   D SSN+V L+K  Y K+ S+V +        + +   + C + A+   K+   C    I+  + +++KV   +C + E S +++  G  D  T+ ++  C C +C   S        C GKG   CG C C+ G+ G  CEC T    ++ +++  C+K     VCSG G C CG+C C  S        G YCECD + C+R   +++VCGG +RG C C G C+CK GY+G  C C  S   C N        CSG G C C  C C+ GY    C++     S    RD     T+C  C              L+ +K P   N S+       + +    I L K+   E  SE C I   L        K    IY +       +   EC    ++  I+ G ++G+V++G++LL+IWK +  + D RE   ++++   ++W   +NP+FK   TTV NP +
Sbjct:   23 QECTKYKVSSCRDCIQSGPGCSWCQKLNF----TGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRK-----QLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKE---KACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWR-NVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNM-----------YKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQ-EQSFVIRALGFTDTVTVQVRPQCEC-QCRDQSR---EQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQ-ELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERY--NSQVCGGSDRGSCNC-GKCSCKPGYEGSACQCQRSTTGCLNARLVE---CSGRGHCQCNRCICDEGYQPPMCEDCPSCGSH--CRDNH---TSCAEC--------------LKFDKGPFEKNCSV-----QCAGMTLQTIPLKKKPCKERDSEGCWITYTLQ------QKDGRNIYNIH-----VEDSLECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQW-NNDNPLFKSATTTVMNPKF 767          
BLAST of Integrin beta vs. Ensembl Mouse
Match: Itgb3 (integrin beta 3 [Source:MGI Symbol;Acc:MGI:96612])

HSP 1 Score: 347.436 bits (890), Expect = 1.172e-105
Identity = 255/812 (31.40%), Postives = 399/812 (49.14%), Query Frame = 3
Query:  120 NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR---IKRQSDDDEI-QLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPF--INPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFK-GETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXX---XXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEI-CVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            +CQ C+  SP C WC D      +     RC   + L++  C    IEF  S  +    R    K      +I Q+ P   +  +RP       L  + + +YPVD+YYL DLS+SMKDDL ++ ++  K++ ++ +LT  LR+GFG FVDKPV P+  I+P P A++NPC N++     C P F YKH+L+LT   + F E  +  + S N D+PEGG DA++Q   C + I W ++A  +++FT+D   H+A DGRLAG++ P    C +               +  S   DYPS+G +   L++K IN+IFA       LY+  +E +P   VGV  D SSN++ L+ + Y KI SKV +  +     + L     C +        SC+   I   + + I+   + C +  E S  ++  G KD+ T+ +   C+   C+  + A  SSP+C NG G F CG C C +G+ G  CECS   E      + +C   +   +CS RG     +C        + TG YCECD   C R     ++C G   G C C G C C   + G  C+C      C    +T+  LCSG G+C+CG C C + G  GD C+                    C  C        D   +K E  +  + +  ++ H++   S      I+  K+ +    + + C   N+ +C +   Y    E  + R +L   + + ECP    ++++++ V+  I+++G+  LLIWK+++TI DR+E A ++E+   AKW+T  NP++K   +T  N  Y+G
Sbjct:   37 SCQQCLAVSPVCAWCSDETLSQGSP----RCNLKENLLKDNCAPESIEFPVSEAQILEARPLSSKGSGSSAQITQVSPQRIALRLRPDDSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGAFVDKPVSPYMYISP-PQAIKNPCYNMK---NACLPMFGYKHVLTLTDQVSRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGHCHIGTDNH----------YSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSDDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFSIEAKVRGCPQEKEQSFTIKPVGFKDSLTVQVTFDCD---CACQAFAQPSSPRCNNGNGTFECGVCRCDQGWLGSMCECS--EEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRY--KGEMCSG--HGQCNC-GDCVCDSDWTGYYCNCTTRTDTCM---STNGLLCSGRGNCECGSCVCVQPGSYGDTCE-------------------KCPTC-------PDACSFKKECVECKKFNRGTL-HEENTCSRYCRDDIEQVKELTDTGKNAVNCTYKNEDDCVVRFQYY---EDTSGRAVLYVVE-EPECPKGPDILVVLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRG 786          
BLAST of Integrin beta vs. Ensembl Mouse
Match: Itgb6 (integrin beta 6 [Source:MGI Symbol;Acc:MGI:96615])

HSP 1 Score: 344.354 bits (882), Expect = 1.892e-104
Identity = 256/810 (31.60%), Postives = 401/810 (49.51%), Query Frame = 3
Query:  114 ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR---IKRQSDD-DEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT---GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCES-GYTGDQCQNIKGDSSQRCSRDKDKVLT--NCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            A +C  C+   P C WC    F   + G G RC +   L+ +GCQ   IE   S I+   N+   + RQ +  D +Q+ P +    +RPG    +++  +   +YPVDLYYL DLS SM DDL T+  +  ++++E+ +LT   R+GFG FV+KPV PF+   P+ + NPC ++      C P F +KHIL LT +   F E  +    S N+D+PEGG DA++Q A C++ I W +++  +++F SD   H   D +LAG++ P    C L+ + +          +  S   +YP++G++   L +  + +IFA   E   LYE  A+ +P A VG+ +  S NI+ L+   Y+++ S+V +    D   ++L     C +   F  +  C    +     + + V    C K   ++I++  GL D   +++ + C+CD         +SS   NG G F CG CTC  G  G  CEC       ++     CK++     CSGRG C CG+C C LS Y    G YC+CD   C R      +CG  + G C C G C C++G+ GE C+C  +  +C   T+    LCSG G C CG C C + G +G  C        +RC    D   +  +C+ C   +           +G+   E      C DKC       S    +K     D S  C +  +  C I     T  E  T+   +     +K+CP   ++ MI++GV + I+++G+VLL IWK++V+  DR+E A ++ +   AKW+T  NP+++   +T KN  Y+
Sbjct:   28 AESCSDCLLTGPHCAWCSQENFTHLS-GAGERCDTPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEITNPCSSIPYF---CLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE----------YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVTVSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCD--CQREIETNSSKCHNGNGSFQCGVCTCNPGHMGPHCECGEDMVSTDS-----CKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCDNFSCLR--HKGLLCG--DNGDCDC-GECVCRDGWTGEYCNCTTNRDSC---TSEDGVLCSGRGDCVCGKCVCRNPGASGPTC--------ERCPTCGDPCNSKRSCIECYLSA-----------DGQAQEE------CADKCKAIGATISEEDFSK-----DTSVSCSLQGENECLITFLITTDNEGKTIIHNIN----EKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYK 774          
BLAST of Integrin beta vs. Ensembl Mouse
Match: Itgb6 (integrin beta 6 [Source:MGI Symbol;Acc:MGI:96615])

HSP 1 Score: 344.354 bits (882), Expect = 1.892e-104
Identity = 256/810 (31.60%), Postives = 401/810 (49.51%), Query Frame = 3
Query:  114 ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR---IKRQSDD-DEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT---GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCES-GYTGDQCQNIKGDSSQRCSRDKDKVLT--NCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            A +C  C+   P C WC    F   + G G RC +   L+ +GCQ   IE   S I+   N+   + RQ +  D +Q+ P +    +RPG    +++  +   +YPVDLYYL DLS SM DDL T+  +  ++++E+ +LT   R+GFG FV+KPV PF+   P+ + NPC ++      C P F +KHIL LT +   F E  +    S N+D+PEGG DA++Q A C++ I W +++  +++F SD   H   D +LAG++ P    C L+ + +          +  S   +YP++G++   L +  + +IFA   E   LYE  A+ +P A VG+ +  S NI+ L+   Y+++ S+V +    D   ++L     C +   F  +  C    +     + + V    C K   ++I++  GL D   +++ + C+CD         +SS   NG G F CG CTC  G  G  CEC       ++     CK++     CSGRG C CG+C C LS Y    G YC+CD   C R      +CG  + G C C G C C++G+ GE C+C  +  +C   T+    LCSG G C CG C C + G +G  C        +RC    D   +  +C+ C   +           +G+   E      C DKC       S    +K     D S  C +  +  C I     T  E  T+   +     +K+CP   ++ MI++GV + I+++G+VLL IWK++V+  DR+E A ++ +   AKW+T  NP+++   +T KN  Y+
Sbjct:   28 AESCSDCLLTGPHCAWCSQENFTHLS-GAGERCDTPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEKPVSPFMKTTPEEITNPCSSIPYF---CLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE----------YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVTVSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCD--CQREIETNSSKCHNGNGSFQCGVCTCNPGHMGPHCECGEDMVSTDS-----CKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCDNFSCLR--HKGLLCG--DNGDCDC-GECVCRDGWTGEYCNCTTNRDSC---TSEDGVLCSGRGDCVCGKCVCRNPGASGPTC--------ERCPTCGDPCNSKRSCIECYLSA-----------DGQAQEE------CADKCKAIGATISEEDFSK-----DTSVSCSLQGENECLITFLITTDNEGKTIIHNIN----EKDCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYK 774          
BLAST of Integrin beta vs. UniProt/SwissProt
Match: sp|P05556|ITB1_HUMAN (Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2)

HSP 1 Score: 387.882 bits (995), Expect = 7.490e-120
Identity = 285/827 (34.46%), Postives = 426/827 (51.51%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGET-SVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC    IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT+    F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        N++  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I + + KC K ++ S  ++  G  +   +I++  C C+     S  I  SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C+    ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +    +  S  C   +  +C  Y TY     +    ++++      ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECE---CQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTSTCE---ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCTQECSYFNITKVESRDKLPQPVQPDPVSH-CKEKDVDDCWFYFTYS----VNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. UniProt/SwissProt
Match: sp|P09055|ITB1_MOUSE (Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 PE=1 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 8.316e-120
Identity = 292/831 (35.14%), Postives = 426/831 (51.26%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC +  F    +    RC  ++ L ++GCQ S IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT     F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L       NN      ++     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +    LP  D   I+ K  + CK+  N T +    C    I  E+Q++I +   KC   E+  I ++  G  +   ++++  C   KC+  S  I +SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C     ++  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +     D    C   +  +C  Y TY        +  ++ +     +CP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLE------NNVYTMSHYY-----DYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLP--DGVTINYK--SYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFIC---KCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGGN--GVCRCR-VCECYPNYTGSACDCSLDTGPC---LASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCAQECSHFNLTKVESREKLPQPVQV-DPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET----PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. UniProt/SwissProt
Match: sp|P49134|ITB1_RAT (Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=Itgb1 PE=2 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 5.321e-119
Identity = 296/836 (35.41%), Postives = 426/836 (50.96%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAI----LPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR-----YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTY----KTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC +  F    +    RC  ++ L ++GC  S IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT     F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L       NN      ++     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +    LP  D   I+ K  + CK+  N T +    C    I  E+Q++I +   KC   E+   L++   G  +   ++++  C   KC+  S  I +SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS  G C CG+C C         Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +    C     T+  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    SR KL +     D    C   +  +C  Y TY    K    ++ V           +CP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCHPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLE------NNVYTMSHYY-----DYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSGNSSNVIQLIIDAYNSLSSEVILENSKLP--DGVTINYK--SYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKESENQLKLNPLGFTEEVEVVLQFIC---KCNCQSHGIPASPKCHEGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRENTNEIYSGKFCECDNFNCDRS--NGLICGGN--GVCRCR-VCECYPNYTGSACDCSLDTVPC---VATNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCAQECSHFNLTKVESREKLPQPVQV-DPVTHCKEKDIDDCWFYFTYSVNSKGEAHVHVVE--------TPDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 798          
BLAST of Integrin beta vs. UniProt/SwissProt
Match: sp|P53713|ITB1_FELCA (Integrin beta-1 OS=Felis catus OX=9685 GN=ITGB1 PE=2 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 9.223e-119
Identity = 285/827 (34.46%), Postives = 421/827 (50.91%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVI-LQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC    IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC +     + C  PF YK++LSLT     F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        ND+  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I +   KC    + +I ++  G  +   +I++  C C+     +  I SSPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +   +C     T+  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    +R KL  Q    D    C   +  +C  Y TY        +  ++ +     ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I D RE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCVNSTFLQEGMPTSARCDDLEALKKKGCHPDDIENPRGSKDVKKNKNVTNRSKGTAEKLQPEDITQIQPQQLVLQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLLNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTS----EQNCTSPFSYKNVLSLTDKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENDVYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKNSEIIKIKPLGFTEEVEIILQFICECE---CQNEGIPSSPKCHEGNGSFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTTSCM---ATNGQICNGRGICECGACKCTDPKFQGPTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCAQECSHFNITKVENRDKL-PQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET----PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDTREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. UniProt/SwissProt
Match: sp|P53712|ITB1_BOVIN (Integrin beta-1 OS=Bos taurus OX=9913 GN=ITGB1 PE=1 SV=3)

HSP 1 Score: 384.8 bits (987), Expect = 9.718e-119
Identity = 285/827 (34.46%), Postives = 419/827 (50.67%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSD----DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKC-FKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY--SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++  P+CGWC ++ F    +    RC  ++ L ++GC  + IE  + S      K+ +NR K  ++    +D  Q++P      +R G P    L +K   +YP+DLYYL DLSYSMKDDL+ V S+   +  E+ R+T   R+GFG FV+K V P+I+  P  LRNPC N     + C  PF YK++LSLT     F E       SGNLDSPEGG DA++QVA C   I W  N  ++++F++D GFH AGDG+L G++ P   QC L        ND+  +  +     DYPS+  +   L+E  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + +   + CK+  N T +    C    I  E+Q++I +   KC  K   ++ ++  G  +   +I++  C C+        I  SPKC+ G G F CG+C C EG  G  CECS T E N  DM   C+K    E+CS       G+C C K   +   Y+G +CECD   C R+  +  +CGG   GVC C   C C   Y G  CDC +   +C      +  +C+G G C+CG C C      G T + CQ   G     C+  K+     C+ C           +   +GEK         C  +C+  N+    +R KL  Q    D    C   +  +C  Y TY           ++ +     ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCHPNDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLVLQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTN----EQNCTSPFSYKNVLSLTDKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHL-------ENDVYTMSHY----YDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITANKCPNKNSETIKIKPLGFTEEVEIILQFICECE---CQGEGIPGSPKCHDGNGTFECGACRCNEGRVGRHCECS-TDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRS--NGLICGG--NGVCKCR-VCECNPNYTGSACDCSLDTTSCM---AVNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLG----VCAEHKE-----CVQC-----------RAFNKGEK------KDTCAQECSHFNITKVENRDKL-PQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEATVHVVET----PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 797          
BLAST of Integrin beta vs. TrEMBL
Match: A0A1P8CUU0 (Integrin beta (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 582/582 (100.00%), Postives = 582/582 (100.00%), Query Frame = 3
Query:  231 MERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSR 1976
            MERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVCSGRGRCKCGKCHCSLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSR
Sbjct:    1 MERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVCSGRGRCKCGKCHCSLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSR 582          
BLAST of Integrin beta vs. TrEMBL
Match: E7BBC0 (Integrin beta OS=Schistosoma mansoni OX=6183 GN=beta-Int1 PE=2 SV=1)

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 415/834 (49.76%), Postives = 553/834 (66.31%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSN---STAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECST-TTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVV----------DDVPKYKLEGE----KLPELSNSSM-------------CHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            C +A +C  CM   P+C WC    F+D   GPGFRC    VL+ RGC +S IE ++S +      + + S  ++IQL P +QS  +RPG  + +  T+++I +YPVDLY+LTDLSY+M DDL+TVS +T  I   +  +TK+L+MGFG FVDKPVFPF+ P P+ LRNPC+N+   N  CDPPFLYKHILSLT NF +F+E+T+   PSGNLDSPEGG+DALLQVA C + I W + ARKIVLF SDGGFH+AGDGR+AGLI PPP  C+L  QADRFN+ LKYLGWHNS +TDYPSVGE+A VL E  I+VIFA + +   LY KLAEFLPSAAVG+  DSS+NIV LL++NY KI++K  ++  YD   ++++V +KC DE  F+ KT C  +P+ G+I Y+I +  K+CF+G   V L++  L+D A L +++AC+C  C      S+    S +C  +G   CG C CQ G++GDFCECS+  + + +A M  QC +    E CSGRGRC CGKC C+L+RY G +CECD  GCKRA+DDN+VCGG  RG C CNG C CK GY G+RCDC+ S K C +P N S P CSG G CDCG CFC SGYTG  C  I+G  S  C+   D+ +  C+LCL +SLV           D++ K   E E    K  +    SM             C   CN + VD SR+KL +    +D S +C+IY + NCR++ TY+ ++ IY  RK+ ++   K EC  T +++ I++GVI  IV+ G++LLLI+K+V+TIDDRRE A +++Q +N +WE  ENPIF+ P T V NP ++
Sbjct:   31 CGRAKSCSECMGIRPACSWCSADEFDDTKEGPGFRCAPSSVLLARGCPQSSIEDVESVLLDHGVPLDQASLTEDIQLTPRSQSVKVRPGGTMMVNFTFQSISDYPVDLYFLTDLSYTMIDDLETVSRLTNDIVLTMRNVTKKLQMGFGAFVDKPVFPFVVPTPEYLRNPCLNVGTKNLHCDPPFLYKHILSLTDNFEEFREKTKVARPSGNLDSPEGGMDALLQVARCSEAIGWRAGARKIVLFASDGGFHLAGDGRIAGLILPPPTTCQLTYQADRFNSSLKYLGWHNSDQTDYPSVGEIAQVLTEADISVIFAVDSKLHGLYTKLAEFLPSAAVGILTDSSTNIVRLLRDNYDKIVNKAELMATYDADYLEVQVFSKCNDENEFSKKTVCNDHPVGGKIGYQISIKAKRCFEGVKKVTLKMVALEDQAVLGVQTACSCPSCEKMPMPSSLTPFSARCQLRGHLHCGECKCQSGYSGDFCECSSEASAEGDAAMLAQCTEYGVKEPCSGRGRCVCGKCKCNLARYEGTFCECDRHGCKRASDDNQVCGGPQRGTCQCNGTCECKPGYTGDRCDCMESEKQCIDPNNPSGPKCSGRGVCDCGQCFCNSGYTGHLCNEIQGGESALCT---DRDVEKCVLCLRDSLVKSFDLDEKLKNDEMTKTDSESEDESLKFNQRQPISMIYSSKEYALAATQCESSCNGTVVDTSRVKLVEASEQKDDSNLCIIYTEDNCRVFFTYRYSDAIYVNRKVDLNIIRKSECTKTINILYIVLGVIAAIVLGGLILLLIYKLVITIDDRRELANFKQQGENMRWEMAENPIFESPTTNVLNPTFE 861          
BLAST of Integrin beta vs. TrEMBL
Match: A0A183P247 (Integrin beta OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS8434 PE=3 SV=1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 413/834 (49.52%), Postives = 550/834 (65.95%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSN---STAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECST-TTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVV----------DDVPKYKLEGEKLPELSN-----------------SSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            C +A +C  CM   P+C WC    F+D   GPGFRC    VL+ RGC +S IE ++S        + + S  ++IQL P +QS  +RPG  + +  T+++I +YPVDLY+LTDLSY+M DDL+TVS +T  I   +  +TK+L+MGFG FVDKPVFPF+ P P+ LRNPC+N+   N  CDPPFLYKHILSLT NF +F+E+T+   PSGNLDSPEGG+DALLQVA C + I W + ARKIVLF SDGGFH+AGDGR+AGLI PPP  C+L  QADRFN+ LKYLGWHNS +TDYPSVGE+A VL E  I+VIFA + +   LY KLAEFLPSAAVG+  DSS+NIV LL++NY KI++K  ++  YD   ++++V +KC DE  F+ KT C  +P+ G+I Y+I +  K+CF+G   V L++  L+D A L +++AC+C  C      S+    S +C  +G   CG C CQ G++GDFCECS   + + +A M  QC +    E CSGRGRC CGKC C+L+RY G +CECD  GCKRA+DDN+VCGG  RG C CNG C CK GY G+RCDC+ S K C +P N S P CSG G CDCG CFC SGYTG  C  I+G  S  C+   D+ +  C+LCL +SLV           D++ K   E E      N                 ++ C   CN + VD SR+KL +    +D S +C+IY + NCR++ TY+ ++ IY  RK+ ++   K EC  T +++ I++GVI  IV+ G++LLLI+K+V+TIDDRRE A +++Q +N +WE  ENPIF+ P T V NP ++
Sbjct:   31 CGRAKSCNECMGIRPACSWCSADEFDDTKEGPGFRCAPSSVLLARGCPQSSIEDVESVFLDHGVPLDQASSAEDIQLTPRSQSIKVRPGGTMMVNFTFQSISDYPVDLYFLTDLSYTMIDDLETVSRLTNDIVLTMRNVTKKLQMGFGAFVDKPVFPFVVPTPEYLRNPCLNVGTKNLHCDPPFLYKHILSLTDNFEEFREKTKVARPSGNLDSPEGGMDALLQVARCSEAIGWRAGARKIVLFASDGGFHLAGDGRIAGLILPPPTTCQLTYQADRFNSSLKYLGWHNSDQTDYPSVGEIAQVLTEADISVIFAVDSKLHGLYTKLAEFLPSAAVGILTDSSTNIVRLLRDNYDKIVNKAELMATYDADYLEVQVFSKCNDENEFSKKTVCNDHPVGGKIGYQISIKAKRCFEGVKKVTLKMVALEDQAVLGVQTACSCPSCEKMPMPSSLTPFSARCQLRGHLHCGECKCQSGYSGDFCECSAEASAEGDAAMLAQCTEYGVKEPCSGRGRCVCGKCKCNLARYEGTFCECDRHGCKRASDDNQVCGGPQRGTCQCNGTCECKPGYTGDRCDCMESEKQCIDPNNPSGPKCSGRGVCDCGQCFCNSGYTGHLCNEIQGGESALCT---DRDVEKCVLCLRDSLVKSFDMDEKLKNDEITKTDSESEDESSKFNQRQPMSTIYSSKEYALAATQCESSCNGTVVDTSRVKLVEVSEQKDDSNLCIIYTEDNCRVFFTYRYSDAIYVNRKVDLNIIRKSECTKTINILYIVLGVIAAIVLGGLILLLIYKLVITIDDRRELANFKQQGENMRWEMAENPIFESPTTNVLNPTFE 861          
BLAST of Integrin beta vs. TrEMBL
Match: A0A430Q9E8 (Integrin beta OS=Schistosoma bovis OX=6184 GN=DC041_0012283 PE=3 SV=1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 412/834 (49.40%), Postives = 549/834 (65.83%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSP---KCNGKGKFFCGSCTCQEGFTGDFCECST-TTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVV----------DDVPKYKLEGEKLPELSN-----------------SSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            C +A +C  CM   P+C WC    F+D   GPGFRC    VL+ RGC +S IE ++S        + + S  ++IQL P +QS  +RPG  + +  T+++I +YPVDLY+LTDLSY+M DDL+TVS +T  I   +  +TK+L+MGFG FVDKPVFPF+ P P+ LRNPC+N+   N  CDPPFLYKHILSLT NF +F+E+T+   PSGNLDSPEGG+DALLQVA C + I W + ARKIVLF SDGGFH+AGDGR+AGLI PPP  C+L  QADRFN+ LKYLGWHNS +TDYPSVGE+A VL E  I+VIFA + +   LY KLAEFLPSAAVG+  DSS+NIV LL++NY KI++K  ++  YD   ++++V +KC DE  F+ KT C  +P+ G+I Y+I +  K+CF+G   V L++  L+D A L +++AC+C  C         +P   +C  +G   CG C CQ G++GDFCECS   + + +A M  QC +    E CSGRGRC CGKC C+L+RY G +CECD  GCKRA+DDN+VCGG  RG C CNG C CK GY G+RCDC+ S K C +P N S P CSG G CDCG CFC SGYTG  C  I+G  S  C+   D+ +  C+LCL +SLV           D++ K   E E      N                 ++ C   CN + VD SR+KL +    +D S +C+IY + NCR++ TY+ ++ IY  RK+ ++   K EC  T +++ I++GVI  IV+ G++LLLI+K+V+TIDDRRE A +++Q +N +WE  ENPIF+ P T V NP ++
Sbjct:   31 CGRAKSCSECMGIRPACSWCSADEFDDTKEGPGFRCAPSSVLLARGCPQSSIEDVESVFLDHGVPLDQASLAEDIQLTPRSQSIKVRPGGTMMVNFTFQSISDYPVDLYFLTDLSYTMIDDLETVSRLTNDIVLTMRNVTKKLQMGFGAFVDKPVFPFVVPTPEYLRNPCLNVGTKNLHCDPPFLYKHILSLTDNFEEFREKTKVARPSGNLDSPEGGMDALLQVARCSEAIGWRAGARKIVLFASDGGFHLAGDGRIAGLILPPPTTCQLTYQADRFNSSLKYLGWHNSDQTDYPSVGEIAQVLTEADISVIFAVDSKLHGLYTKLAEFLPSAAVGILTDSSTNIVRLLRDNYDKIVNKAELMATYDADYLEVQVFSKCNDENEFSKKTVCNDHPVGGKIGYQISIKAKRCFEGVKKVTLKMVALEDQAVLGVQTACSCPSCEKMPMPNSLTPFSARCQLRGHLHCGECKCQSGYSGDFCECSAEASAEGDAAMLAQCTEYGVKEPCSGRGRCVCGKCKCNLARYEGTFCECDRHGCKRASDDNQVCGGPQRGTCQCNGTCECKPGYTGDRCDCMESEKQCIDPNNPSGPKCSGRGVCDCGQCFCNSGYTGHLCNEIQGGESALCT---DRDVEKCVLCLRDSLVKSFDMDEKLKNDEITKTDSESEDESLKFNQRQPMSTIYSSKEYALAATQCESSCNGTVVDTSRVKLVEVSEQKDDSNLCIIYTEDNCRVFFTYRYSDAIYVNRKVDLNIIRKSECTKTINILYIVLGVIAAIVLGGLILLLIYKLVITIDDRRELANFKQQGENMRWEMAENPIFESPTTNVLNPTFE 861          
BLAST of Integrin beta vs. TrEMBL
Match: A0A183K0Y3 (Integrin beta OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS8646 PE=3 SV=1)

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 412/834 (49.40%), Postives = 549/834 (65.83%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSP---KCNGKGKFFCGSCTCQEGFTGDFCECST-TTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVV----------DDVPKYKLEGEKLPELSN-----------------SSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            C +A +C  CM   P+C WC    F+D   GPGFRC    VL+ RGC +S IE ++S        + + S  ++IQL P +QS  +RPG  + +  T+++I +YPVDLY+LTDLSY+M DDL+TVS +T  I   +  +TK+L+MGFG FVDKPVFPF+ P P+ LRNPC+N+   N  CDPPFLYKHILSLT NF +F+E+T+   PSGNLDSPEGG+DALLQVA C + I W + ARKIVLF SDGGFH+AGDGR+AGLI PPP  C+L  QADRFN+ LKYLGWHNS +TDYPSVGE+A VL E  I+VIFA + +   LY KLAEFLPSAAVG+  DSS+NIV LL++NY KI++K  ++  YD   ++++V +KC DE  F+ KT C  +P+ G+I Y+I +  K+CF+G   V L++  L+D A L +++AC+C  C         +P   +C  +G   CG C CQ G++GDFCECS   + + +A M  QC +    E CSGRGRC CGKC C+L+RY G +CECD  GCKRA+DDN+VCGG  RG C CNG C CK GY G+RCDC+ S K C +P N S P CSG G CDCG CFC SGYTG  C  I+G  S  C+   D+ +  C+LCL +SLV           D++ K   E E      N                 ++ C   CN + VD SR+KL +    +D S +C+IY + NCR++ TY+ ++ IY  RK+ ++   K EC  T +++ I++GVI  IV+ G++LLLI+K+V+TIDDRRE A +++Q +N +WE  ENPIF+ P T V NP ++
Sbjct:   31 CGRAKSCSECMGIRPACSWCSADEFDDTKEGPGFRCAPSSVLLARGCPQSSIEDVESVFLDHGVPLDQASLAEDIQLTPRSQSIKVRPGGTMMVNFTFQSISDYPVDLYFLTDLSYTMIDDLETVSRLTNDIVLTMRNVTKKLQMGFGAFVDKPVFPFVVPTPEYLRNPCLNVGTKNLHCDPPFLYKHILSLTDNFEEFREKTKVARPSGNLDSPEGGMDALLQVARCSEAIGWRAGARKIVLFASDGGFHLAGDGRIAGLILPPPTTCQLTYQADRFNSSLKYLGWHNSDQTDYPSVGEIAQVLTEADISVIFAVDSKLHGLYTKLAEFLPSAAVGILTDSSTNIVRLLRDNYDKIVNKAELMATYDADYLEVQVFSKCNDENEFSKKTVCNDHPVGGKIGYQISIKAKRCFEGVKKVTLKMVALEDQAVLGVQTACSCPSCEKMPMPNSLTPFSARCQLRGHLHCGECKCQSGYSGDFCECSAEASAEGDAAMLAQCTEYGVKEPCSGRGRCVCGKCKCNLARYEGTFCECDRHGCKRASDDNQVCGGPQRGTCQCNGTCECKPGYTGDRCDCMESEKQCIDPNNPSGPKCSGRGVCDCGQCFCNSGYTGHLCNEIQGGESALCT---DRDVEKCVLCLRDSLVKSFDMDEKLKNDEITKTDSESEDESLKFNQRQPMSTIYSSKEYALAATQCESSCNGTVVDTSRVKLVEVSEQKDDSNLCIIYTEDNCRVFFTYRYSDAIYVNRKVDLNIIRKSECTKTINILYIVLGVIAAIVLGGLILLLIYKLVITIDDRRELANFKQQGENMRWEMAENPIFESPTTNVLNPTFE 861          
BLAST of Integrin beta vs. Ensembl Cavefish
Match: itgb2 (integrin beta-2-like [Source:NCBI gene;Acc:103028506])

HSP 1 Score: 365.155 bits (936), Expect = 5.690e-113
Identity = 227/624 (36.38%), Postives = 332/624 (53.21%), Query Frame = 3
Query:   96 DEECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR--IKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVL--TKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXX---XXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQ 1940
            +EEC K   T+C +C++  P C WC D  F         RC +   L++RGC ++ +    SS++   N+     Q+  D +Q++P   +  +RPG P   +L +K    YPVDLYYL DLSYSM DDLK V ++  ++   L ++T   R+GFG FVDK + PF + N + L+ PC    P   +C+P F YKH+LSLT N   F+        SGNLD+PEG LDA++QV  C+  I W ++ R +VL T D GFH+AGDG+LAG+++P    C+L    D+ N   K   W      DYPSVG++A  L EK I  IFA   +   +Y +L++ +P + VGV    SSN+V+L+ + Y K+ S + +     DTL +   +  T C+ +++ +D+  C    I  E+++ + V   KC   +T     IG L  N  L +K    C +C  ++   ++S  CN +G   CG+C+C   F G  CECS    ++EA +K QC+K    E                    S Y G +CECD   C++    NK+CGG   G C C G C CK+G++G  C C  S + C   T     +C G G C+C  C CE GY G +C+
Sbjct:    8 EEECVKISVTSCDACIKSGPGCVWCQDVNFTKPGELDTVRCDTRSALLKRGCPETKLINPPSSMQFIKNKPLSDGQAKKDLVQVQPQEITLDLRPGKPYSFDLKFKRAQGYPVDLYYLMDLSYSMNDDLKNVKTLGIELLNRLKQITGSARIGFGSFVDKTLLPFTDTNEEKLKKPC---PPEESECEPAFGYKHVLSLTDNGEQFKNMVSQQRISGNLDAPEGSLDAIMQVVTCENEIGWGNSTRLLVLATDD-GFHMAGDGKLAGILEPNQESCQL----DKKNMYSKSNLW------DYPSVGQIARKLEEKNIQPIFAVTQKVADVYRELSKLIPKSDVGVLSGDSSNVVNLIVDAYNKLSSNIIVT---HDTLPEHVSVTYTTCQGQSS-SDRGICNNVNIGQEVKFTVTVKASKCIDLKT---FTIGPLGFNEKLTVKVRTRC-QCECDNIRNNASEHCNRQGSVVCGTCSCNPQFLGQRCECS-VGHKDEAALKAQCRKDNGTECEGRGDCECGVCKCHLTEGGSSYYGPHCECDDEHCEKY--QNKLCGG--NGECKC-GRCKCKDGFEGTACQCQKSTEGCIART---GAVCHGRGKCECNQCVCEGGYKGLKCE 600          
BLAST of Integrin beta vs. Ensembl Cavefish
Match: itgb2 (integrin beta-2-like [Source:NCBI gene;Acc:103028506])

HSP 1 Score: 365.155 bits (936), Expect = 7.478e-113
Identity = 227/624 (36.38%), Postives = 332/624 (53.21%), Query Frame = 3
Query:   96 DEECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR--IKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVL--TKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXX---XXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQ 1940
            +EEC K   T+C +C++  P C WC D  F         RC +   L++RGC ++ +    SS++   N+     Q+  D +Q++P   +  +RPG P   +L +K    YPVDLYYL DLSYSM DDLK V ++  ++   L ++T   R+GFG FVDK + PF + N + L+ PC    P   +C+P F YKH+LSLT N   F+        SGNLD+PEG LDA++QV  C+  I W ++ R +VL T D GFH+AGDG+LAG+++P    C+L    D+ N   K   W      DYPSVG++A  L EK I  IFA   +   +Y +L++ +P + VGV    SSN+V+L+ + Y K+ S + +     DTL +   +  T C+ +++ +D+  C    I  E+++ + V   KC   +T     IG L  N  L +K    C +C  ++   ++S  CN +G   CG+C+C   F G  CECS    ++EA +K QC+K    E                    S Y G +CECD   C++    NK+CGG   G C C G C CK+G++G  C C  S + C   T     +C G G C+C  C CE GY G +C+
Sbjct:   22 EEECVKISVTSCDACIKSGPGCVWCQDVNFTKPGELDTVRCDTRSALLKRGCPETKLINPPSSMQFIKNKPLSDGQAKKDLVQVQPQEITLDLRPGKPYSFDLKFKRAQGYPVDLYYLMDLSYSMNDDLKNVKTLGIELLNRLKQITGSARIGFGSFVDKTLLPFTDTNEEKLKKPC---PPEESECEPAFGYKHVLSLTDNGEQFKNMVSQQRISGNLDAPEGSLDAIMQVVTCENEIGWGNSTRLLVLATDD-GFHMAGDGKLAGILEPNQESCQL----DKKNMYSKSNLW------DYPSVGQIARKLEEKNIQPIFAVTQKVADVYRELSKLIPKSDVGVLSGDSSNVVNLIVDAYNKLSSNIIVT---HDTLPEHVSVTYTTCQGQSS-SDRGICNNVNIGQEVKFTVTVKASKCIDLKT---FTIGPLGFNEKLTVKVRTRC-QCECDNIRNNASEHCNRQGSVVCGTCSCNPQFLGQRCECS-VGHKDEAALKAQCRKDNGTECEGRGDCECGVCKCHLTEGGSSYYGPHCECDDEHCEKY--QNKLCGG--NGECKC-GRCKCKDGFEGTACQCQKSTEGCIART---GAVCHGRGKCECNQCVCEGGYKGLKCE 614          
BLAST of Integrin beta vs. Ensembl Cavefish
Match: itgb2 (integrin beta-2-like [Source:NCBI gene;Acc:103028506])

HSP 1 Score: 365.155 bits (936), Expect = 1.397e-112
Identity = 227/624 (36.38%), Postives = 332/624 (53.21%), Query Frame = 3
Query:   96 DEECSK--ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNR--IKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVL--TKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXX---XXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQ 1940
            +EEC K   T+C +C++  P C WC D  F         RC +   L++RGC ++ +    SS++   N+     Q+  D +Q++P   +  +RPG P   +L +K    YPVDLYYL DLSYSM DDLK V ++  ++   L ++T   R+GFG FVDK + PF + N + L+ PC    P   +C+P F YKH+LSLT N   F+        SGNLD+PEG LDA++QV  C+  I W ++ R +VL T D GFH+AGDG+LAG+++P    C+L    D+ N   K   W      DYPSVG++A  L EK I  IFA   +   +Y +L++ +P + VGV    SSN+V+L+ + Y K+ S + +     DTL +   +  T C+ +++ +D+  C    I  E+++ + V   KC   +T     IG L  N  L +K    C +C  ++   ++S  CN +G   CG+C+C   F G  CECS    ++EA +K QC+K    E                    S Y G +CECD   C++    NK+CGG   G C C G C CK+G++G  C C  S + C   T     +C G G C+C  C CE GY G +C+
Sbjct:    8 EEECVKISVTSCDACIKSGPGCVWCQDVNFTKPGELDTVRCDTRSALLKRGCPETKLINPPSSMQFIKNKPLSDGQAKKDLVQVQPQEITLDLRPGKPYSFDLKFKRAQGYPVDLYYLMDLSYSMNDDLKNVKTLGIELLNRLKQITGSARIGFGSFVDKTLLPFTDTNEEKLKKPC---PPEESECEPAFGYKHVLSLTDNGEQFKNMVSQQRISGNLDAPEGSLDAIMQVVTCENEIGWGNSTRLLVLATDD-GFHMAGDGKLAGILEPNQESCQL----DKKNMYSKSNLW------DYPSVGQIARKLEEKNIQPIFAVTQKVADVYRELSKLIPKSDVGVLSGDSSNVVNLIVDAYNKLSSNIIVT---HDTLPEHVSVTYTTCQGQSS-SDRGICNNVNIGQEVKFTVTVKASKCIDLKT---FTIGPLGFNEKLTVKVRTRC-QCECDNIRNNASEHCNRQGSVVCGTCSCNPQFLGQRCECS-VGHKDEAALKAQCRKDNGTECEGRGDCECGVCKCHLTEGGSSYYGPHCECDDEHCEKY--QNKLCGG--NGECKC-GRCKCKDGFEGTACQCQKSTEGCIART---GAVCHGRGKCECNQCVCEGGYKGLKCE 600          
BLAST of Integrin beta vs. Ensembl Cavefish
Match: itgb1a (integrin subunit beta 1 [Source:NCBI gene;Acc:103043585])

HSP 1 Score: 363.614 bits (932), Expect = 9.789e-112
Identity = 280/828 (33.82%), Postives = 411/828 (49.64%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRI--------KRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFT--DKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXX-----XXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCN--TSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAE--EIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EC KA   +C  C++    CGWC D +F  +      RC  ++ L +RGC  + IE  + S ++  N+         ++   +D  Q++P   S S+R G P  I+L +K   +YP+DLYYL DLSYSMKDDL+ V ++   +  E+ ++T   R+GFG FV+K V P+I+  P  L NPC      ++ C  PF YK++L LTSN   F         SGNLDSPEGG DA++QVA C +HI W  N  ++++F++D GFH AGDG+L G++ P   +C L        N++  +  +     DYPS+  +   L++  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   + CK+       D   C    I  E+ + I +  + C K   S  L+I  L     + IK +  CD C      I +S  C NG G F CG+C C +G  G  CEC    E +  D+   C+K    ++CS  G C      C K       Y+G+YCECD   C R+  +NK+CGG  R  C     C C   Y G  CDC +    C    N    +C+G G+C+CG C C +  + G  C+ I       C+  K      C+ C           +    GEK         C  +CN  T      R KL +          C   +  +C  Y TY      E++ V  L        ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   26 ECIKANAESCGDCIQVGAKCGWCTDISFLKQGEPTSARCDELESLKKRGCVAAKIENPRGSQRTLRNKPVTNRKKGGEKLKPEDITQIQPQKLSVSLRSGEPQKIDLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMLEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLLNPCTG----DQNCTSPFSYKNVLKLTSNGQQFNTLVGQQQISGNLDSPEGGFDAIMQVAVCGEHIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVINLIIDAYNSLSSEVILENSKLPEGVTITYQSHCKNGVVSVGEDGRKCSNISIGDEVYFSINITAQGCPKQGKSESLKIRPLGFTEEVEIKLSFICD-CECQKDGIPNSDLCNNGNGTFECGACRCNKGRIGRECECR-KDEVSSEDLDKNCRKDNGTDLCSNNGECVCGKCECKKRENPEEYYSGEYCECDNFNCDRS--NNKLCGGHGRCECRV---CICDANYTGSACDCSLDTSTCLASNNQ---ICNGRGNCECGACRCTDPKFQGPTCE-ICPTCPGVCTEHKA-----CVQC-----------RAFGTGEK------KDTCDRECNYFTLTKVKDRDKLPQPVQAFPLMH-CKERDANDCWFYYTYAVNNNTEVHVVETL--------ECPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 795          
BLAST of Integrin beta vs. Ensembl Cavefish
Match: itgb1a (integrin subunit beta 1 [Source:NCBI gene;Acc:103043585])

HSP 1 Score: 359.762 bits (922), Expect = 3.087e-110
Identity = 276/826 (33.41%), Postives = 409/826 (49.52%), Query Frame = 3
Query:  102 ECSKAT--NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRI--------KRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFT--DKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXX-----XXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCN--TSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAE--EIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            EC KA   +C  C++    CGWC D +F  +      RC  ++ L +RGC  + IE  + S ++  N+         ++   +D  Q++P   S S+R G P  I+L +K   +YP+DLYYL DLSYSMKDDL+ V ++   +  E+ ++T   R+GFG FV+K V P+I+  P  L NPC      ++ C  PF YK++L LTSN   F         SGNLDSPEGG DA++QVA C +HI W  N  ++++F++D GFH AGDG+L G++ P   +C L        N++  +  +     DYPS+  +   L++  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   + CK+       D   C    I  E+ + I +  + C K   S  L+I  L     + IK +  CD C      I +S  C NG G F CG+C C +G  G  CEC    E +  D+   C+K    ++CS  G C      C K       Y+G+YCECD   C R+  +NK+CGG  R  C     C C   Y G  CDC +    C    N    +C+G G+C+CG C C +  + G  C+ I       C+  K      C+ C           +    GEK         C  +CN  T      R KL +          C   +  +C  Y TY      E++ V  L        ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T+ENPI+K P+   +NP Y
Sbjct:   26 ECIKANAESCGDCIQVGAKCGWCTDISFLKQGEPTSARCDELESLKKRGCVAAKIENPRGSQRTLRNKPVTNRKKGGEKLKPEDITQIQPQKLSVSLRSGEPQKIDLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMLEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLLNPCTG----DQNCTSPFSYKNVLKLTSNGQQFNTLVGQQQISGNLDSPEGGFDAIMQVAVCGEHIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHL-------ENNMYTMSHY----YDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVINLIIDAYNSLSSEVILENSKLPEGVTITYQSHCKNGVVSVGEDGRKCSNISIGDEVYFSINITAQGCPKQGKSESLKIRPLGFTEEVEIKLSFICD-CECQKDGIPNSDLCNNGNGTFECGACRCNKGRIGRECECR-KDEVSSEDLDKNCRKDNGTDLCSNNGECVCGKCECKKRENPEEYYSGEYCECDNFNCDRS--NNKLCGGHGRCECRV---CICDANYTGSACDCSLDTSTCLASNNQ---ICNGRGNCECGACRCTDPKFQGPTCE-ICPTCPGVCTEHKA-----CVQC-----------RAFGTGEK------KDTCDRECNYFTLTKVKDRDKLPQPVQAFPLMH-CKERDANDCWFYYTYAVNNNTEVHVVETL--------ECPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINKFQNPNY 793          
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Match: ITGB1 (integrin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6153])

HSP 1 Score: 353.214 bits (905), Expect = 1.605e-108
Identity = 270/823 (32.81%), Postives = 394/823 (47.87%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAA-FEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSI-----KSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFT--DKTSCLKNPIDGEIQYKIKVDTKKC-FKGETS-VILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSR------YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLC--LYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++    C WC  +  F +       RC  ++ L ERGC     E  + S      +  S R ++ S D   Q+ P   +  +R G P    +T++   +YP+DLYYL DLSYSMKDDL+ V  +  ++   +  +T   R+GFG FVDK V PFI+  P  LRNPC   E   E C  PF Y+++L LTSN + F E       SGNLDSPEGGLDA++QVA C+ +I W  N  ++++F++D GFH AGDG+L G++ P    C L+ +           G+  S   DYPSV ++   L +K I  IFA N E   +Y  L+E +P +AVGV   +SSN++ L+ + Y  + S+V +        + +     CK     T     +C    I  E+ + I V   +C  +GE + + ++  G  +   + ++  C C  C S  TA   SP+C+ G G+  CG+C C EG  G  CECS   E N  D++  CK+     V                 R        G  CECD   C RA    K+CGG   GVC C G C C   + G  CDC +    C+        +C+G G+C+CG C C E  Y G  C+ +     + C   KD     C+ C         +   +  L+   +PEL+                 +I   KQ   +D            C  + T+  +    +V       Q K+ECP   +++ II GV+ GIV++G+ LLLIWK++ +I DRRE A ++++   AKW+T         VTTV NP Y G
Sbjct:   33 ANAKSCGECIQTGSRCSWCTKSVNFTEVGEPNSARCDYVENLRERGCGAERTENPRGSQALLLDRPLSERGQKLSPDHITQVAPQRLTLRLRSGEPQVFNVTFRRAEDYPIDLYYLMDLSYSMKDDLENVKKLGTELQRRMKDVTSDFRIGFGSFVDKTVMPFISTTPAKLRNPCGTRE---EVCTSPFSYRNVLPLTSNGSLFNELVSLQKISGNLDSPEGGLDAMMQVAACEDNIRWR-NVTRLLVFSTDAGFHFAGDGKLGGIVIPNDGHCHLDREG----------GYTKSDVYDYPSVAQLVQKLGDKNIQPIFAVNNEFHDVYRSLSELIPKSAVGVLSSNSSNVIQLIIDAYNALSSEVILENTKVPEGVHVAYTAHCKHGETRTGDGGRACSNIQIGDEVTFSISVMATRCPNEGEDARLTIRPLGFNEKVEVTLQFVCEC-ACHSLGTA--DSPECSQGNGRLECGACRCNEGRIGRLCECS-KDEVNSEDIQATCKRDNSSTVVCSGRGDCVCGECVCHKRDNANEHVFGTLCECDDFSCDRAA--GKICGGN--GVCDC-GHCVCFPNFTGNACDCALGTHGCE---GRGGQICNGRGTCECGKCRCSEPRYQGATCE-LCPTCPEACEEHKD-----CVQCAAFANGPRKETCEECGLKVRVVPELTQPGA-----------VQQIVHCKQKDDDD------------CWFFFTFTGSGSNASVE-----VQEKRECPAEPNVLAIIAGVVAGIVLIGLALLLIWKLLTSIHDRREFAKFEKEKLTAKWDTVPALHSSSAVTTVVNPKYGG 795          
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Match: itgb3b (integrin beta 3b [Source:ZFIN;Acc:ZDB-GENE-071207-2])

HSP 1 Score: 339.732 bits (870), Expect = 1.306e-103
Identity = 263/815 (32.27%), Postives = 398/815 (48.83%), Query Frame = 3
Query:  111 KATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIK-SQSNRIK---RQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFIN--PNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYT---GDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLN-CRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
             A  C+ C+   P C WC    +   N     RC  +  L+E GC +  +E   S ++  QSN +      SD    QL P   + ++  G P   +L  + + +YPVDLYYL DLS SM+DDL T+ ++   +S E+ +LT   R+GFG F+DKPV PF+    +P+  +NPC         C   + Y H+L LT+    F E  Q    S N D+PEGG+DA+LQ   C++ I W   A  +++FT+D   H A DGRLAG+++P    C L+        D            DYPS+  V+  L+E  IN+IFA   E K +Y    E +P   V V   +S+NI+ L+  +YK + SKV +        + +     C+D      +  C    +     + I V+ + C       +L+I   G KD   + +  +C    C+   +A  +S +CN +GK  CG C CQEG  G  CECS     + +        T D  VC GRG C CG C C  S Y    G  CECD   C R  D  ++CGG   G C C G C C   + G+ C+C     +C+   ++   LCSG G C CG C C  +G +GD C        +RC       LT   +C   SL    +P+    G++L      +   +    + + ++ I L   ++  D S I   Y   N C +  TY   E+ +    + +   +   CP   +M+ +I+GV  GI+++G+ +LLIWK+++++ DRRE A ++E+  +A+W++ +NP++K  VTT KN  Y+G
Sbjct:   20 HAHLCRECLLLHPDCAWCAMKEYPSGNS----RCDLLANLVENGCPQESLEKSSSHVRVEQSNPLSDTGSGSDKQITQLTPQKITLTMMTGAPAKFQLKVRQVEDYPVDLYYLMDLSMSMRDDLDTIRNLGTDLSREMAKLTSNFRLGFGSFIDKPVSPFVQMFTDPEHAKNPCQLRTKPPFSCPSTYGYHHVLPLTNEVNKFNEEVQKQEVSPNRDAPEGGMDAILQATVCKEQIGWRREASHLLVFTTDDHSHFALDGRLAGIVQPSDGLCHLDSSNVYVMTD----------SMDYPSIALVSEKLSENNINLIFAVTKEFKEIYTNYTELIPGTTVEVLTANSNNIIQLIVSSYKSLRSKVELEVWDQPEELSVSFSAICQDGNPQPGQKKCTDLNVGDTASFDITVEARGCPSQPVERMLKIKPVGFKDALEVRVLLSCG---CACEKSATSNSTECNEQGKSECGVCLCQEGRLGSTCECSAEGPVDGSS-GGSANATGDQPVCGGRGECVCGVCVCYTSEYGKIYGKQCECDSFSCGRHRD--QLCGG--HGDCNC-GECRCHVDWSGDLCNCTTRMDSCE---SSDGLLCSGRGDCTCGRCMCTTAGSSGDTC--------ERC-------LTCTDVCTTRSLCCVALPRL---GKRL------NWVQENVYNNLLSFNWIMLLVSFTGNDSSAISCSYKDENDCDVQFTY--MEDTFGKSSIAVLNHLV--CPAGPNMLAVILGVAAGILLIGLAMLLIWKLLISMHDRREFARFEEEKLHARWDSGQNPLYKNTVTTFKNVAYKG 780          
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Match: ITGB1 (integrin subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:6153])

HSP 1 Score: 318.931 bits (816), Expect = 5.057e-96
Identity = 245/807 (30.36%), Postives = 382/807 (47.34%), Query Frame = 3
Query:  159 WCFDAAFEDRNVGPG----FRCGSIKVLMERGCQKSLIEFMKSSIK-----SQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLP----ELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTY---KTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            WC    F     GPG     RC     L  R C  + IE     +K       +NR  +    D  Q+ P     ++R G P +I+L ++   +YP+DLYYL DLSYSMKDDL+ V  +  ++ + +  +T    +GFG FVDK V P+I+  P  L+NPC N +   + C  PF YK++LSLTS    F         SGNLDSPEGG DA++Q A C   I W +N R +++F++D GFH AGDG+L G++ P   +C L+ +     +D            DYPSV ++   L E  I  IFA   E   +Y++L+  +P +AVGV   +SSN++ L+ + Y  + S++ +        +  +    CKD   F  +    C    I  E+Q+ I+V   KC     +  ++I   G ++  T++++  C   +C  +++ + +S +C+ G G   CG+C C EG  G  CEC  T E N  D++  CK+     V                                       VC G  RG C+C G C C   YK E         + + P+ ++AP      SC   +     G              +R +   + V ++C       LV     + +  G+ L     +   +    + C+    +  +++  ++  + + +  C + N+ +C  Y  +   K+  E+Y         Q K ECP+  ++I II GV+ GIV++G+ LLLIWK+++ I DRRE A +++   NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   46 WCNRLDF----TGPGESNSARCDYADNLERRKCPPTSIESPTGKVKILKDKKLTNRSSKLPAKDITQIAPQLIELTLRSGQPQNIDLRFRRAADYPIDLYYLMDLSYSMKDDLENVKKLGTELQQRMKDITSDFFIGFGSFVDKTVMPYISTTPKKLQNPCGNNDE-KQVCTSPFSYKNVLSLTSEGNKFNSLVSRQKISGNLDSPEGGFDAMMQAAVCGNKIGWRNNTR-LLVFSTDAGFHFAGDGKLGGIVLPNDGRCHLDGKGMYTQSDF----------YDYPSVAQLVQKLGENSIQPIFAVTEEFYNVYKELSNLIPKSAVGVLSSNSSNVIQLIIDAYDALSSEIILENSKVPEGLQFRYTAVCKDNKVFRGEQGRKCSDIQIGDEVQFTIEVVATKCPNNGKAHEVEIRPLGFQEKVTVLLRFEC---ECQCHTSGVSNSMECHFGNGTMECGACRCNEGRVGRLCECG-TDEVNSEDIEASCKRDNSSTV---------------------------------------VCSG--RGDCVC-GECIC---YKRES-PAPAPTPSTRGPSASTAPRARTRASCTSKWSPVCGGL-------------RRRTPTPENVTSHCPELFRVRLVERREEEPQTSGKALDCAECKAFQTGPKKETCDKCEFEVKKVEEIEKRESTEHTAFCKVKNEEDCWFYFNFTYAKSDAEVYV--------QTKVECPEEPNIIAIIAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKDRMNAKWDTGENPIYKSAVTTVVNPRYEG 765          
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008082.1 (pep scaffold:Pmarinus_7.0:GL480062:177781:197788:1 gene:ENSPMAG00000007264.1 transcript:ENSPMAT00000008082.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 301.982 bits (772), Expect = 1.254e-91
Identity = 191/557 (34.29%), Postives = 289/557 (51.89%), Query Frame = 3
Query:  114 ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKS-LIEFMKSSIKSQSNRIKRQSDDDE--IQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSA----CNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXL-----SRYTGDYCECDLLGCKRATDDNKVCGGK 1745
               C  C+     C WC    F         RC S++ L  RGC+ + ++  M S    Q+  +       E  +QL P      +RPG+P   ++ +K    YP+DLYYL DLSYSM DDL+ V  +  ++ + LG++TK  + GFG FVDK V P+++ +P+ L +PC      N +C  PF YKH+L+LT     F+++       GNLD+PEGG DA+LQ A C   I W +N R +++FTSD GFH AGDG+LAG++ P    C L+   +          + ++I  DYPSVG++A  L+E  I  IFA       +Y +L++ +P +AVG     SSN++ L+   Y  + SK+ + P      + +  ++ C ++   T K  C +  I  EI + + V  K+C K +T V  +I  L     L +K +    CNC+  + N      +P C NG G   CG C+C +   G  C+C        A ++ QC+     ++CSG+G C CGKC C++      +  G YC C+   C+R   DNK+CGG+
Sbjct:   32 VVTCSDCLASGGYCAWCRTLNFTRDGELDSVRCASVEALKARGCEANDIMNPMGSFSVLQNEPLTSTGMQSETVVQLSPQKVHVKLRPGIPTKFDIKFKRAEGYPIDLYYLMDLSYSMNDDLENVKKLGSQLLQSLGKITKGEKPGFGAFVDKTVLPYVSTSPEHLEHPCTE---KNVRCSRPFAYKHVLTLTDKSAIFEKKVGDQI-IGNLDTPEGGFDAMLQAAVCGDKIGWRNNTR-LLVFTSDAGFHFAGDGKLAGIVTPNDGNCHLDSDGE----------YKDNIHYDYPSVGQLAQKLSENNIQPIFAVTKSVVNIYRELSQLIPKSAVGELSGDSSNVIQLITSAYNNLSSKIILEPSRVPEGVSVSFVSHCNNKEKETQKGVCSEVKIGTEILFTVAVLAKECPK-DTEVEFEIRSLGFQEKLSVKLSFECQCNCNDSTKN------APYCSNGNGNLECGVCSCHQDRIGRLCDCRAKGGDTIA-LEAQCRPDNSSQLCSGQGDCVCGKCVCNVRADPQEKVDGKYCHCNNFNCERY--DNKLCGGE 563          
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Match: itgb6 (integrin, beta 6 [Source:ZFIN;Acc:ZDB-GENE-100812-2])

HSP 1 Score: 157.918 bits (398), Expect = 7.353e-41
Identity = 165/596 (27.68%), Postives = 258/596 (43.29%), Query Frame = 3
Query:  789 QQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECS-------------TTTEQNEADMKNQCKKTKDDEVXXXXXX---XXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPC--ACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTED-GSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            Q  I W S A  +++F SD   H+A DGRLAG+  P    C L+ +            + +S + DYPS+G++   L +  I +IFA   +    Y   +  +P A  G     S+N+ DL+ + YK + S+V +  K     + L     C D      +  C       ++++ + V+   C  G  +++L+  GL+D   L + + C C +C +      +SP+C  G G + CG C C  G  G  CEC+                +    + + +C+   +   CSGRG      C        R  G +CECD   C  A  ++ +C    RG C C G C   C   Y G  C C VS   C+         C     C C             C+ + G++  R   D       C+  LY S   D V     E  +L E +   MC          Y    +T+   +ED    +C   N+ NC +   Y     I+    +L       +C +  S++ IIVGV +G+VI+G ++LL+WK++VTI DRRE A +QE   +A+W    NP+++P  +T +N  Y+G
Sbjct:    1 QDKIGWRSEAMHLLVFVSDADSHIALDGRLAGVAVPNDGLCHLDEKN----------AYTHSTDMDYPSLGQLIEKLTDNNIQLIFAVTGKWLDQYANYSSLIPGATFGQLNKDSTNVQDLIIKAYKGLRSEVELEVKEQLEGVKLYFTALCHDGTVLPGQKKCTNLREGDKVRFNVSVELTSCLPGTHTLLLKPVGLRDVLQLEVTARCGC-QCEAAPEI--ASPRCTAGNGDYTCGVCACSPGRLGPRCECASGSGGDEGGPGGGGGGDGGTGESERECRAEPEAPACSGRGDCFCGTCQCHGSEFGRIYGQHCECDNFSC--AHHNSNICA--ERGECEC-GICLLICHAAYHGSLCRCSVSVSLCR---------CVSVSLCHC---------VAVSCRCVAGETCLRSCHDS----MVCVSSLYTSATRDCVKCMHFETGRLNE-TCGQMC---------KYMLSVVTQLPDSEDVNPNVCTFSNENNCSVQFMYSKDTAIHPTLYVLKEM----DCHNPPSVMGIIVGVTVGVVIIGFIVLLLWKMMVTIHDRREFAKFQEDRSHARWGMSTNPLYRPTTSTFRNVSYRG 542          
BLAST of Integrin beta vs. Ensembl Nematostella
Match: EDO49405 (Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RGD5])

HSP 1 Score: 332.028 bits (850), Expect = 1.141e-100
Identity = 264/829 (31.85%), Postives = 391/829 (47.17%), Query Frame = 3
Query:   99 EECSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNS--NARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFE---DSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSA-------------CNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNE---ADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE--SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            EEC K   C  C++ SP CGWC D  +      P  RC  ++   E+ C++  +   KSS  + ++       DD +++ P   + ++RPG P   ++  +   NYPVDLYYL DLS SM +D+  V ++ +KI++E+  +T R R+GFG FVDKP+ P+I+  P    +P    +  N    P F +K++LSL  +   F+        SGN+DSPEGGLDAL+QVA C++ I W +   AR++V+FT+D G+H AGDG L G++ P   +C L               +  S   DYPSVG +   L +  +  IFA       +Y+ L  F       V E     SSN+V L++E Y KI     +     D  I +     C D     + T C    I  E+ + + V    C K + ++ L+   L  N    +K+A             C C+K   NS +I     C+  G   CG C C  G  G  C C   ++      A   N   +          G C C +         G YCEC  + C R       CGG   G+C C G C C   + G  C C  SN+ C      +  LCSG G+C+CG C C   SGY G  C +      Q C  ++D     C+ C+            KL G +         C  KC          ++  +   E G E C+  ++ +C     Y+  E     ++L++  Q +++CP+ A  + +I+GV+ G++ VG+ LLLIWK++ TI DRRE A ++++ +NAKW+T ENPIFK   TT +NP Y G
Sbjct:   11 EECKKKLTCGECIQTSPECGWCEDLNYF-WGGQPSPRCNDLQSHREKFCKR--VANPKSSFDTSTD----SPLDDRVKVSPQNMTLNLRPGQPTTFKVKVRMPENYPVDLYYLMDLSGSMLEDIAQVKTLGQKIADEMANITTRFRLGFGAFVDKPLAPYIDTYPPVRAHP----DLTNPSSVPAFGFKNMLSLNKDPKKFESTVASLNISGNVDSPEGGLDALMQVAVCEKEIGWANKLEARRLVIFTTDSGYHFAGDGLLGGVVTPNDAKCHLEGNT-----------YAASTTLDYPSVGSLRETLLQYQVAPIFAITKTQVDIYKTLVSFFGKETGAVAERLNSDSSNVVPLIREAYLKIAQTQTVTDTAPDG-IKVDYTANCPDGRRVGENT-CTGVKIGEEVSFDVSVTATDCSK-KMNICLK--KLSLNPRFSLKTAFGDIDISLKYICDCQCEK-PENSGSI----HCSTNGTLSCGVCDCDRGSAGRLCNCPAGSQYEPKRCARGGNSTAQVCSGRGVCDCGECICTESKTKGEIIYGKYCECTNMDCPRDPGSGLPCGGPEHGICDC-GTCNCTGNWTGPDCMCTKSNETCIR----NGVLCSGRGTCECGQCVCNATSGYVGAFCDDCPTCPGQ-CEANRD-----CVQCM-------KFGTGKLAGAE---------CAPKCGG-----ILFEMVDEIKPEMG-EKCLFEDQDDCFFTFAYRENEN----QELVIYVQKERDCPEEAEALAVILGVVGGVLGVGLALLLIWKLLATIQDRREFAKFEKERQNAKWDTGENPIFKQATTTFQNPTYGG 770          
BLAST of Integrin beta vs. Ensembl Nematostella
Match: EDO35236 (Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7SM23])

HSP 1 Score: 318.931 bits (816), Expect = 6.935e-96
Identity = 251/812 (30.91%), Postives = 401/812 (49.38%), Query Frame = 3
Query:  120 NCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINW--NSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGV---FEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQC-KKTKDDEVXXXXXXXXXXXXXXXLSR-----YTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESG--YTGDQCQNIKGDS-SQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQ 2513
            +C  C+   P C WC D  +  R   P  RC S+    +  CQK           + S ++K +  DD   + P   +  +R G P    ++ +   N+PVDLYYL D+S SM  D++ ++S+ K+I+ E+ ++T R R+GFG FVDKPV PFI+  P+ L +P +    ++    P F +++ L L    + F+ +      SGN+D+PEGG+DALLQ+A C + I W     AR++V+ T+D  +H AGDG L G++ P   +C L+ + +          +  S   DYPS+G++  +L E  +  IFA     K +Y+ L  F    +  V    E   SN+V L++E Y+KI +K   +     T + +     C D   F +K  C    I  E+ +++ V   +C   +    + +  +     L +K  C C KC         S  C+  G   CG C C   +TG  C+C   T    AD  ++C K     +VCSGRG+C C +C C  S+     + GD+C+C  + C R  D+  +CGG  +G C C G C+C   + G  C C     +C      +  +CSG G C+CG C C +   Y G  C +    + S +C+ +K      C+ C             K+ G     L N   C +KC+    D  ++ +  +  TE+  E C   +  +C     Y+  ++     +L +  + ++ CP+  + +++I+GVI GI+ +G+ LLLIW+++ TI DRRE A ++++   AKW+T ENPIF    TT +NP Y+
Sbjct:    1 SCSECIRGGPECAWCEDKDYFVRQ-QPADRCDSVLNHQKNKCQK----LTNPKSGTDSKQVKNKKLDDSTNVTPRNLTLHLRKGQPARFNVSMRTPENFPVDLYYLMDISGSMFQDMQQITSLGKRIATEMNKITTRFRLGFGTFVDKPVAPFIDTQPELLAHPRLTDTGIDLDSIPAFGFRNNLPLDQETSKFEAKVAAQNISGNVDNPEGGMDALLQIAVCHKDIGWVKKEEARRLVVLTTDANYHFAGDGLLGGIVTPNDGKCHLSAEGE----------YEASTLQDYPSLGQLREILIENQVVPIFAITQNQKAIYDVLQNFFGDQSFAVAAELEADGSNVVTLIREAYEKI-AKTQTVSDNTTTGVTITYKAICPD-GTFENKQVCNNVKIGEEVTFEVSVTALEC-SDKMPDRVNLRTVFGEVALNLKYICEC-KCQELEQ--HKSSYCSRNGTLICGECECDPEWTGRRCDCQKGT----ADDPSKCPKNNATGQVCSGRGKCYCAECICDESKVPGEEFYGDHCQCSNMDCPR-NDEGLLCGGPEQGKCDC-GKCSCYGNWTGPACSCTTETASCFE----NGAMCSGRGECECGKCVCNASLPYIGVYCNDCPVRTCSGQCNANK-----ACVQC-------------KVFGTG--PLQNE--CQEKCSD---DVIKVNIVDKI-TEEMGERCSFQDDDDCTFTFAYQPTDDY----RLEVFVEKERACPEQVAALVVILGVIFGILAIGLALLLIWRLLATIQDRREFAKFEKERSQAKWDTGENPIFINATTTFQNPTYK 751          
BLAST of Integrin beta vs. Ensembl Nematostella
Match: EDO45831 (Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RRW0])

HSP 1 Score: 310.457 bits (794), Expect = 9.483e-93
Identity = 264/822 (32.12%), Postives = 397/822 (48.30%), Query Frame = 3
Query:  105 CSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINW--NSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLP--SAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKC---FKGETSVILQIGGLK-DNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXX---XXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC---DCLVSNKNCQNPTNTSAPLCSG--HGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCL-YESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            C   + C  C+ K PSC WC       + V P  RC +   L   GC++  I    S+ +S  +  K       IQ+ P   +  +RPG+P  + +T +   NYPVDLYYL D+S+SM++DL  +  +  KI+E +  +TK  ++GFG FVDK V P++      L  PC +      +C   + +KHIL L  N T F+E+      SGNLD PEGG DAL+QVA C Q I W  N  +R++V+F +D  FH+AGDG+L G++ P   QC L+      N+ +    +  S E DYPS+ ++   L +K I  IFA       LY  L+       A  GV  + S N+V L+K +Y+KI S V +  K     I +     CKD     +   C    I  ++++ + V   +C    +   S  +++ G    N  L    +C CD         ++S +C +G G + CG C C +G  G+ CEC    ++     K +     D+  CSG+G+    KC        R  GD C+C+   C+       VCGG  RGVC C G C CK+ Y G  C   +C + +  C+   +  +P+C G   G+C+CG C C   YTG  C+         CSR KD     C+LC  +E   +DD  K      +   +  S    DK  T       +     Y  E   +         C  Y TY    +  T     +  Q K++CP+ A ++ I++GV+ GI+++G++LLLI K++V++ DR E   ++     +KW  E+NP++K   TT +NP Y G
Sbjct:    1 CLSQSTCNECISK-PSCAWC------SQEVTPS-RCDTYLRLKGYGCREENI----SNPQSIFSETKNDPVGATIQVTPQRVTLKLRPGIPSILPVTIRPAENYPVDLYYLMDMSWSMENDLDNLKKLAGKIAESMKNITKNFKLGFGSFVDKTVSPYVRTE---LTKPCSD----TSECVASYGFKHILPLVRNDTMFKEKVNEQKISGNLDEPEGGFDALMQVAVCDQQIGWSVNGTSRRLVVFVTDAPFHLAGDGKLGGIVTPNDGQCHLS------NSGV----YTKSDELDYPSIAQLHEKLLQKQIQPIFAVTGNVTDLYLGLSNSWDDLGATTGVLAEDSGNVVQLIKNSYEKIASTVKLSYKAPPG-ISVSYSGTCKDGQPVVN-GECTGVGIGQKVKFDVSVTLDRCTEDVQKYKSFPIRVPGFGLLNVDLEFICSCQCD---GKDFREENSTRCSSGNGTYACGQCQCHKGRYGELCECDNPFDKKTDVTKCKATNATDEPPCSGQGQCICGKCVCNRDPRGRIYGDKCQCNDFSCQE--HQGLVCGGNERGVCDC-GVCKCKDVYVGVNCGQRNCSLLDFECRK--DKGSPVCGGPDRGTCECGKCKCNRKYTGQYCEECPSCEGGICSRSKD-----CILCTKFEKKSLDDCKKL----NRCEPIVQSVEFVDKIET-------LTAKGLYRCEGARD--------KCTYYFTYDKRADGKTYD---LYVQEKQDCPEPAPILAIVLGVVGGILLIGLLLLLIGKIMVSMVDRIEYKKFERDRMRSKWHREKNPLYKEAKTTFENPTYAG 756          
BLAST of Integrin beta vs. Ensembl Nematostella
Match: EDO29722 (Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7T2U5])

HSP 1 Score: 286.96 bits (733), Expect = 3.511e-84
Identity = 235/819 (28.69%), Postives = 383/819 (46.76%), Query Frame = 3
Query:  126 QSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINW--NSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLP--SAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGET-----SVILQIGGLKDNATLIIKS--ACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC---DCLVSNKNCQNPTNTSAPLCSG--HGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYK---TAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQGGD 2522
            + C+ K P C WC+   F +      +RC +   L+ +GC+        S+  ++   IK  +   + Q+ P      +RPG P  + LT +   NYPVDLYYL D+S+SM+DDL  +  +  KI+E +  +T + R+GFG FVDK V P++   PD +  PC     L   C   + +KHILSL +N   F++       SGN+D PEGG DAL+QVA C++ I W     +R++V+F SD  FH AGDG+L G++ P   QC LN            + +  S E DYP++ ++   L    I  IFA       +Y+ L+       A  G     S N+VDL++E+Y KI S V +L     + + +    +C ++    ++  C    I  +I + ++V  ++C K  +     S  +++ G     TL +++   C C+ C       ++S +C +G G + CG C C  G  G+ CEC +  ++ +   K +   + D++ CSG+G+C CG+C C+   Y G+ C+C    C++   + ++CGG  RG C+C G C C+  + G  C   +C      C +P +    LCSG  HG+C CG C C   Y+G  C+         C R +D     C+ C+   L              L +    + C     T +V    I     +  E G          +C +Y TY      +    +R+  +             + +I   ++ G   + +V        ++ D +   A   E+ + A+W+ E++P++K P TT  NP Y   +
Sbjct:    2 KGCIAK-PQCAWCYQEDFTELG-NAVYRCDTKDDLVNKGCKNI------SNPSTELTNIKDVAVGAQYQVSPQQVKVKLRPGAPARLRLTVRPAENYPVDLYYLMDMSWSMRDDLSKLKGLAGKIAESMANITTKFRLGFGSFVDKTVMPYV--QPDFVDEPC--RRELPGACVATYGFKHILSLVNNSKLFEDEVNKQVISGNIDDPEGGFDALMQVAVCEEKIGWLKRGTSRRLVVFVSDASFHFAGDGKLGGIVTPNDEQCHLN----------GLMTYDKSNEMDYPTLAQLHHQLQMHQIQPIFAVTRNVSNIYKVLSTMWGDIGAVTGELALDSRNVVDLIQESYDKIASTV-MLSHSAPSEVKITYTARCGNQ--ILNQKECTNVGIGEKIYFDLEVGIERCNKDLSEKKMDSFPVRVPGF---GTLTVQAEYVCQCE-CEGPGYKEENSSRCTSGNGTYACGQCACHHGRYGERCECDSPFDKAKDVGKCKMTNSSDEQPCSGQGQCVCGRCVCNQGHY-GEKCKCSDATCQKY--EKQLCGGPERGACVC-GECKCESEFLGSNCGELNCAGIQHRCHSPGSPRGVLCSGSDHGTCTCGQCTCTRKYSGKYCEECPSCEGGICRRSED-----CLKCVTADL------------NSLEDCKKLNRCEPVVKTVSVQDEIIVTQANFKCEAGEG--------DCSVYYTYSFDGLGKRYDIIRQRGLGKPPPPPPILQIVLGVIAGILLSGSYCLCLVSYFETLHNISQDKKEVEAFMLERTR-ARWQKEKSPLYKAPTTTFTNPAYASAE 761          
BLAST of Integrin beta vs. Ensembl Nematostella
Match: EDO46245 (Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RQX1])

HSP 1 Score: 277.715 bits (709), Expect = 4.812e-81
Identity = 205/651 (31.49%), Postives = 325/651 (49.92%), Query Frame = 3
Query:  126 QSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINW--NSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLP--SAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGET-----SVILQIGGLKDNATLIIKS--ACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERC---DCLVSNKNCQNPTNTSAPLCSG--HGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESL 2027
            + C+ K P C WC+   F +      +RC +   L+ +GC+        S+  ++   IK  +   + Q+ P      +RPG P  + LT +   NYPVDLYYL D+S+SM+DDL  +  +  KI+E +  +T + R+GFG FVDK V P++   PD +  PC     L   C   + +KHILSL +N   F++       SGN+D PEGG DAL+QVA C++ I W     +R++V+F SD  FH AGDG+L G++ P   QC LN            + +  S E DYP++ ++   L    I  IFA       +Y+ L+       A  G     S N+VDL++E+Y KI S V  L     + + +    +C ++    ++  C    I  ++ + ++V  ++C K  +     S  +++ G     TL +++   C C+ C       ++S +C +G G + CG C C  G  G+ CEC +  ++ +   K +   + D++ CSG+G+C CG+C C+   Y G+ C+C    C++   + ++CGG  RG C+C G C C+  + G  C   +C      C +P +    LCSG  HG+C CG C C   Y+G  C+         C R +D     C+ C+   L
Sbjct:    2 KGCIAK-PQCAWCYQEDFTELG-NAVYRCDTKDDLVNKGCKNI------SNPSTELTNIKDVAVGAQYQVSPQQVKVKLRPGAPARLRLTVRPAENYPVDLYYLMDMSWSMRDDLSKLKGLAGKIAESMANITTKFRLGFGSFVDKTVMPYV--QPDFVDEPC--RRELPGACVATYGFKHILSLVNNSNLFEDEVNKQVISGNIDDPEGGFDALMQVAVCEEKIGWLKRGTSRRLVVFVSDDSFHFAGDGKLGGIVTPNDEQCHLN----------GLMTYDKSNEMDYPTLAQLHHQLQMHQIQPIFAVTRNVSNIYKVLSTMWGDIGAVTGELALDSRNVVDLIQESYDKIASTVK-LSHSAPSEVKITYTARCGNQ--ILNQKECTNVGIGEKVYFDLEVGIERCNKDLSEKKMNSFPVRVPGF---GTLTVQAEYVCQCE-CEGPGYKEENSSRCTSGNGTYACGQCACHHGRYGERCECDSPFDKAKDVGKCKMTNSSDEQPCSGQGQCVCGRCVCNQGHY-GEKCKCSDATCQKY--EKQLCGGPERGACVC-GECKCESEFLGSNCGELNCAGIQHRCHSPGSPRGVLCSGSDHGTCTCGQCTCTRKYSGKYCEECPSCEGGICRRSED-----CLKCVTADL 614          
BLAST of Integrin beta vs. Ensembl Medaka
Match: itgb1b.1 (integrin beta-1 [Source:NCBI gene;Acc:101154978])

HSP 1 Score: 375.941 bits (964), Expect = 2.519e-116
Identity = 274/824 (33.25%), Postives = 421/824 (51.09%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIK-SQSNRIKRQSDDDEIQLKPLTQ------SASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFT--DKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE-SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNV--DYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKT---AEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A +C  C++ S +CGWC D  F         RC  ++ L +R C+ S IE  +  I   Q N +  +  D++++L+ +TQ      + ++R G P  I L ++   +YP+DLYYL DLSYSMKDDL+ V ++  ++  E+ ++T   ++GFG FV+K V P+++  P  + NPC+     N  C  PF YK++LSLT +   F         SGNLDSPEGG DA++QVA C++ I W  N  ++++F++D GFH AGDG+L G++ P   QC  +L+ + +     Y         DYPS+  +   LN+  I  IFA   E + +Y++L   +P +AVG    +SSN++ L+ + Y  + S+V +        + ++  + CK+    T  D   C    I  E+ + I ++++KC   +  + ++  G  +   + +K  C+C +CSS   A  +S KC +G G F CG+C C EG  G  CECS    + E D+   C+K    ++CS       G C+C K       Y+G YCECD   C R+  +NK+CGG  R  C C   C C   Y G  CDC +    C      +  +C+G G C CG C C  S + G  C+ +       C+  KD     C+ C           +    G+K         C  +C+  N+     R KL +          C   +  +C  Y T+       E+  V +L        ECP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   28 ANAQSCGECIQVSETCGWCTDENFLTVGEPKSARCDDLESLKKRNCKVSQIENPRGKIVVDQDNPVTIRKKDEKVKLEDITQIQPQKVTVTLRTGEPQTINLKFRRADDYPIDLYYLMDLSYSMKDDLENVKNLGTELMREMAKITSDFKIGFGSFVEKTVMPYVSTTPLRMMNPCLG----NHNCTSPFSYKNVLSLTKDGKKFNNLVSQQQISGNLDSPEGGFDAIMQVAVCEKIIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQC--HLEGNMYTMSHYY---------DYPSIAHLVQKLNDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSSNSSNVIKLILDAYNSLSSEVTLEHGKLPDGVSIQYKSFCKNGVTQTGEDGRRCFNISIGDEVNFHISIESQKCLSKDEIIKIKPLGFNEELVINLKFICDC-QCSSGGEA--NSKKCFDGNGTFECGACKCNEGRIGRVCECSKDEVRTE-DLDANCRKDNGTDICSNNGDCVCGTCECKKRENPAEVYSGKYCECDNFNCDRS--NNKLCGGHGR--CECR-KCICDANYTGSACDCSLDTTPC---LAKNRQICNGRGECKCGSCRCTGSKFQGPTCE-LCPTCPGVCAEHKD-----CVQC-----------RAFQSGDK------KDTCEKECSNFNMIKVKDRDKLPQPTDQSFPLTHCKERDANDCWFYFTFSVRNDTNEVVVVEQL--------ECPAGPDIIPIVAGVVAGIVMIGLALLLIWKLLMIIHDRREFAKFEKEKLNAKWDTGENPIYKSAVTTVVNPKYEG 792          
BLAST of Integrin beta vs. Ensembl Medaka
Match: itgb1a (integrin subunit beta 1 [Source:NCBI gene;Acc:101175441])

HSP 1 Score: 358.221 bits (918), Expect = 1.209e-109
Identity = 267/832 (32.09%), Postives = 404/832 (48.56%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSN-------------RIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNV--DYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQG 2516
            + A  C  C++    CGWC D  F  +      RC   + L+ RGC + +IE      K   N             R K+   +D  Q++P   + ++R G P   +L +K   +YP+DLYYL DLS+SM DDL+ V ++   +  E+ ++T   R+GFG FV+K V P+I+  P  LRNPC      ++ C  PF YK++L LT +   F         SGNLDSPEGG DA++QVA C + I W  N  ++++F++D GFH AGDG+L G++ P   +C L       NN      ++     DYPS+  +   L++  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   + CK+      ++   C    I  E+ + I + +K C KG T+  ++I   G  +   L +   C C+    ++    +SPKC+ G G + CG+C C EG  G  CECS+     E DM   C+K    ++CS       G C+C K      RY+G YCECD   C R+   N +CGG   G C C   C C   + G  C+C   N+ C     ++  +C+G G+C+CG C C      G T + C    G     C+  KD V                      E            C + C+T  +     R KL +          C   +  +C  Y TY        V  ++ +     +CP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T ENPI+K  VTTV NP Y+G
Sbjct:   30 ANAKYCGECIQAGAKCGWCKDPNFLKQGESLSTRCDEFQSLLTRGCTEDMIEDPHGEHKVLQNKTVTNRKKVKDRSRAKQLKPEDITQIQPQKLNLTLRSGEPQSFKLKFKRAEDYPIDLYYLMDLSFSMADDLENVKNLGTSLMSEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTG----DQNCTSPFSYKNVLKLTEDGKLFNTLVGQQHISGNLDSPEGGFDAIMQVAVCGEQIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLE------NNVYTMSHYY-----DYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTLSANSSNVINLIIDAYNSLSSEVILENSKLPEGVTIAYKSHCKNGVVSEGESGRKCSNISIGDEVTFNISITSKGCPKGGTAETIKIKPLGFTEEVELTLNFICECE---CHNDGEKNSPKCHFGNGTYECGACKCNEGRVGKQCECSSNDVATE-DMDRTCRKDNSTDICSNNGECVCGTCECKKRENPNERYSGLYCECDNFNCDRS--GNLLCGG--HGTCECR-VCKCDPMWTGSACECSQDNRTC---LASNKQICNGRGTCECGVCKCTDPKFQGPTCEACPTCPG----VCTEHKDCV----------------------ECRAFGTGEMKDKCQEMCSTFTLIKVKDRDKLPQPNDASYPVMHCKERDANDCWFYYTYAVNNNTEKVVHVVET----PDCPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEG 803          
BLAST of Integrin beta vs. Ensembl Medaka
Match: itgb1a (integrin subunit beta 1 [Source:NCBI gene;Acc:101175441])

HSP 1 Score: 354.369 bits (908), Expect = 3.550e-108
Identity = 265/830 (31.93%), Postives = 406/830 (48.92%), Query Frame = 3
Query:  108 SKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSN-------------RIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTS--CLKNPIDGEIQYKIKVDTKKCFKGETSVILQIG--GLKDNATLIIKSACNCDKCSSNSTAIDSSPKCN-GKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXX-----XXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCE----SGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNV--DYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLY 2510
            + A  C  C++    CGWC D  F  +      RC   + L+ RGC + +IE      K   N             R K+   +D  Q++P   + ++R G P   +L +K   +YP+DLYYL DLS+SM DDL+ V ++   +  E+ ++T   R+GFG FV+K V P+I+  P  LRNPC      ++ C  PF YK++L LT +   F         SGNLDSPEGG DA++QVA C + I W  N  ++++F++D GFH AGDG+L G++ P   +C L       NN      ++     DYPS+  +   L++  I  IFA   E + +Y++L   +P +AVG    +SSN+++L+ + Y  + S+V +        + +   + CK+      ++   C    I  E+ + I + +K C KG T+  ++I   G  +   L +   C C+    ++    +SPKC+ G G + CG+C C EG  G  CECS+     E DM   C+K    ++CS       G C+C K      RY+G YCECD   C R+   N +CGG   G C C   C C   + G  C+C   N+ C     ++  +C+G G+C+CG C C      G T + C    G     C+  KD     C+ C           +    GE          C + C+T  +     R KL +          C   +  +C  Y TY        V  ++ +     +CP    +I I+ GV+ GIV++G+ LLLIWK+++ I DRRE A ++++  NAKW+T+ENPI+K P+   +NP Y
Sbjct:   30 ANAKYCGECIQAGAKCGWCKDPNFLKQGESLSTRCDEFQSLLTRGCTEDMIEDPHGEHKVLQNKTVTNRKKVKDRSRAKQLKPEDITQIQPQKLNLTLRSGEPQSFKLKFKRAEDYPIDLYYLMDLSFSMADDLENVKNLGTSLMSEMSKITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTG----DQNCTSPFSYKNVLKLTEDGKLFNTLVGQQHISGNLDSPEGGFDAIMQVAVCGEQIGWR-NVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLE------NNVYTMSHYY-----DYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTLSANSSNVINLIIDAYNSLSSEVILENSKLPEGVTIAYKSHCKNGVVSEGESGRKCSNISIGDEVTFNISITSKGCPKGGTAETIKIKPLGFTEEVELTLNFICECE---CHNDGEKNSPKCHFGNGTYECGACKCNEGRVGKQCECSSNDVATE-DMDRTCRKDNSTDICSNNGECVCGTCECKKRENPNERYSGLYCECDNFNCDRS--GNLLCGG--HGTCECR-VCKCDPMWTGSACECSQDNRTC---LASNKQICNGRGTCECGVCKCTDPKFQGPTCEACPTCPG----VCTEHKD-----CVEC-----------RAFGTGEM------KDKCQEMCSTFTLIKVKDRDKLPQPNDASYPVMHCKERDANDCWFYYTYAVNNNTEKVVHVVET----PDCPSGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINQFQNPNY 801          
BLAST of Integrin beta vs. Ensembl Medaka
Match: itgb5 (integrin subunit beta 5 [Source:NCBI gene;Acc:101165543])

HSP 1 Score: 337.806 bits (865), Expect = 3.853e-102
Identity = 256/821 (31.18%), Postives = 390/821 (47.50%), Query Frame = 3
Query:  114 ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSN---RIKRQSD--DDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKG--ETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXX---XXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTT--------VKNPLYQGG 2519
            A +C  C+   PSC WC    F  RN     RC  ++ L ++ C+K  IEF  S ++   N     KR     D  +Q+ P   S S+RPG      L  + + +YPVDLYYL DLS SMKDDL T+ ++  K++ E+G+LT   R+GFG FVDK + PF    P    NPC N   L  +C P F ++HIL LT     F +  Q    S N D+PEGG DA+LQ A C+  I W   A  +++F +D   H+A DGRL GL++P   +C L+ Q +          +  S + DYPS+  +   L E  I +IFA    + ++Y+ L   +P   V + +  S N++ L+   Y  I SKV +        I+L     C+D         C    +   + + + V+T+ C     + S  ++  G +D   + +   C+C  CS N  A  +S  C+  G + CG+C C+ G+ G  CEC      + A   + C++++  ++CSGRG C C +         ++ G +CECD   C R      +C G   G C C G C C  GY G+ C+C     +C         +CSG G C CG C C E G  GD C+         C   +D     C+ C             +L G     L+++  C   C    +    +K        DG+ +C+     +C +  TY    E  + + +L + + + EC      +M+++ V+  I++VG+VLL +WK+V+T+ DRRE A +Q     A++E   NP++K PV+T        +    Y GG
Sbjct:   32 AASCAECLLIHPSCAWCAQEVF-GRNQTLVSRCDLVQNLQKKNCEKRFIEFSTSHVQVLKNIPLSSKRSGFVWDRVVQVSPQKISLSLRPGHQAQFSLQVRQVEDYPVDLYYLMDLSLSMKDDLATIRNLGTKLALEMGKLTSNFRLGFGSFVDKNMSPFSYTAPKYQENPC-NGFKLFPQCVPTFGFRHILPLTDQVDRFNQEVQKQLVSRNRDAPEGGFDAILQAAVCEDKIGWRKEAYHLLVFATDDVPHLALDGRLGGLVRPHDGRCHLDDQNE----------YSASTKMDYPSLALLGEKLAENNIFLIFAVTKRHYVIYKNLTALIPGTTVEILDQDSKNVIQLIITAYSNIRSKVELTTSDPPEDINLSFTATCQDGKPLPGLRKCADLKLGDTVSFDVSVETRSCSSNNPKQSFTIKPVGFEDRLEVAVTYECDCG-CSQN--AQTNSSICSSIGTYTCGTCHCEPGYLGAHCECQEGDGNSMA--VSACRESEGKQLCSGRGECSCNQCLCYESEFGKFYGSFCECDDFSCAR--HKGILCSG--HGECHC-GQCKCHAGYVGDNCNCSTETASC---IAEDGKMCSGRGQCVCGRCRCTEPGAFGDTCEKCP-TCPDACGSKRD-----CIEC-------------RLFGSG--RLADNQTCQRLCKDQILTVESLK-------TDGTTLCLYKTHDDCIMKFTY---SEHASGQSVLTALK-EPECGGGPDALMVLLAVVGSILLVGVVLLAVWKLVITVHDRREFARFQNARWRARYEVASNPLYKQPVSTHRLVTDLNMHGKFYNGG 795          
BLAST of Integrin beta vs. Ensembl Medaka
Match: ENSORLT00000005904.2 (integrin subunit beta 3 [Source:NCBI gene;Acc:101161193])

HSP 1 Score: 336.265 bits (861), Expect = 1.673e-101
Identity = 259/830 (31.20%), Postives = 389/830 (46.87%), Query Frame = 3
Query:  114 ATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRI----KRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPD-ALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFK-GETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKC-NGKGKFFCGSCTCQEGFTGDFCECS----TTTEQNE-------ADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFC-ESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLL-------MSFQIKK-ECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQGGD 2522
            A+ C+ C+   PSCGWCF   F    V    RC   K L+  GC  S +E   S ++   +R        +  D  Q+KP     ++RP       +  + + +YPVDLYYL DLS+SM DDL  + ++   ++  + R T  LRMGFG FVDKP+ P++  +P+ A++NPC ++   N  C P F YKH+LSLT     F E  +    S N D+PEGG DA++Q A C++ I W   A  +++FTSD   H+A DGRLAG++ P   QC LN +            +  S   DYPS+  +   ++E  IN+IFA       LY+  +E +P   VG   + S N++ L+ + Y KI SKV +  +     + L     C +        SC    I   + + ++     C K  + + +++  G KD+ T+ +   C+C KC S   A  +SPKC NG G F CG C C  G  G  CEC+      T+Q+          +++     + D V       +C        +  G  CECD   C R     ++C G   GVC C G C C   ++GE C+C      C +       LCSG G C CG C C + G  G  C     D    C  D   +   C+ C           K+   G+   + + S +C D+          I L  +    D        N +NC    TYK  ++     +         + F +K+ +CP    ++++++ V   I+ +G+  LLIWK++VTI DRRE A ++E+   AKW+T  NP++K   +T  N  Y+G D
Sbjct:   34 ASTCKQCLAVHPSCGWCFQEDF-GHGVASSSRCDLKKNLIAAGCSPSALESPTSKLQVIEDRPLSNKAAGATQDITQIKPQKLHITLRPDDAKRFTVKVRQVEDYPVDLYYLMDLSFSMNDDLFRLRTLGNGLATAMSRTTSNLRMGFGAFVDKPLSPYMYISPEEAVKNPCYSI---NTTCLPQFGYKHVLSLTEEVGRFTEEVKKQMVSRNRDAPEGGFDAIIQAAVCKEQIGWRPGASHLLIFTSDAKTHMALDGRLAGIVHPNDGQCHLNSENI----------YSKSTTMDYPSLALITEKMSENNINLIFAVTNSVVTLYQNYSELIPGTTVGTLSNDSGNVIQLILKAYAKIRSKVELEVQGVPEELSLSFNATCLNGEVIPGLKSCSGLKIGDTVSFSVEARAHGCPKQKKKTFVIKPVGFKDSLTVTVTFECDC-KCQSK--AQPNSPKCTNGNGTFECGICLCHPGRLGPHCECAEGDYNPTDQDRCSGPDGAGGLRSSICSGRGDCV-----CGQCVCHSSDFGKVWGKLCECDDFNCPRY--KGELCSG--HGVCNC-GFCQCDPDWQGENCNCSRRTDTCMSSLGL---LCSGRGQCVCGVCECTQPGAYGATC-----DKCPTCP-DACTMKKECVEC-----------KHFKRGKLFEDNTCSRICKDE----------IVLVDEIVLHD-------TNAVNC----TYKDEDDCVERFQYFEDASGKSILFVVKEPDCPKGPDILVVLLSVAGAILFLGLAALLIWKLLVTIHDRREFAKFEEERARAKWDTGHNPLYKGATSTFTNITYRGKD 795          
BLAST of Integrin beta vs. Planmine SMEST
Match: SMESG000045564.1 (SMESG000045564.1)

HSP 1 Score: 1570.06 bits (4064), Expect = 0.000e+0
Identity = 812/812 (100.00%), Postives = 812/812 (100.00%), Query Frame = 3
Query:   90 NPDEECSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVXXXXXXXXXXXXXXXLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMXXXXXXXXXXXXXXXXXXXXXXXXTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQGGDD 2525
            NPDEECSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVCSGRGRCKCGKCHCSLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMIIVGVIIGIVIVGIVLLLIWKVVVTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQGGDD
Sbjct:   20 NPDEECSKATNCQSCMEKSPSCGWCFDAAFEDRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQLKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVSSMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPLNEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVAYCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQADRFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEKLAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKVLTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGLKDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGDFCECSTTTEQNEADMKNQCKKTKDDEVCSGRGRCKCGKCHCSLSRYTGDYCECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNKNCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDKDKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDYSRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQIKKECPDTASMIMIIVGVIIGIVIVGIVLLLIWKVVVTIDDRRENAIYQEQLKNAKWETEENPIFKPPVTTVKNPLYQGGDD 831          
The following BLAST results are available for this feature:
BLAST of Integrin beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGB11.560e-12034.46integrin subunit beta 1 [Source:HGNC Symbol;Acc:HG... [more]
ITGB11.560e-12034.46integrin subunit beta 1 [Source:HGNC Symbol;Acc:HG... [more]
ITGB13.146e-11934.18integrin subunit beta 1 [Source:HGNC Symbol;Acc:HG... [more]
ITGB27.607e-11234.27integrin subunit beta 2 [Source:HGNC Symbol;Acc:HG... [more]
ITGB27.607e-11234.27integrin subunit beta 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Integrin beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pat-32.764e-11332.60Integrin beta pat-3 [Source:UniProtKB/Swiss-Prot;... [more]
C05D9.34.350e-1031.39Uncharacterized integrin beta-like protein C05D9.3... [more]
ten-12.559e-626.42Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-12.663e-626.42Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
ten-12.691e-626.42Teneurin-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ... [more]
back to top
BLAST of Integrin beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mys2.911e-10330.98gene:FBgn0004657 transcript:FBtr0340137[more]
mys2.911e-10330.98gene:FBgn0004657 transcript:FBtr0340136[more]
mys2.911e-10330.98gene:FBgn0004657 transcript:FBtr0071105[more]
mys1.131e-10230.98gene:FBgn0004657 transcript:FBtr0340135[more]
Itgbn4.899e-7529.64gene:FBgn0010395 transcript:FBtr0346711[more]
back to top
BLAST of Integrin beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itgb24.826e-11632.52integrin, beta 2 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
itgb1a3.574e-11433.17integrin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-060803... [more]
itgb1a2.638e-11232.77integrin, beta 1a [Source:ZFIN;Acc:ZDB-GENE-060803... [more]
itgb1b.12.743e-10631.85integrin, beta 1b.1 [Source:ZFIN;Acc:ZDB-GENE-0608... [more]
itgb71.820e-10532.34integrin, beta 7 [Source:ZFIN;Acc:ZDB-GENE-100728-... [more]
back to top
BLAST of Integrin beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGB25.148e-12132.97integrin subunit beta 2 [Source:NCBI gene;Acc:1004... [more]
ITGB29.430e-12132.97integrin subunit beta 2 [Source:NCBI gene;Acc:1004... [more]
itgb12.624e-11333.53integrin subunit beta 1 [Source:NCBI gene;Acc:3947... [more]
itgb13.954e-11333.53integrin subunit beta 1 [Source:NCBI gene;Acc:3947... [more]
itgb15.622e-11333.53integrin subunit beta 1 [Source:NCBI gene;Acc:3947... [more]
back to top
BLAST of Integrin beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Itgb11.189e-12035.14integrin beta 1 (fibronectin receptor beta) [Sourc... [more]
Itgb22.352e-11233.66integrin beta 2 [Source:MGI Symbol;Acc:MGI:96611][more]
Itgb31.172e-10531.40integrin beta 3 [Source:MGI Symbol;Acc:MGI:96612][more]
Itgb61.892e-10431.60integrin beta 6 [Source:MGI Symbol;Acc:MGI:96615][more]
Itgb61.892e-10431.60integrin beta 6 [Source:MGI Symbol;Acc:MGI:96615][more]
back to top
BLAST of Integrin beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P05556|ITB1_HUMAN7.490e-12034.46Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 P... [more]
sp|P09055|ITB1_MOUSE8.316e-12035.14Integrin beta-1 OS=Mus musculus OX=10090 GN=Itgb1 ... [more]
sp|P49134|ITB1_RAT5.321e-11935.41Integrin beta-1 OS=Rattus norvegicus OX=10116 GN=I... [more]
sp|P53713|ITB1_FELCA9.223e-11934.46Integrin beta-1 OS=Felis catus OX=9685 GN=ITGB1 PE... [more]
sp|P53712|ITB1_BOVIN9.718e-11934.46Integrin beta-1 OS=Bos taurus OX=9913 GN=ITGB1 PE=... [more]
back to top
BLAST of Integrin beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1P8CUU00.000e+0100.00Integrin beta (Fragment) OS=Schmidtea mediterranea... [more]
E7BBC00.000e+049.76Integrin beta OS=Schistosoma mansoni OX=6183 GN=be... [more]
A0A183P2470.000e+049.52Integrin beta OS=Schistosoma mattheei OX=31246 GN=... [more]
A0A430Q9E80.000e+049.40Integrin beta OS=Schistosoma bovis OX=6184 GN=DC04... [more]
A0A183K0Y30.000e+049.40Integrin beta OS=Schistosoma curassoni OX=6186 GN=... [more]
back to top
BLAST of Integrin beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itgb25.690e-11336.38integrin beta-2-like [Source:NCBI gene;Acc:1030285... [more]
itgb27.478e-11336.38integrin beta-2-like [Source:NCBI gene;Acc:1030285... [more]
itgb21.397e-11236.38integrin beta-2-like [Source:NCBI gene;Acc:1030285... [more]
itgb1a9.789e-11233.82integrin subunit beta 1 [Source:NCBI gene;Acc:1030... [more]
itgb1a3.087e-11033.41integrin subunit beta 1 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Integrin beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ITGB11.605e-10832.81integrin subunit beta 1 [Source:HGNC Symbol;Acc:HG... [more]
itgb3b1.306e-10332.27integrin beta 3b [Source:ZFIN;Acc:ZDB-GENE-071207-... [more]
ITGB15.057e-9630.36integrin subunit beta 1 [Source:HGNC Symbol;Acc:HG... [more]
ENSPMAT00000008082.11.254e-9134.29pep scaffold:Pmarinus_7.0:GL480062:177781:197788:1... [more]
itgb67.353e-4127.68integrin, beta 6 [Source:ZFIN;Acc:ZDB-GENE-100812-... [more]
back to top
BLAST of Integrin beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrin beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494051.141e-10031.85Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RGD5... [more]
EDO352366.935e-9630.91Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7SM23... [more]
EDO458319.483e-9332.12Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RRW0... [more]
EDO297223.511e-8428.69Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7T2U5... [more]
EDO462454.812e-8131.49Integrin beta [Source:UniProtKB/TrEMBL;Acc:A7RQX1... [more]
back to top
BLAST of Integrin beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
itgb1b.12.519e-11633.25integrin beta-1 [Source:NCBI gene;Acc:101154978][more]
itgb1a1.209e-10932.09integrin subunit beta 1 [Source:NCBI gene;Acc:1011... [more]
itgb1a3.550e-10831.93integrin subunit beta 1 [Source:NCBI gene;Acc:1011... [more]
itgb53.853e-10231.18integrin subunit beta 5 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000005904.21.673e-10131.20integrin subunit beta 3 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Integrin beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000045564.10.000e+0100.00SMESG000045564.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006369 ID=SMED30006369|Name=Integrin beta|organism=Schmidtea mediterranea sexual|type=transcript|length=2863bp
AATCTATATAAATCTTATATGGCATTGCTAAAATGAATGTTTTTTTCGTT
TTTTTGATATCGTTTTCTCTGATCTCCTTGGCGGTTTCTAATCCTGATGA
GGAATGTTCGAAAGCTACAAATTGTCAATCTTGCATGGAAAAATCTCCTA
GCTGTGGCTGGTGTTTTGATGCGGCATTTGAAGACCGTAATGTTGGCCCT
GGATTTCGATGTGGGTCTATAAAAGTTTTAATGGAAAGAGGTTGTCAGAA
ATCACTAATTGAATTTATGAAATCGTCAATTAAAAGTCAAAGTAATCGCA
TTAAAAGACAATCAGACGATGATGAAATTCAGCTTAAACCATTAACTCAA
TCAGCTTCAATTCGACCAGGCCTGCCGCTGGACATTGAACTGACCTATAA
AGCAATAGGAAACTATCCAGTTGATTTATACTATTTAACTGATCTGTCAT
ATAGTATGAAAGATGATTTAAAGACAGTTTCCAGCATGACCAAAAAGATT
TCTGAAGAATTGGGAAGATTGACAAAGAGATTGCGAATGGGTTTTGGGGG
TTTTGTTGATAAACCCGTGTTTCCATTTATTAATCCAAATCCCGATGCCC
TTCGAAATCCTTGCATTAATTTAGAACCTCTTAATGAGAAGTGTGATCCT
CCGTTTTTGTATAAACATATTCTATCGTTGACTTCGAATTTCACAGATTT
TCAAGAACGAACTCAACACACAACGCCCTCGGGAAATCTAGATAGTCCTG
AAGGAGGTCTTGATGCCTTATTGCAAGTGGCTTATTGTCAGCAACATATC
AATTGGAACTCTAATGCCAGAAAAATTGTCCTCTTCACTAGTGACGGTGG
ATTCCATGTAGCGGGAGATGGGAGATTAGCAGGATTAATTAAACCTCCGC
CAAGACAATGTGAATTGAATTTACAAGCGGATAGATTTAATAATGACCTG
AAATACCTGGGTTGGCATAACTCAATTGAAACCGATTATCCGAGTGTAGG
AGAGGTAGCTAGCGTTCTCAATGAGAAAGGAATCAATGTCATATTTGCCA
CTAATCCCGAGAATAAAATGCTTTATGAAAAATTGGCGGAGTTTTTACCC
AGTGCTGCTGTCGGAGTTTTTGAAGATTCTTCGTCCAATATTGTCGATTT
ATTAAAGGAAAATTATAAGAAAATTCTTTCGAAAGTGGCTATATTACCGA
AATATGATGATACTCTTATTGATCTCAAAGTTCTAACAAAATGTAAAGAT
GAAGCGAATTTTACTGACAAAACATCTTGTCTAAAAAATCCGATCGACGG
TGAAATTCAATACAAAATAAAAGTTGACACGAAAAAGTGTTTCAAAGGTG
AAACAAGTGTCATTTTACAAATAGGAGGATTGAAAGACAATGCAACTCTC
ATAATTAAATCAGCCTGCAATTGTGACAAATGCAGTAGTAACTCGACTGC
TATTGACAGTTCACCGAAATGTAATGGTAAAGGTAAATTTTTCTGCGGTA
GCTGTACTTGTCAAGAGGGTTTTACTGGGGATTTTTGCGAGTGCTCTACG
ACTACAGAACAAAACGAAGCAGACATGAAAAATCAATGCAAAAAAACCAA
AGATGATGAGGTTTGTTCTGGTCGTGGACGTTGTAAATGCGGAAAATGCC
ATTGTTCCCTGTCGAGATATACAGGAGATTATTGTGAATGCGATCTATTA
GGTTGTAAGCGAGCTACTGATGATAACAAAGTCTGTGGGGGCAAAAATCG
AGGCGTGTGTCTATGTAATGGCCCATGCGCCTGCAAAGAAGGCTATAAAG
GAGAACGATGCGATTGTTTAGTCAGTAACAAGAATTGCCAGAATCCAACG
AATACATCGGCACCTCTTTGTTCCGGTCACGGTAGTTGTGACTGTGGGTA
TTGTTTTTGTGAATCTGGATATACCGGTGACCAATGTCAAAACATTAAAG
GTGATTCTAGTCAACGATGTAGTCGTGATAAAGACAAAGTTCTCACCAAC
TGCATGTTATGTCTATACGAATCATTAGTGGTTGACGATGTGCCTAAGTA
TAAATTAGAAGGAGAAAAATTGCCCGAGTTATCGAATTCAAGCATGTGTC
ACGACAAATGCAATACATCTAATGTCGATTATTCAAGAATAAAATTAACC
AAACAATACAGCACAGAAGATGGTTCAGAAATTTGTGTGATTTACAACAA
ATTGAATTGTCGTATTTATGTTACATACAAAACTGCCGAAGAGATCTACA
CAGTTCGGAAGTTATTAATGAGCTTTCAAATAAAGAAGGAATGTCCCGAC
ACTGCGAGTATGATTATGATAATTGTAGGAGTAATCATAGGCATTGTCAT
TGTCGGCATTGTTTTACTGTTGATTTGGAAAGTTGTTGTTACAATTGATG
ATCGAAGGGAGAATGCAATCTATCAAGAGCAATTGAAAAATGCAAAGTGG
GAAACCGAAGAAAATCCGATTTTCAAGCCTCCAGTCACAACTGTTAAAAA
TCCTCTTTATCAAGGAGGAGATGACTAAGTCACGAATTTATTATTGTTTT
AATTTATTGAAATGTGATTTTTGAATTTGATATATCCAATTGTAATGTGC
TTATATCGAAATCCAATGTTTCGCATGTGTTTATTGATATTGTATATATA
AATAGTTATATAGTTTAATTATTTTCTAAGACAATAATTTCAAAATTCTG
CATTATTTTTATATTTGTGTCTCATTTATAACTTTTCGTTTTTATAACAT
TTTGCAATACTTGATTGGATAGATCTGTAAATAGTTTTTTATAGTTCGCT
GATTTTTACTGTATATCTCTGGCTGGCGATTTTATTTAGCTAAACTGGCA
CATTTATTTTTTG
back to top

protein sequence of SMED30006369-orf-1

>SMED30006369-orf-1 ID=SMED30006369-orf-1|Name=SMED30006369-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=832bp
MNVFFVFLISFSLISLAVSNPDEECSKATNCQSCMEKSPSCGWCFDAAFE
DRNVGPGFRCGSIKVLMERGCQKSLIEFMKSSIKSQSNRIKRQSDDDEIQ
LKPLTQSASIRPGLPLDIELTYKAIGNYPVDLYYLTDLSYSMKDDLKTVS
SMTKKISEELGRLTKRLRMGFGGFVDKPVFPFINPNPDALRNPCINLEPL
NEKCDPPFLYKHILSLTSNFTDFQERTQHTTPSGNLDSPEGGLDALLQVA
YCQQHINWNSNARKIVLFTSDGGFHVAGDGRLAGLIKPPPRQCELNLQAD
RFNNDLKYLGWHNSIETDYPSVGEVASVLNEKGINVIFATNPENKMLYEK
LAEFLPSAAVGVFEDSSSNIVDLLKENYKKILSKVAILPKYDDTLIDLKV
LTKCKDEANFTDKTSCLKNPIDGEIQYKIKVDTKKCFKGETSVILQIGGL
KDNATLIIKSACNCDKCSSNSTAIDSSPKCNGKGKFFCGSCTCQEGFTGD
FCECSTTTEQNEADMKNQCKKTKDDEVCSGRGRCKCGKCHCSLSRYTGDY
CECDLLGCKRATDDNKVCGGKNRGVCLCNGPCACKEGYKGERCDCLVSNK
NCQNPTNTSAPLCSGHGSCDCGYCFCESGYTGDQCQNIKGDSSQRCSRDK
DKVLTNCMLCLYESLVVDDVPKYKLEGEKLPELSNSSMCHDKCNTSNVDY
SRIKLTKQYSTEDGSEICVIYNKLNCRIYVTYKTAEEIYTVRKLLMSFQI
KKECPDTASMIMIIVGVIIGIVIVGIVLLLIWKVVVTIDDRRENAIYQEQ
LKNAKWETEENPIFKPPVTTVKNPLYQGGDD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000121stem cell
PLANA:0000136whole organism
PLANA:0000429neoblast
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR033760Integrin_beta_N
IPR036465vWFA_dom_sf
IPR015812Integrin_bsu
IPR002369Integrin_bsu_VWA
IPR016201PSI
IPR014836Integrin_bsu_cyt_dom
IPR013111EGF_extracell
IPR002035VWF_A
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007229integrin-mediated signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015812Integrin beta subunitPRINTSPR01186INTEGRINBcoord: 240..262
score: 56.2
coord: 31..47
score: 44.88
coord: 63..82
score: 30.93
coord: 171..190
score: 57.96
coord: 761..778
score: 33.33
coord: 813..823
score: 51.18
coord: 103..116
score: 35.19
coord: 357..381
score: 36.44
coord: 131..149
score: 86.94
coord: 778..796
score: 57.89
coord: 267..282
score: 45.37
coord: 616..629
score: 60.05
coord: 207..226
score: 47.78
IPR015812Integrin beta subunitPIRSFPIRSF002512Integrin_Bcoord: 1..833
e-value: 2.6E-212
score: 704.7
IPR015812Integrin beta subunitPANTHERPTHR10082INTEGRIN BETA SUBUNITcoord: 21..831
IPR015812Integrin beta subunitPROSITEPS00243INTEGRIN_BETAcoord: 616..629
IPR015812Integrin beta subunitPROSITEPS00243INTEGRIN_BETAcoord: 531..544
IPR016201PSI domainSMARTSM00423psinew7coord: 27..75
e-value: 5.5E-4
score: 29.3
IPR002369Integrin beta subunit, VWA domainSMARTSM00187INB_2coord: 33..467
e-value: 1.1E-108
score: 377.0
IPR002369Integrin beta subunit, VWA domainPFAMPF00362Integrin_betacoord: 130..388
e-value: 4.0E-91
score: 305.1
IPR014836Integrin beta subunit, cytoplasmic domainSMARTSM01241Integrin_b_cyt_2coord: 786..832
e-value: 1.8E-15
score: 67.4
IPR014836Integrin beta subunit, cytoplasmic domainPFAMPF08725Integrin_b_cytcoord: 786..830
e-value: 1.3E-15
score: 56.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 515..556
e-value: 4.0E-12
score: 47.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 466..510
e-value: 1.0E-7
score: 33.8
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 600..639
e-value: 1.6E-7
score: 33.4
coord: 557..597
e-value: 8.3E-6
score: 28.0
NoneNo IPR availableGENE3DG3DSA:3.30.1680.10coord: 24..81
e-value: 2.3E-11
score: 45.2
NoneNo IPR availableGENE3DG3DSA:2.60.40.1510coord: 96..465
e-value: 2.1E-118
score: 397.4
NoneNo IPR availableGENE3DG3DSA:1.20.5.100coord: 755..832
e-value: 2.5E-26
score: 92.8
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.874
NoneNo IPR availableSUPERFAMILYSSF103575Plexin repeatcoord: 27..80
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 614..639
NoneNo IPR availableTMHMMTMhelixcoord: 763..785
IPR033760Integrin beta N-terminalPFAMPF17205PSI_integrincoord: 27..75
e-value: 4.0E-9
score: 36.1
IPR013111EGF-like domain, extracellularPFAMPF07974EGF_2coord: 613..638
e-value: 7.9E-5
score: 22.9
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 130..385
e-value: 2.1E-118
score: 397.4
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 130..386