Piezo-type mechanosensitive ion channel component

Overview
NamePiezo-type mechanosensitive ion channel component
Smed IDSMED30006368
Length (bp)6439
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Piezo-type mechanosensitive ion channel component (SMED30006368) t-SNE clustered cells

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30006368) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Piezo-type mechanosensitive ion channel component (SMED30006368) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Piezo-type mechanosensitive ion channel component (SMED30006368) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006368

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30006368h1SMcG0012780 dd_Smed_v4_18354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12740newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12740uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12738newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12738uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12739uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006368h1SMcG0012780 Contig12739newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 399.438 bits (1025), Expect = 2.093e-111
Identity = 229/597 (38.36%), Postives = 353/597 (59.13%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERT---EIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERST---SDWWQLHSHKEFDCLSRNPFSPDKT--KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M    +N     +  +  A+ F++++E +D+T+  +   S S+W+I+PP+K   +  LLD   + ++      +RN S    ++   D       ++T +     IA   T   K  V ++ +  + V   +D     +  L SEN+   +    I+LS + +T   S+WW L      +      ++P+    +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2116 LEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDI---TIILSRDNTTKYNSEWWVL------NLTGNRIYNPNSQALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2701          

HSP 2 Score: 130.183 bits (326), Expect = 3.391e-29
Identity = 99/342 (28.95%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  641 SVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLS----------VSSQIDRARSSVIFE----------------------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            SV   ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ +  +   + +                                  +    K L   +  +  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  440 SVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 767          

HSP 3 Score: 128.642 bits (322), Expect = 1.100e-28
Identity = 66/149 (44.30%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM+S +M++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     +V  + KD P+  P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1843 DELEESEKFYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVE-VNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 1990          

HSP 4 Score: 122.094 bits (305), Expect = 9.721e-27
Identity = 91/320 (28.44%), Postives = 158/320 (49.38%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  +++ S CWLI    + C  T + +   +  + C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L    G+    ++  EED  D+R  D
Sbjct: 1162 WLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNS-CWLIQAFSLAC--TVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGEGQDMQKLSEED--DEREAD 1475          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 399.438 bits (1025), Expect = 2.123e-111
Identity = 229/597 (38.36%), Postives = 353/597 (59.13%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERT---EIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERST---SDWWQLHSHKEFDCLSRNPFSPDKT--KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M    +N     +  +  A+ F++++E +D+T+  +   S S+W+I+PP+K   +  LLD   + ++      +RN S    ++   D       ++T +     IA   T   K  V ++ +  + V   +D     +  L SEN+   +    I+LS + +T   S+WW L      +      ++P+    +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2190 LEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDI---TIILSRDNTTKYNSEWWVL------NLTGNRIYNPNSQALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2775          

HSP 2 Score: 130.568 bits (327), Expect = 3.062e-29
Identity = 99/342 (28.95%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  641 SVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLS----------VSSQIDRARSSVIFE----------------------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            SV   ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ +  +   + +                                  +    K L   +  +  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  491 SVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 818          

HSP 3 Score: 128.642 bits (322), Expect = 1.098e-28
Identity = 66/149 (44.30%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM+S +M++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     +V  + KD P+  P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1917 DELEESEKFYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVE-VNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2064          

HSP 4 Score: 122.094 bits (305), Expect = 9.952e-27
Identity = 91/320 (28.44%), Postives = 158/320 (49.38%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  +++ S CWLI    + C  T + +   +  + C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L    G+    ++  EED  D+R  D
Sbjct: 1236 WLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNS-CWLIQAFSLAC--TVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGEGQDMQKLSEED--DEREAD 1549          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 399.438 bits (1025), Expect = 2.182e-111
Identity = 229/597 (38.36%), Postives = 353/597 (59.13%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERT---EIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERST---SDWWQLHSHKEFDCLSRNPFSPDKT--KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M    +N     +  +  A+ F++++E +D+T+  +   S S+W+I+PP+K   +  LLD   + ++      +RN S    ++   D       ++T +     IA   T   K  V ++ +  + V   +D     +  L SEN+   +    I+LS + +T   S+WW L      +      ++P+    +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2165 LEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDI---TIILSRDNTTKYNSEWWVL------NLTGNRIYNPNSQALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2750          

HSP 2 Score: 130.568 bits (327), Expect = 3.080e-29
Identity = 99/342 (28.95%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  641 SVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLS----------VSSQIDRARSSVIFE----------------------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            SV   ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ +  +   + +                                  +    K L   +  +  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  491 SVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 818          

HSP 3 Score: 128.642 bits (322), Expect = 1.042e-28
Identity = 66/149 (44.30%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM+S +M++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     +V  + KD P+  P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1892 DELEESEKFYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVE-VNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2039          

HSP 4 Score: 122.094 bits (305), Expect = 9.363e-27
Identity = 91/320 (28.44%), Postives = 158/320 (49.38%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  +++ S CWLI    + C  T + +   +  + C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L    G+    ++  EED  D+R  D
Sbjct: 1211 WLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNS-CWLIQAFSLAC--TVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGEGQDMQKLSEED--DEREAD 1524          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO1 (piezo type mechanosensitive ion channel component 1 [Source:HGNC Symbol;Acc:HGNC:28993])

HSP 1 Score: 345.51 bits (885), Expect = 7.791e-95
Identity = 218/593 (36.76%), Postives = 338/593 (57.00%), Query Frame = 3
Query: 4587 VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSL----TERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTS-----DWWQLHSHK-EFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            +++F+ ++   +Y    DVY  MF+ + + F II+ G+ AFG  + +T      L D ++P  F++ML+ QF  +++DRAL+LRK V+GKL FQ+  V+ IH+W+FF+ P ++   +N  +  Q  YF KC+YFALS+YQI+ GYP RILGNFLTKKYN+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL  WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL+++F     W PL+  S++ S+  V N P    +TL+  G+  ++  +++   +   +   Y  +   +    +A+ F+  + P+D+    I   S ++W I+PP++    + L +    + L      +R   D     TV        L+L    T R ++ASL       +V++  L P+++ A      + +     N         I L  E+        +WW +   +   DC        +     IFS+++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE +   LEE+L AKLIF+YRS ETMI++TR K+
Sbjct: 1942 LRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHSAATDIT-SSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQR---DLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDC--------NLLPMVIFSDKVSPPSLG-FLAGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREKE 2521          

HSP 2 Score: 172.94 bits (437), Expect = 3.511e-42
Identity = 103/297 (34.68%), Postives = 165/297 (55.56%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLC----AKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++  SY+ + IAMM WS+TY SWLTFVLL+ AC++W +       ++ SP I+ YG+ L  + YV  +   ++   +     P   + + G+   + P + L   + Y + FWL LR ++KEK+     S       +V   + +  ++L+  L +L     AKYWI+ C    ++VS   ++ +  +VYM   ++ +T F   YS WR+ +  +WWLV+ Y++ VL  +YTFQF+ F   W N T FT E L D G E F +S L   +L P   L+  I+Q+HYFH PFM+++D+
Sbjct:  419 IMDQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAM---DLRPELPTTLGP-VSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTRTQTLLQSLGELVKGVYAKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYSLWRKLLKAFWWLVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHYFHRPFMQLTDM 711          

HSP 3 Score: 107.842 bits (268), Expect = 2.245e-22
Identity = 59/145 (40.69%), Postives = 90/145 (62.07%), Query Frame = 3
Query: 4059 SSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALE-KDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDK 4490
               R   L+ A+   V  +S++LCY I+++NHM++ +  SL+ P+ VFLWAMLS PRPS  +W+  I++T++ +++KY+FQF F    S V     ++ P+F P  LG+ KT+ Y   DL+QL  LF HR  L  +GLW   +D 
Sbjct: 1668 GQGRALRLLRAVYQCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLWDHEEDS 1812          

HSP 4 Score: 91.2781 bits (225), Expect = 2.515e-17
Identity = 96/374 (25.67%), Postives = 161/374 (43.05%), Query Frame = 3
Query: 2241 PKLCI--L*NGSRVYPFHFPYLLEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGEN----RPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHC----------IPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRI--EQTHQNYGR------------------PLPN-----------------EHYLVLRSGDYFLF 3200
            P LCI      SR  P +    L  WL+LP +   P +  LI D +  +C + Q+ VF  E    ++   G N     P+     P     +FI  + SY+D LK  +F + +WL L +VF  G  R ++F LGY++        G   +    +  L  W+ ++ YN  +I+ K  L L++CV+++  +    CW+I +  + C          +  R+    + +E +         WD +CF FL++QR++F +  + +V  D++ T    SRG  L N   +  +   +  E +   ++K ++ RI  +Q     GR                  P P+                 +H  V+ SGDYFLF
Sbjct: 1061 PALCIDYPWRWSRAVPMN--SALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGVNTDRLEPLRGEPNPV---PNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQ-MQTGFCWVIQLFSLVCTVKGYYDPKEMMDRDQDCLLPVEEA------GIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNAANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKHRQGRVDRSRPQDTLGPKDPGLEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLF 1421          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 251.521 bits (641), Expect = 5.047e-66
Identity = 114/222 (51.35%), Postives = 159/222 (71.62%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSE 5234
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE
Sbjct: 2165 LEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESE 2385          

HSP 2 Score: 130.183 bits (326), Expect = 3.472e-29
Identity = 99/342 (28.95%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  641 SVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLS----------VSSQIDRARSSVIFE----------------------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            SV   ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ +  +   + +                                  +    K L   +  +  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  491 SVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 818          

HSP 3 Score: 128.642 bits (322), Expect = 1.018e-28
Identity = 66/149 (44.30%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM+S +M++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     +V  + KD P+  P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1892 DELEESEKFYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVE-VNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2039          

HSP 4 Score: 122.479 bits (306), Expect = 8.069e-27
Identity = 91/320 (28.44%), Postives = 158/320 (49.38%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  +++ S CWLI    + C  T + +   +  + C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L    G+    ++  EED  D+R  D
Sbjct: 1211 WLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNS-CWLIQAFSLAC--TVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGEGQDMQKLSEED--DEREAD 1524          

HSP 5 Score: 113.235 bits (282), Expect = 5.545e-24
Identity = 94/310 (30.32%), Postives = 161/310 (51.94%), Query Frame = 3
Query: 5427 IYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERT---EIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERST---SDWWQLHSHKEFDCLSRNPFSPDKT--KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            I+  +++   L+ M    +N     +  +  A+ F++++E +D+T+  +   S S+W+I+PP+K   +  LLD   + ++      +RN S    ++   D       ++T +     IA   T   K  V ++ +  + V   +D     +  L SEN+   +    I+LS + +T   S+WW L      +      ++P+    +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2388 IFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDI---TIILSRDNTTKYNSEWWVL------NLTGNRIYNPNSQALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2687          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 410.994 bits (1055), Expect = 9.242e-117
Identity = 382/1489 (25.65%), Postives = 652/1489 (43.79%), Query Frame = 3
Query: 2277 YPFHF--PYLLEDWLFLPSYL--------NPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNE-----LPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQF-----ILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYI---DHIINYSK--CWLIHILGIHCIPTRENHI---------SISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL----------PNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLD---YMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKD-SPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK--GFKDKFNIKEPEKK--------------------TNFNTLQTSSLTSRFILLKPFIT-------------------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRG-------------DML----QAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECER--NPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-KGLPRFL-VATKTDFQDALVLGSE--NSLNPLESYMIMLSIERSTSDWW--------QLHSHKEFDCLSRNPFSPDK-TKFFI-----------------FSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            YP+ +  P   +D  F  SYL        N P AY LIGD    +  + Q  VF+ E        GE+   ++N+      P+    DFI  K SY+DY K  +F + +W+TL      GI   +LF LGY+I      W G         L   ++ L  WN +L Y    I +K  LQ+  CV++   D    + K  C +  +  I C+   E H+         + ++E   G+I     +DV+   FL+ Q +IF +  F + +++ +      +RGA+L N+ +   + E+ E++   F  ++    R E   + Y + +          P  +    R+GDY++F+       YD   DD  E +  F  + D   K  + + LD    M   +  D+   +            + K   I  P +R+                         L +     +         +  ED   KDS  E  +K+ +K             + LD   + +N L ++ RYV  +L  EK+ +K+           G  E+                     L+ T      +   V+L ++ +    + + K+                ET+ +  +Q+ SS   LL  A+ N +  ++D+LCY   +M  +++  +++L  PL    W  LS PRPS F+W+ +I YT+ VI+IK+V QF F+   S     E    P  L    G+++ + +AL D++ LF LF HR  L+  GLWK     D F +KE  +                     T  +TL+ +S     I   P                      + +F   L   ++    D+Y  MF  + I F I+  GY AFG   G +   LD +K S+IP+  ++ML+   + IIIDRAL+LRK V+GKL++Q+  +  +H+W+F + P ++R    +    Q LY  K  YF +S++QI++GYP   +GN LT  Y   N+  FK ++ +PFL+ELR  +DW WTDT++ L+ +  +E+ +A IF +KC R+ E  YP PRG  +  + KY++G  ++I   +  + PL+L S++  I   + P    L +  +G+  +YE  ++G             D L    QA++D       +    + +++S++K +  +D+ I+     SE  W I+  +++  +   L +  ++N    +E  R  +P++    K    +    +L +T R +I S       + +L+ + +P F+ V  + +      +G+   N  NP  +   M   + + + W+        Q  S  E   ++ +    D+  K +I                 F +R   +   ++F    I    +  + V   L+R +++     +   ELP  D +LK+  +IYLVRE K F LE+ L AKLIF++RS  T+I +TR+ +
Sbjct:  334 YPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAY-LIGDFFVLLLASCQLAVFRRE--------GEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCV-NNECHVLKELEDFSKACAVETKEGNIG----FDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRR---RTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFK-------YDPENDDLVEPVDSFVPEVDP--KATAYDRLDPGQIMYAATAHDLDLAKT--------VQQVKKGDTIKDPDSRA-------------------------LIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQK----------MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKS-----------GHSES---------------------LSNTSRKLTDIRSAVDLPSLQLVQSANDVEKM----------------ETAVSVDWQQKSSATRLL-NAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG--EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDK-LSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARA-WFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK 1700          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 410.994 bits (1055), Expect = 9.242e-117
Identity = 382/1489 (25.65%), Postives = 652/1489 (43.79%), Query Frame = 3
Query: 2277 YPFHF--PYLLEDWLFLPSYL--------NPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNE-----LPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQF-----ILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYI---DHIINYSK--CWLIHILGIHCIPTRENHI---------SISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL----------PNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLD---YMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKD-SPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK--GFKDKFNIKEPEKK--------------------TNFNTLQTSSLTSRFILLKPFIT-------------------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRG-------------DML----QAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECER--NPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-KGLPRFL-VATKTDFQDALVLGSE--NSLNPLESYMIMLSIERSTSDWW--------QLHSHKEFDCLSRNPFSPDK-TKFFI-----------------FSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            YP+ +  P   +D  F  SYL        N P AY LIGD    +  + Q  VF+ E        GE+   ++N+      P+    DFI  K SY+DY K  +F + +W+TL      GI   +LF LGY+I      W G         L   ++ L  WN +L Y    I +K  LQ+  CV++   D    + K  C +  +  I C+   E H+         + ++E   G+I     +DV+   FL+ Q +IF +  F + +++ +      +RGA+L N+ +   + E+ E++   F  ++    R E   + Y + +          P  +    R+GDY++F+       YD   DD  E +  F  + D   K  + + LD    M   +  D+   +            + K   I  P +R+                         L +     +         +  ED   KDS  E  +K+ +K             + LD   + +N L ++ RYV  +L  EK+ +K+           G  E+                     L+ T      +   V+L ++ +    + + K+                ET+ +  +Q+ SS   LL  A+ N +  ++D+LCY   +M  +++  +++L  PL    W  LS PRPS F+W+ +I YT+ VI+IK+V QF F+   S     E    P  L    G+++ + +AL D++ LF LF HR  L+  GLWK     D F +KE  +                     T  +TL+ +S     I   P                      + +F   L   ++    D+Y  MF  + I F I+  GY AFG   G +   LD +K S+IP+  ++ML+   + IIIDRAL+LRK V+GKL++Q+  +  +H+W+F + P ++R    +    Q LY  K  YF +S++QI++GYP   +GN LT  Y   N+  FK ++ +PFL+ELR  +DW WTDT++ L+ +  +E+ +A IF +KC R+ E  YP PRG  +  + KY++G  ++I   +  + PL+L S++  I   + P    L +  +G+  +YE  ++G             D L    QA++D       +    + +++S++K +  +D+ I+     SE  W I+  +++  +   L +  ++N    +E  R  +P++    K    +    +L +T R +I S       + +L+ + +P F+ V  + +      +G+   N  NP  +   M   + + + W+        Q  S  E   ++ +    D+  K +I                 F +R   +   ++F    I    +  + V   L+R +++     +   ELP  D +LK+  +IYLVRE K F LE+ L AKLIF++RS  T+I +TR+ +
Sbjct:  334 YPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAY-LIGDFFVLLLASCQLAVFRRE--------GEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCV-NNECHVLKELEDFSKACAVETKEGNIG----FDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRR---RTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFK-------YDPENDDLVEPVDSFVPEVDP--KATAYDRLDPGQIMYAATAHDLDLAKT--------VQQVKKGDTIKDPDSRA-------------------------LIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQK----------MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKS-----------GHSES---------------------LSNTSRKLTDIRSAVDLPSLQLVQSANDVEKM----------------ETAVSVDWQQKSSATRLL-NAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG--EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDK-LSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARA-WFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK 1700          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 410.609 bits (1054), Expect = 1.309e-116
Identity = 382/1489 (25.65%), Postives = 652/1489 (43.79%), Query Frame = 3
Query: 2277 YPFHF--PYLLEDWLFLPSYL--------NPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNE-----LPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQF-----ILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYI---DHIINYSK--CWLIHILGIHCIPTRENHI---------SISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL----------PNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLD---YMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKD-SPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK--GFKDKFNIKEPEKK--------------------TNFNTLQTSSLTSRFILLKPFIT-------------------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRG-------------DML----QAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECER--NPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-KGLPRFL-VATKTDFQDALVLGSE--NSLNPLESYMIMLSIERSTSDWW--------QLHSHKEFDCLSRNPFSPDK-TKFFI-----------------FSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            YP+ +  P   +D  F  SYL        N P AY LIGD    +  + Q  VF+ E        GE+   ++N+      P+    DFI  K SY+DY K  +F + +W+TL      GI   +LF LGY+I      W G         L   ++ L  WN +L Y    I +K  LQ+  CV++   D    + K  C +  +  I C+   E H+         + ++E   G+I     +DV+   FL+ Q +IF +  F + +++ +      +RGA+L N+ +   + E+ E++   F  ++    R E   + Y + +          P  +    R+GDY++F+       YD   DD  E +  F  + D   K  + + LD    M   +  D+   +            + K   I  P +R+                         L +     +         +  ED   KDS  E  +K+ +K             + LD   + +N L ++ RYV  +L  EK+ +K+           G  E+                     L+ T      +   V+L ++ +    + + K+                ET+ +  +Q+ SS   LL  A+ N +  ++D+LCY   +M  +++  +++L  PL    W  LS PRPS F+W+ +I YT+ VI+IK+V QF F+   S     E    P  L    G+++ + +AL D++ LF LF HR  L+  GLWK     D F +KE  +                     T  +TL+ +S     I   P                      + +F   L   ++    D+Y  MF  + I F I+  GY AFG   G +   LD +K S+IP+  ++ML+   + IIIDRAL+LRK V+GKL++Q+  +  +H+W+F + P ++R    +    Q LY  K  YF +S++QI++GYP   +GN LT  Y   N+  FK ++ +PFL+ELR  +DW WTDT++ L+ +  +E+ +A IF +KC R+ E  YP PRG  +  + KY++G  ++I   +  + PL+L S++  I   + P    L +  +G+  +YE  ++G             D L    QA++D       +    + +++S++K +  +D+ I+     SE  W I+  +++  +   L +  ++N    +E  R  +P++    K    +    +L +T R +I S       + +L+ + +P F+ V  + +      +G+   N  NP  +   M   + + + W+        Q  S  E   ++ +    D+  K +I                 F +R   +   ++F    I    +  + V   L+R +++     +   ELP  D +LK+  +IYLVRE K F LE+ L AKLIF++RS  T+I +TR+ +
Sbjct:  316 YPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAY-LIGDFFVLLLASCQLAVFRRE--------GEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCV-NNECHVLKELEDFSKACAVETKEGNIG----FDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRR---RTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFK-------YDPENDDLVEPVDSFVPEVDP--KATAYDRLDPGQIMYAATAHDLDLAKT--------VQQVKKGDTIKDPDSRA-------------------------LIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQK----------MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKS-----------GHSES---------------------LSNTSRKLTDIRSAVDLPSLQLVQSANDVEKM----------------ETAVSVDWQQKSSATRLL-NAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG--EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDK-LSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARA-WFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK 1682          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 409.838 bits (1052), Expect = 3.596e-115
Identity = 382/1489 (25.65%), Postives = 652/1489 (43.79%), Query Frame = 3
Query: 2277 YPFHF--PYLLEDWLFLPSYL--------NPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNE-----LPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQF-----ILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYI---DHIINYSK--CWLIHILGIHCIPTRENHI---------SISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL----------PNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLD---YMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKD-SPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK--GFKDKFNIKEPEKK--------------------TNFNTLQTSSLTSRFILLKPFIT-------------------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRG-------------DML----QAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECER--NPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-KGLPRFL-VATKTDFQDALVLGSE--NSLNPLESYMIMLSIERSTSDWW--------QLHSHKEFDCLSRNPFSPDK-TKFFI-----------------FSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            YP+ +  P   +D  F  SYL        N P AY LIGD    +  + Q  VF+ E        GE+   ++N+      P+    DFI  K SY+DY K  +F + +W+TL      GI   +LF LGY+I      W G         L   ++ L  WN +L Y    I +K  LQ+  CV++   D    + K  C +  +  I C+   E H+         + ++E   G+I     +DV+   FL+ Q +IF +  F + +++ +      +RGA+L N+ +   + E+ E++   F  ++    R E   + Y + +          P  +    R+GDY++F+       YD   DD  E +  F  + D   K  + + LD    M   +  D+   +            + K   I  P +R+                         L +     +         +  ED   KDS  E  +K+ +K             + LD   + +N L ++ RYV  +L  EK+ +K+           G  E+                     L+ T      +   V+L ++ +    + + K+                ET+ +  +Q+ SS   LL  A+ N +  ++D+LCY   +M  +++  +++L  PL    W  LS PRPS F+W+ +I YT+ VI+IK+V QF F+   S     E    P  L    G+++ + +AL D++ LF LF HR  L+  GLWK     D F +KE  +                     T  +TL+ +S     I   P                      + +F   L   ++    D+Y  MF  + I F I+  GY AFG   G +   LD +K S+IP+  ++ML+   + IIIDRAL+LRK V+GKL++Q+  +  +H+W+F + P ++R    +    Q LY  K  YF +S++QI++GYP   +GN LT  Y   N+  FK ++ +PFL+ELR  +DW WTDT++ L+ +  +E+ +A IF +KC R+ E  YP PRG  +  + KY++G  ++I   +  + PL+L S++  I   + P    L +  +G+  +YE  ++G             D L    QA++D       +    + +++S++K +  +D+ I+     SE  W I+  +++  +   L +  ++N    +E  R  +P++    K    +    +L +T R +I S       + +L+ + +P F+ V  + +      +G+   N  NP  +   M   + + + W+        Q  S  E   ++ +    D+  K +I                 F +R   +   ++F    I    +  + V   L+R +++     +   ELP  D +LK+  +IYLVRE K F LE+ L AKLIF++RS  T+I +TR+ +
Sbjct: 1072 YPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAY-LIGDFFVLLLASCQLAVFRRE--------GEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCV-NNECHVLKELEDFSKACAVETKEGNIG----FDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRR---RTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFK-------YDPENDDLVEPVDSFVPEVDP--KATAYDRLDPGQIMYAATAHDLDLAKTV--------QQVKKGDTIKDPDSRA-------------------------LIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQK----------MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKS-----------GHSES---------------------LSNTSRKLTDIRSAVDLPSLQLVQSANDVEKM----------------ETAVSVDWQQKSSATRLL-NAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG--EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDK-LSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARA-WFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK 2438          

HSP 2 Score: 58.9214 bits (141), Expect = 5.426e-8
Identity = 92/363 (25.34%), Postives = 162/363 (44.63%), Query Frame = 2
Query:  557 KKNRFTEHIHNTETTATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNIN-----GDEI-MNTIKIFFEPYFEISEFGIFEWKI----PFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRAR-----------------SSVIFED--NSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVF----DMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR 1546
             +N+ + +I NT        A S   I +V+T ++ +SY  +  AMM W++ Y S    +LLIL CILW+  D+R +   M+P I+ Y   L+ + Y  +++     GD   MN + I              EW        I L +     +  +L LRL  +EK   S+S    + R                 +   F+D  +  F + V +L    + Y+IF  ++ LL+VS         +++     + + +  FS+  +R   Y +W  +  Y+  V+  +Y +QF    +     T  +QE L   G   F    +  +L   LL+P+ L +VT++Q+ +FH P+ + +  +P+R
Sbjct:  431 DRNKLS-NIFNTTAPGDKESAASKGMI-AVMTFVIFHSYSIALTAMMTWALLYHSIFGLILLILTCILWIFRDTRKSSFAMAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGI--------------EWTTLPVHAVIILCVQTLLTLPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTGAGGVAVAKFQDPKSRKFAAFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALWALNLIYLKFSFRLYRGLAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEWLNAIGLVDFRAIGESGALFLQLLAPIALFVVTMLQLKFFHGPWSRAT--SPRR 775          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Match: pezo-1 (Piezo-type mechanosensitive ion channel component [Source:UniProtKB/TrEMBL;Acc:A0A061AE33])

HSP 1 Score: 409.838 bits (1052), Expect = 3.958e-115
Identity = 382/1489 (25.65%), Postives = 652/1489 (43.79%), Query Frame = 3
Query: 2277 YPFHF--PYLLEDWLFLPSYL--------NPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNE-----LPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQF-----ILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYI---DHIINYSK--CWLIHILGIHCIPTRENHI---------SISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL----------PNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLD---YMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKD-SPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK--GFKDKFNIKEPEKK--------------------TNFNTLQTSSLTSRFILLKPFIT-------------------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRG-------------DML----QAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECER--NPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-KGLPRFL-VATKTDFQDALVLGSE--NSLNPLESYMIMLSIERSTSDWW--------QLHSHKEFDCLSRNPFSPDK-TKFFI-----------------FSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            YP+ +  P   +D  F  SYL        N P AY LIGD    +  + Q  VF+ E        GE+   ++N+      P+    DFI  K SY+DY K  +F + +W+TL      GI   +LF LGY+I      W G         L   ++ L  WN +L Y    I +K  LQ+  CV++   D    + K  C +  +  I C+   E H+         + ++E   G+I     +DV+   FL+ Q +IF +  F + +++ +      +RGA+L N+ +   + E+ E++   F  ++    R E   + Y + +          P  +    R+GDY++F+       YD   DD  E +  F  + D   K  + + LD    M   +  D+   +            + K   I  P +R+                         L +     +         +  ED   KDS  E  +K+ +K             + LD   + +N L ++ RYV  +L  EK+ +K+           G  E+                     L+ T      +   V+L ++ +    + + K+                ET+ +  +Q+ SS   LL  A+ N +  ++D+LCY   +M  +++  +++L  PL    W  LS PRPS F+W+ +I YT+ VI+IK+V QF F+   S     E    P  L    G+++ + +AL D++ LF LF HR  L+  GLWK     D F +KE  +                     T  +TL+ +S     I   P                      + +F   L   ++    D+Y  MF  + I F I+  GY AFG   G +   LD +K S+IP+  ++ML+   + IIIDRAL+LRK V+GKL++Q+  +  +H+W+F + P ++R    +    Q LY  K  YF +S++QI++GYP   +GN LT  Y   N+  FK ++ +PFL+ELR  +DW WTDT++ L+ +  +E+ +A IF +KC R+ E  YP PRG  +  + KY++G  ++I   +  + PL+L S++  I   + P    L +  +G+  +YE  ++G             D L    QA++D       +    + +++S++K +  +D+ I+     SE  W I+  +++  +   L +  ++N    +E  R  +P++    K    +    +L +T R +I S       + +L+ + +P F+ V  + +      +G+   N  NP  +   M   + + + W+        Q  S  E   ++ +    D+  K +I                 F +R   +   ++F    I    +  + V   L+R +++     +   ELP  D +LK+  +IYLVRE K F LE+ L AKLIF++RS  T+I +TR+ +
Sbjct: 1030 YPWSYWIPSYSDDARFNLSYLLNLSIYGVNWPSAY-LIGDFFVLLLASCQLAVFRRE--------GEDNDSIYNDGNFVIKPENPQYDFIDTKKSYVDYFKSFVFHYGHWITLMSTLAAGIAGTSLFALGYIIFTLTMLWSGNNLYVMNSTLRSFEHTLKRWNALLGYTLFTITMKVCLQIFGCVFLSWFDQSGGWGKTLCIVRQLFSITCV-NNECHVLKELEDFSKACAVETKEGNIG----FDVIALSFLVFQIRIFHSWYFQHCMVEYRSEVILANRGAVLKNQLIEKEMKEQNEQQKAKFNDIRR---RTEAIRERYQKQIERGAAERDFEPVTYGHAKRAGDYYMFK-------YDPENDDLVEPVDSFVPEVDP--KATAYDRLDPGQIMYAATAHDLDLAKTV--------QQVKKGDTIKDPDSRA-------------------------LIAVSEPEARKPGGTEETDGDEDEDNKDSKVESTAKFIQK----------MIASALDLCSVTLNKLCREHRYVGFVLSKEKQKLKS-----------GHSES---------------------LSNTSRKLTDIRSAVDLPSLQLVQSANDVEKM----------------ETAVSVDWQQKSSATRLL-NAVVNCIGAHTDILCYFFAIMTQVMTGGLITLPLPLMSLFWGNLSNPRPSKFFWVTMITYTECVIVIKFVCQFAFMPYNSITWRTEHQMDPMSLDKLFGVSQRDSFALWDIVLLFSLFFHRYMLRKLGLWKDANLTDTFTLKEEPRSASGSDTGSPKKIAQEPKVVVTQSDTLEGTSGGEIVIPSDPNAVSNMEELDCEPPIPEKQSGPIGRFIHQLFHPKFRYIRDLYPIMFGIDVICFLIMTFGYSAFG--EGGSGNVLDDVKASRIPVTLVVMLVGMTLAIIIDRALYLRKSVVGKLIYQVLMIAFLHIWVFLVLPNMTRRSAISNHVAQALYVIKSCYFLVSAWQIRNGYPELCIGNLLTHSYGMTNMIAFKVFMNIPFLFELRTAIDWTWTDTSMPLFDFFNMENFYAHIFNIKCARQFEAAYPAPRGIPKGKLVKYMMGFPIIIGVVIFIFSPLLLWSLLNQIGTISMPEKVTLRISIEGYPPLYEMEAQGSNHDNAELGMIKPDQLASLNQALTDSYTTRDTNSILRSRMSVSYLKGYTYEDILIVRFRPESEIYWPISQDSRNAMIDK-LSRNTSVNFEVSLEFTRPYDPNENAALKHSKSWLVPISLDMTIRAKIQSALRGDPGHPILIPQSIPAFIQVPNQGELTLPTSIGNTIINDGNPRINTTGMEKSDEARA-WFDSLTLNLEQGKSQNEKMWIATSEHPGDQNAKLWIKTANTTYSGRPYLQVVGFIDRAFPSFLAKVFKGGVIAVYLSVILVVGRGLVRGIFTTSPSTVMFTELPNADHLLKICLDIYLVREAKDFMLEQDLFAKLIFLFRSPATLIEWTRMSK 2396          

HSP 2 Score: 60.8474 bits (146), Expect = 1.536e-8
Identity = 122/503 (24.25%), Postives = 200/503 (39.76%), Query Frame = 2
Query:  299 VLYMYQIGI------------TKLLGLYYKIDTSCERHGSVTILQQRFFD---------FMNPFALFALFYIHSLDSKIWLD--REAIQN--------LALFTKSSSSQNTNAAVSQKKNRFTEHIHNTE-------------------------TTATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNIN-----GDEI-MNTIKIFFEPYFEISEFGIFEWKI----PFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSS--QIDRARSSVIFEDNST---------------FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVF----DMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR 1546
            VLY YQI I             +L GL   +D+SC        +   F D         + NP  +   FY+     K   +  RE I +          L + +SSS N +    Q + R    + N E                         T      A S   I +V+T ++ +SY  +  AMM W++ Y S    +LLIL CILW+  D+R +   M+P I+ Y   L+ + Y  +++     GD   MN + I              EW        I L +     +  +L LRL  +EK   S+S   +  R  S   F  + T               F + V +L    + Y+IF  ++ LL+VS         +++     + + +  FS+  +R   Y +W  +  Y+  V+  +Y +QF    +     T  +QE L   G   F    +  +L   LL+P+ L +VT++Q+ +FH P+ + +  +P+R
Sbjct:  251 VLYTYQIPIVHHSWLPTGSFLPRLFGLTVLMDSSCPEWWKFPFVAPDFNDDDLIMKWPLYANPIVVLVFFYLTVAQYKFTRNGSREYIDDNEYGSSVHEELLSNASSSANDD---EQGRARSRSPLRNGEEQGSIPLRKVTSQVVDRNKLSNIFNTPGDKESAASKGMI-AVMTFVIFHSYSIALTAMMTWALLYHSIFGLILLILTCILWIFRDTRKSSFAMAPIILMYIEFLLILQYFLSMDIHAEIGDPAWMNFVGI--------------EWTTLPVHAVIILCVQTLLTLPVFLLLRLARREKFYESLSDYERQRRINSYGTFGASKTGAGGVAVAKDPKSRKFAAFVEYLSNKVSVYFIFVVSVVLLVVSTCFAPNFYNILFFALWALNLIYLKFSFRLYRGLAYAFWLTLTFYTSIVIIALYIYQFPGVSQWIIRNTSLSQEWLNAIGLVDFRAIGESGALFLQLLAPIALFVVTMLQLKFFHGPWSRAT--SPRR 733          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335175)

HSP 1 Score: 416.772 bits (1070), Expect = 4.737e-117
Identity = 271/896 (30.25%), Postives = 471/896 (52.57%), Query Frame = 3
Query: 3891 QTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            Q   H +    ++EL    V     +   I++ P           +E       Q+    +  ++++    ++  +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1815 QQHQHIRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGAGEFNLEEENFA----QRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2687          

HSP 2 Score: 157.918 bits (398), Expect = 6.818e-38
Identity = 116/398 (29.15%), Postives = 181/398 (45.48%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQ-------------NYGRPLPNE----------HYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRN 3365
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q              +G PLP            H    R+GDY++FEE  ++ E  D I D  +FL+     ++ ++K +  + L Y +   ++D +++R+
Sbjct: 1137 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMFEEMDDKFEL-DLIHDEIDFLEE-ENITESEMKMQRRKTL-YDVWKDLNDAEYRRH 1529          

HSP 3 Score: 137.502 bits (345), Expect = 1.055e-31
Identity = 112/377 (29.71%), Postives = 182/377 (48.28%), Query Frame = 2
Query:  461 DSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEIS-EFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFM 1519
            + ++ L R++ +         S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++        +I  E  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+
Sbjct:  419 NQRLSLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFI 794          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335182)

HSP 1 Score: 416.387 bits (1069), Expect = 4.969e-117
Identity = 271/896 (30.25%), Postives = 471/896 (52.57%), Query Frame = 3
Query: 3891 QTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            Q   H +    ++EL    V     +   I++ P           +E       Q+    +  ++++    ++  +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1657 QQHQHIRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGAGEFNLEEENFA----QRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2529          

HSP 2 Score: 166.007 bits (419), Expect = 2.328e-40
Identity = 110/342 (32.16%), Postives = 163/342 (47.66%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNE-HYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLK 3263
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q   RPL  + H+   R+GDY++FEE  ++ E  D I D  +FL+
Sbjct: 1085 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDATRAGDYYMFEEMDDKFEL-DLIHDEIDFLE 1423          

HSP 3 Score: 147.902 bits (372), Expect = 7.908e-35
Identity = 131/458 (28.60%), Postives = 211/458 (46.07%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFF--DFMNPFALF------ALFYIHSLDSKIWLDREAIQNLALFTKSS-----------------SSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEISEFGIFEWKI-----PFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTP 1540
             +L+GL   I++ C     V +   +     ++NPFALF      AL   H +  ++ L R+    L   T+++                 S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++         + + G FE  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+      P
Sbjct:  294 ARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRVSLRRDQRATLNEPTETTPLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPYLQTAGINLQQIG-FERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFIASLQQQP 749          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0347414)

HSP 1 Score: 416.772 bits (1070), Expect = 5.080e-117
Identity = 271/896 (30.25%), Postives = 471/896 (52.57%), Query Frame = 3
Query: 3891 QTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            Q   H +    ++EL    V     +   I++ P           +E       Q+    +  ++++    ++  +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1944 QQHQHIRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGAGEFNLEEENFA----QRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2816          

HSP 2 Score: 146.362 bits (368), Expect = 2.049e-34
Identity = 126/428 (29.44%), Postives = 205/428 (47.90%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFF--DFMNPFALFALFYIHSLDSK----IWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEIS-EFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFM 1519
             +L+GL   I++ C     V +   +     ++NPFALF  ++  +L +K      L R++ +         S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++        +I  E  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+
Sbjct:  294 ARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFI 720          

HSP 3 Score: 145.206 bits (365), Expect = 5.297e-34
Identity = 99/321 (30.84%), Postives = 145/321 (45.17%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPL-----------PNEHYL 3170
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q   RPL           P+EH +
Sbjct: 1063 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDGRRTPSEHAM 1381          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335176)

HSP 1 Score: 416.387 bits (1069), Expect = 5.421e-117
Identity = 262/821 (31.91%), Postives = 447/821 (54.45%), Query Frame = 3
Query: 4116 SDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1848 TDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2649          

HSP 2 Score: 157.918 bits (398), Expect = 6.183e-38
Identity = 116/398 (29.15%), Postives = 181/398 (45.48%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQ-------------NYGRPLPNE----------HYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRN 3365
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q              +G PLP            H    R+GDY++FEE  ++ E  D I D  +FL+     ++ ++K +  + L Y +   ++D +++R+
Sbjct: 1137 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMFEEMDDKFEL-DLIHDEIDFLEE-ENITESEMKMQRRKTL-YDVWKDLNDAEYRRH 1529          

HSP 3 Score: 137.887 bits (346), Expect = 8.299e-32
Identity = 113/384 (29.43%), Postives = 183/384 (47.66%), Query Frame = 2
Query:  461 DSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEIS-EFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTP 1540
            + ++ L R++ +         S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++        +I  E  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+      P
Sbjct:  419 NQRLSLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFIASLQQQP 801          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Match: Piezo (gene:FBgn0264953 transcript:FBtr0335179)

HSP 1 Score: 416.001 bits (1068), Expect = 6.328e-117
Identity = 271/896 (30.25%), Postives = 471/896 (52.57%), Query Frame = 3
Query: 3891 QTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            Q   H +    ++EL    V     +   I++ P           +E       Q+    +  ++++    ++  +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1657 QQHQHIRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGAGEFNLEEENFA----QRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2529          

HSP 2 Score: 156.377 bits (394), Expect = 2.184e-37
Identity = 111/364 (30.49%), Postives = 163/364 (44.78%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQ-------------NYGRPLPNE----------HYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLK 3263
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q              +G PLP            H    R+GDY++FEE  ++ E  D I D  +FL+
Sbjct: 1063 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMFEEMDDKFEL-DLIHDEIDFLE 1423          

HSP 3 Score: 147.517 bits (371), Expect = 9.760e-35
Identity = 127/435 (29.20%), Postives = 206/435 (47.36%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFF--DFMNPFALFALFYIHSLDSK----IWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEIS-EFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTP 1540
             +L+GL   I++ C     V +   +     ++NPFALF  ++  +L +K      L R++ +         S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++        +I  E  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+      P
Sbjct:  294 ARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFIASLQQQP 727          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 392.119 bits (1006), Expect = 3.057e-116
Identity = 225/602 (37.38%), Postives = 348/602 (57.81%), Query Frame = 3
Query: 4566 LLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESY-------MIMLSIERSTS------DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            +L  +I +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  +++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNYLNLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++ + L+ +++ ++    + Y     A+ F++++  +DVT+  +   S S+W+I+PP++   M  +L K+    +      +RN S             V  L +  R E+ +L    +   VL++ + P F+ A            S+++  P+E          I L +ERS +      +WW +   +      R        + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct:  265 VLDVYIPIRQFFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLM-DVLSKEDQFPVTMTWSIQRNLS-LGAKSEFAMDKHVTYLDIKTRQELIALLNGTRNTPVLIEQVFPCFIRAP-----------SDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQKQQREA----GLQLYVFSDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 847          

HSP 2 Score: 110.538 bits (275), Expect = 9.716e-24
Identity = 61/145 (42.07%), Postives = 97/145 (66.90%), Query Frame = 3
Query: 4038 QAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            Q+++F +S  +L  L  ++ N+++ +S M+CY+++++NHMIS ++ +L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F      +  ++K  PF  P  +G+ K E Y   DL+QL  LF HR  LK +GLW
Sbjct:    9 QSERFYRSQPQLLQLCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQSIE-VDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLW 152          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: LO018508.1 (pep chromosome:GRCz11:2:54327160:54353625:1 gene:ENSDARG00000112723.1 transcript:ENSDART00000182320.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:LO018508.1)

HSP 1 Score: 378.252 bits (970), Expect = 1.939e-114
Identity = 231/602 (38.37%), Postives = 341/602 (56.64%), Query Frame = 3
Query: 4587 VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLV-----KGLPRFL------VATKTDFQDALVLGSENSLNPLES----YM-IMLSIERSTS-----DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG   G        L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P I+  +++     Q  YF KC+YF LS+YQI+ GYP RILGNFLTK YNY NLFLF+G+ L+PFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    ++L   G   I+  ++           + N+IK    N   A+ F++S+ P+D+TI ++   S S+W+I+PP+K+             NL +M+   R P           ++  +NLSL  + E A       KY + +     KGL   L      V  K  F   +   S+++  P++     YM I L + +  S     +WW ++   + D       +    + +I S+++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct:   26 IRQFFYNLVHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHQGGADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVVGKVIFQVILVFGIHFWMFFILPGITERRFSQNTIAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKSYNYANLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLEVSVSLTLGGLQPIFTMSA-----------QQNHIKSVTGN---AIMFLESYFPEDLTIAHLEGSSNSLWTISPPSKE-------------NLKNMLNDTREP-----FPLTFTWSIQRNLSLGAKAETAM-----GKYFIELDDETRKGLTDQLGNSSQRVTIKKIFPRYIRAPSDSNAKPIDQLYNEYMDITLFLNKKNSSEGVQEWWIVN---QTDSGPLPGLNGSGLQIYIISDQVSPPSLG-FLAGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTREK 585          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-131119-76])

HSP 1 Score: 390.578 bits (1002), Expect = 7.984e-109
Identity = 225/602 (37.38%), Postives = 348/602 (57.81%), Query Frame = 3
Query: 4566 LLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESY-------MIMLSIERSTS------DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            +L  +I +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  +++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNYLNLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++ + L+ +++ ++    + Y     A+ F++++  +DVT+  +   S S+W+I+PP++   M  +L K+    +      +RN S             V  L +  R E+ +L    +   VL++ + P F+ A            S+++  P+E          I L +ERS +      +WW +   +      R        + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2038 VLDVYIPIRQFFYSLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYLNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKELTESDFKNFINSYNYVPSAMQFLEAYRAEDVTVAELEGSSNSLWTISPPSRKNLM-DVLSKEDQFPVTMTWSIQRNLS-LGAKSEFAMDKHVTYLDIKTRQELIALLNGTRNTPVLIEQVFPCFIRAP-----------SDSNAKPIEQLYEDGVYKSIQLDLERSANSSEDLQEWWIVDELRSAQKQQREA----GLQLYVFSDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2620          

HSP 2 Score: 128.642 bits (322), Expect = 6.600e-29
Identity = 96/302 (31.79%), Postives = 156/302 (51.66%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVS----SQIDRARSSVIFEDNST-----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFV LI +C LW++ D R   +V SPF+V YG +LI + Y+ +    E +  +   F            + ++PF  L      L+ FWL LR ++ E+          S +      +  +D +       + L   L  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y  WR  +  +W  V+VY++ VL  +YTFQF+    +W N T  ++E L+D G E F + +L   +  P   L+V I+ +HYFH  F++++D+
Sbjct:  398 IMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYSMVTSPFMVFYGNLLIILQYIWSF---ECLQPVPGLF-----------LKKEVPFRELGSKTLCLLSFWLLLRQFLTERREKHTDDPQLSDVTVDGHKLGLQDEAAGHREMMEVLGSSLMAMLNKYWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQLHYERWRWMLKYFWMSVVVYTMLVLILVYTFQFESSINVWSNMTGMSREKLEDLGLEKFSVPALFTRIFIPTWFLLVCILHLHYFHERFLELTDI 685          

HSP 3 Score: 122.479 bits (306), Expect = 5.689e-27
Identity = 82/301 (27.24%), Postives = 148/301 (49.17%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN-NIYKYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGD 3188
            WL+ P +   P +  L+ D +  +C +LQ  VF+ E  +  +   G+N  I  +    T  +     DFI  + SY+D LK ++F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  + CWLI +  + C     +         C   +++    WD +CF FL++QR++F +  F +VV D++ +    SRGA L    ++  +    E+E +    +K ++ RI+   Q + R       L   SG+
Sbjct: 1087 WLYFPDFHTKPNSLFLLYDFMLLLCASLQGRVFEEECVSPVQLLAGDNVEICRDLDAATFSQHNPVPDFIHCR-SYLDMLKVMVFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLIFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKALVA-NHCWLIQLFSLACTIKGYSKPEQQANKQCELPSDEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRSSQLLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQKFKRGKERMLSLAQESGE 1385          

HSP 4 Score: 110.538 bits (275), Expect = 2.345e-23
Identity = 61/145 (42.07%), Postives = 97/145 (66.90%), Query Frame = 3
Query: 4038 QAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            Q+++F +S  +L  L  ++ N+++ +S M+CY+++++NHMIS ++ +L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F      +  ++K  PF  P  +G+ K E Y   DL+QL  LF HR  LK +GLW
Sbjct: 1782 QSERFYRSQPQLLQLCYSLYNVLVSHSQMVCYLVIILNHMISASVATLVLPVLIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQSIE-VDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCYGLW 1925          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 362.844 bits (930), Expect = 2.271e-100
Identity = 224/588 (38.10%), Postives = 341/588 (57.99%), Query Frame = 3
Query: 4596 FYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTE----RTEIASLFTIPKKYAVLVKGL-PRFLVA-TKTDFQDALVL--GSENSLNPLE-SYMIMLSIERSTS-DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            F+ N+    Y    DVY  MF+ + + F II+ G+ AFG  + +   A   L + ++P  F++ML+ QF  +IIDRAL+LRK ++GKL+FQ+  V  IH+W+FF+ P ++   +N     Q  YFFKC+YF LS+YQI+ GYP RILGNFLTKK+N+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL +WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL+++F     W PL+  S++ S+  V N P    +T++  G+  ++  + +   +Q  ++  YN + + +  N VA+ F+  +  +D+    I   S S+W I+PP++   +K LL     M L      +R   D     TV +     ++SL      R ++ASL    +K  V V  + P ++ A +  + +  + L  G E     +  S M   S+  + + +WW +      DC       P      IF++++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP  DRILKL  +I+LVRE     LEE+L +KLIF+YRS ETMI++TR K
Sbjct: 1858 FFQNILHAEYRASTDVYALMFLTDVVDFIIIIFGFWAFGKHSAAADIA-SSLSEDQVPEAFLVMLLIQFSTMIIDRALYLRKSILGKLIFQVILVFGIHLWMFFILPAVTERMFNHNSVAQLWYFFKCIYFTLSAYQIRCGYPTRILGNFLTKKFNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKRIVKYGMGGLIILFLICIIWFPLLFISLVKSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTESRYNQLNNQFSKNAVAMQFITMYSYEDIVTANIEGSSGSVWRISPPSRQELIKELLSSTGDMTLRLDWNFQR---DLGKGGTVENTFDKHSISLAPKNPVRADLASLLLGTRKDPVHVPHMFPNYIRAPSGAEAKPVMQLFDGDEEGFQDVTVSLMREASVNTTGAQEWWDISIA---DCKESCNVLP----MIIFNDKVSPPSLG-FLAGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCADRILKLCMDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTREK 2433          

HSP 2 Score: 148.288 bits (373), Expect = 6.390e-35
Identity = 127/403 (31.51%), Postives = 200/403 (49.63%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGD-EIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKE----KIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLH-HEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELNYLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIV 1846
            +++ SYI + IAMM WS+TY SWLTFVLL+ +C++W+L   +      SPFI+ YG+ L  + YV  ++ + E+   I         + + G+   + P + L   + + + FWL LR  +K+    K  L+V  Q +         + S  K     +  L AKYWI+ C    ++VS   ++    +VYM+  ++ M  +   YS WRR +  +WW+V+ Y++ VL  IYTFQF+ F   W N+T FT++ L D G E F +S L   ++ P   L+  I+Q+HYFH PFMK++D            LE  + +H HE      E     +Q++Y                 D        LV D    + +L+RK      ++   IWR+LE+H  KI+ 
Sbjct:  408 VLQQSYICALIAMMVWSITYHSWLTFVLLLWSCVIWMLRTRQRFAAYCSPFILLYGLALCCLQYVWAMDLETELPQHIG-----SMSLHQLGLDRAQYPCLRLGALLLFTLTFWLLLRQSVKDTFSRKKSLTVPLQ-EVTTGESTGRNESILKVFGGLVMSLYAKYWIYVCGGMFIMVSFAGKLVAYKIVYMLLFLLCMCLYQVYYSLWRRLLKAFWWMVVAYTMVVLIAIYTFQFEDFPGYWGNFTGFTEQQLADMGLETFKLSELFTSIVIPGFFLLACILQLHYFHKPFMKITD------------LENVSPIHRHE----PEEEELIVDQDDYPSEA-------------DEVIPSKWGLVMD---RLMVLSRKFSDTLTHVQSFIWRVLELHIVKIVA 772          

HSP 3 Score: 133.65 bits (335), Expect = 1.853e-30
Identity = 99/311 (31.83%), Postives = 163/311 (52.41%), Query Frame = 3
Query: 3660 YTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENI----------DVKLYYDKINKIDNEPHINNTNNVIF------VDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVN-ALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW---KGFKDKFNIKEPEKKTNFNT 4532
            +  FL  +D   + +NLLTK       +L  E+ L    +          S EN      +Q      ++ L   L +T+        VVE E +             L  +   ++D EP  + T + +       VDE  Q+++F  S +RL  L+ A+ N++  +S+++CY I+V+N++++ +++SL+ P+ VFLWAMLS PRPS  +W+  I+YT++++++KY+FQF F    ++    L +D PFF P  LG+ KT++Y   DLLQL VLF HR  L+ +GLW      ++K ++   E K N  T
Sbjct: 1468 WVLFLAMVDGFTMWLNLLTKQYVDTSMVLSEERYLFIHNV------SQRASREN----MDDQISHDSEDLTLETCLDETDTDNICDTNVVESETLGGFAKSRDFSSTTLSSELTLELDCEPFYSQTASELLSERPFRVDELIQSREFYSSQNRLLKLLFALYNVLAAHSELVCYFIIVLNNLVTASVISLVLPVLVFLWAMLSVPRPSKRFWMTAIIYTEVMVVVKYLFQFGFFPWNTEYELKLNEDKPFFPPRILGLEKTDNYIRYDLLQLLVLFFHRSLLQRYGLWDQEGPLEEKSDLSPAENKPNTET 1768          

HSP 4 Score: 120.553 bits (301), Expect = 1.888e-26
Identity = 95/352 (26.99%), Postives = 163/352 (46.31%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN-NIYKYKGGENRP-------IVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI--------PTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNY--GR------PLPNE-------------------HYLVLRSGDYFLFE-EHQEEDE 3224
            L  W++LP +   P +  LI D +  MC + Q+ VF  E    +   GGENR        ++FN  P     +FI N  SY+D  K ++F + +W  L +VF  G  R ++F LGY++    +   G + +    +  L  W+ ++ YN  +I+ K  L +++CV++   +  + CW+I +  + C                S+ +E +         WD +CF FL++QR++F +  F +V  D++ + +  SRG  L    ++  +   ++ E +   ++KE + RI    Q Y  GR        P+E                   H  VL SG+Y++FE +  EEDE
Sbjct: 1034 LVKWMYLPDFYTVPNSKNLISDFLLLMCASQQWTVFDNEKKEEWMVMGGENRDNPDPMENMLFNPAP-----NFI-NCRSYLDMAKILVFRYMFWFVLSVVFVTGATRISVFGLGYLMACFFFLLFGTKLLTKPSRTRLVMWDCLIIYNVAVIISKNILSILACVFVME-MQKNFCWVIQLFSLVCTVKGYYDPESVCNKDCSLPVEEA------GIIWDSICFFFLLLQRRVFLSFYFLHVSADLQASARQASRGFELFRASIIKNMHFHQQAERKSIQQLKESMKRIRGKQQKYKDGRITSDIEEQPSEQKKETKLSKSKSWQYPWVDHATVLHSGEYYMFESDSGEEDE 1372          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Match: si:dkey-11f4.7 (si:dkey-11f4.7 [Source:ZFIN;Acc:ZDB-GENE-070912-361])

HSP 1 Score: 264.618 bits (675), Expect = 4.507e-79
Identity = 128/286 (44.76%), Postives = 186/286 (65.03%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFS 5423
            L  ++ +++F+ ++    YS   DVY  MF+ + ++F II+ GY AFG  + +     + L + ++P  F++ML+ QF  +I+DRAL+LRK ++GK VFQ+  V  IH W+FF+ P ++  ++N     Q  YF KC+YF LS+YQIK GYP R+LGNFLTK +NY NLFLF+G+ LVPFL ELR VMDW+WTDT LSL +W+ VED++A IF+LKCWR +E +YP  RG  +  V KY +GG ++       W PL+  S++ S+  V N P    + L   G+ 
Sbjct:    3 LHIYLPIRQFFYDIIHPEYSPVCDVYALMFLIDVVNFIIIIFGYWAFGKHSAAADIT-ESLSEDQVPEAFLVMLLIQFSTMIVDRALYLRKTLLGKCVFQVVLVFGIHFWMFFILPGVTERRFNRNRVAQLWYFVKCIYFGLSAYQIKCGYPNRVLGNFLTKNHNYFNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSNWICVEDIYANIFILKCWREAEKKYPHRRGQRKKKVVKYTMGGFIIFALICIVWFPLLFMSLVKSVAGVTNQPLDVSIQLSILGYE 287          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 513.457 bits (1321), Expect = 1.259e-148
Identity = 304/822 (36.98%), Postives = 467/822 (56.81%), Query Frame = 3
Query: 4008 NNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW----------------------KGFKDKF---------------NIKEPEKKTNFNTLQTSS------LTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQD----ALVLGSENSLNPLESYMIMLSIERSTSDWWQL-HSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            N + + +E   +++F  +  R   LI A+ N ++  S+M+CY ++++NHMIS +M++L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     +V+   KD P+F P  +GI K E Y   DL+QL  LF HR  LK HGLW                       G +D                 ++  PE+KT      TSS       +S   +L+ ++ +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++ + LQ ++D+E+ ++ + YK N  A+ F++S+  +D+TI  +   S S+W+I+PP++ + ++ L+ +    +  ++I                        SL  + E+       +KY + + G  R  +A   + Q+    +++L  EN+                  +WW +  SHKEF          D  + ++FS+++S    G L + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 1296 NKMFYDEELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVD-YTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERLIQEP---DFTAVISWSIR-------------------SLGAKAEVTG-----EKYTISLAGQTRRELADMMNNQEFVNISVLLRKENT-------------SEGVREWWVVNQSHKEF-------IKKDGLELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2067          

HSP 2 Score: 149.058 bits (375), Expect = 6.375e-35
Identity = 99/288 (34.38%), Postives = 154/288 (53.47%), Query Frame = 2
Query:  692 MMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNI--NGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVS----SQIDRARSSVIFED-NSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            + AWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +I    DE+   +             G+ E K P   L+  I + V FWL LR ++ E+  L       S+I         ED N   K L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y +WRR +  +W  V+VY++ VL  IYT+QFK F  LW N T   +E L D G E F+++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  245 LQAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEVM-------------GLLERKKP-EELVSKIIFTVTFWLLLRQHLTEQKALKQKELALSEIKVGSEDKEVEDENDIMKVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDL 518          

HSP 3 Score: 85.5001 bits (210), Expect = 1.048e-15
Identity = 70/244 (28.69%), Postives = 119/244 (48.77%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSR 3017
            WL+ P ++  P    L+ D +  +C +LQ  VF+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K I+F + +W  L I+F  G  R ++FC+GY++    +   G   +L   + +L  W+ ++ YN  +I +K N+  VS ++         CWLI    + C  T + +        C   + +    WD +CF FL++QR++F +  F +VV D+K +    SR
Sbjct:  849 WLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMK-NVLSVSVLF--------HCWLIQAFSLSC--TVKGYFIPQNTPDCQLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1080          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 511.531 bits (1316), Expect = 2.397e-148
Identity = 303/816 (37.13%), Postives = 464/816 (56.86%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW----------------------KGFKDKF---------------NIKEPEKKTNFNTLQTSS------LTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQD----ALVLGSENSLNPLESYMIMLSIERSTSDWWQL-HSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            +E   +++F  +  R   LI A+ N ++  S+M+CY ++++NHMIS +M++L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     +V+   KD P+F P  +GI K E Y   DL+QL  LF HR  LK HGLW                       G +D                 ++  PE+KT      TSS       +S   +L+ ++ +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++ + LQ ++D+E+ ++ + YK N  A+ F++S+  +D+TI  +   S S+W+I+PP++ + ++ L+ +    +  ++I                        SL  + E+       +KY + + G  R  +A   + Q+    +++L  EN+                  +WW +  SHKEF          D  + ++FS+++S    G L + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 1228 EELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVD-YTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERLIQEP---DFTAVISWSIR-------------------SLGAKAEVTG-----EKYTISLAGQTRRELADMMNNQEFVNISVLLRKENT-------------SEGVREWWVVNQSHKEF-------IKKDGLELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 1993          

HSP 2 Score: 149.828 bits (377), Expect = 3.033e-35
Identity = 102/304 (33.55%), Postives = 164/304 (53.95%), Query Frame = 2
Query:  692 MMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNI--NGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTP-KRISFSR*NLETRNKLHH 1594
            + AWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +I    DE+   +             G+ E K P   L+  I + V FWL LR ++ E+  L    Q + A S  I ++N   K L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y +WRR +  +W  V+VY++ VL  IYT+QFK F  LW N T   +E L D G E F+++ L   +  P   L+V I+ +HYFH+ F++++DL    R+   + ++    K+ H
Sbjct:  231 LQAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEVM-------------GLLERKKP-EELVSKIIFTVTFWLLLRQHLTEQKALK---QKELALSE-IKDENDIMKVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDLKAVTRMQQIQDSVRDSAKIQH 516          

HSP 3 Score: 85.1149 bits (209), Expect = 1.665e-15
Identity = 72/248 (29.03%), Postives = 118/248 (47.58%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHC------IPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSR 3017
            WL+ P ++  P    L+ D +  +C +LQ  VF+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K I+F + +W  L I+F  G  R ++FC+GY++    +   G   +L   + +L  W+ ++ YN  +I +K N+  VS ++         CWLI    + C      IP       +      G I     WD +CF FL++QR++F +  F +VV D+K +    SR
Sbjct:  836 WLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMK-NVLSVSVLF--------HCWLIQAFSLSCTVKGYFIPQNTPDCQLP-SGEAGII-----WDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1067          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 507.294 bits (1305), Expect = 3.755e-147
Identity = 299/787 (37.99%), Postives = 461/787 (58.58%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSR----FIL----------LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-TIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTS---DWWQL-HSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            ++   +++F  +  R   LI A+ N ++  S+M+CY ++++NHMIS +M++L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     +V+   KD P+F P  +GI K E Y   DL+QL  LF HR  LK HGLW    D+ ++ E     +    + S  + R    FIL          L+ ++ +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++ + LQ ++D+E+ ++ + YK N  A+ F++S+  +D+TI  +   S S+W+I+PP++ + ++ L+ +    +  ++I                            R  I+SLF  +P  ++      P F +         L L + + +       ++L  E ++    +WW +  SHKEF          D  + ++FS+++S    G L + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 1196 EKLEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVD-YTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLW----DEDDVTEKATDKDDTDGEISEASGRRDSFFILYILCFFPSRILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERLIQEP---DFTAVISWS-----------------------IRRYIISSLFYNLPNSFSY----RPIFHIY-------PLCLKAPSDVTAKPILHVLLRKENTSEGVREWWVVNQSHKEF-------IKKDGLELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 1931          

HSP 2 Score: 169.088 bits (427), Expect = 4.254e-41
Identity = 111/315 (35.24%), Postives = 179/315 (56.83%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNI--NGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFED-NSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLH 1591
            ++K SYI + I+MMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +I    DE+   ++  FE  +++  +G       +I L+  I + V FWL LR ++ E+  L    ++  +   V  ED N   K L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y +WRR +  +W  V+VY++ VL  IYT+QFK F  LW N T   +E L D G E F+++ L   +  P   L+V I+ +HYFH+ F++++DL  K ++      E+RNK H
Sbjct:  161 IMKQSYICALISMMAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEVME--FESNYKM--YG------NYILLVFQIIFTVTFWLLLRQHLTEQKALK-QKELALSEIKVGMEDENDIMKVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDL--KAVTRDSKEPESRNKWH 462          

HSP 3 Score: 97.8265 bits (242), Expect = 2.118e-19
Identity = 73/244 (29.92%), Postives = 124/244 (50.82%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSR 3017
            WL+ P ++  P    L+ D +  +C +LQ  VF+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K I+F + +W  L I+F  G  R ++FC+GY++    +   G   +L   + +L  W+ ++ YN  +I +K  L + +C YI+++I  S CWLI    + C  T + +        C   + +    WD +CF FL++QR++F +  F +VV D+K +    SR
Sbjct:  764 WLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMKNVLSIGACGYIEYLIKDS-CWLIQAFSLSC--TVKGYFIPQNTPDCQLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASR 1003          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: PIEZO2 (piezo-type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:100492729])

HSP 1 Score: 496.893 bits (1278), Expect = 1.497e-142
Identity = 306/864 (35.42%), Postives = 470/864 (54.40%), Query Frame = 3
Query: 3993 HINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW----------------------KGFKD---------------KFNIKEPEKKTNFNTLQTSS----------------------------------LTSRFILLKPFI--TVKKFYMNLASYRY-------SKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQD----ALVLGSENSLNPLESYMIMLSIERSTSDWWQL-HSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            H +  + + + +E   +++F  +  R   LI A+ N ++  S+M+CY ++++NHMIS +M++L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     +V+   KD P+F P  +GI K E Y   DL+QL  LF HR  LK HGLW                       G +D                 ++  PE+KT      TSS                                  L  + I  K F   T+ + Y+ +  + Y       S   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++ + LQ ++D+E+ ++ + YK N  A+ F++S+  +D+TI  +   S S+W+I+PP++ + ++ L+ +    +  ++I                     +N+SL  + E+       +KY + + G  R  +A   + Q+    +++L  EN+                  +WW +  SHKEF          D  + ++FS+++S    G L + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 1461 HTDFFHRMFYDEELEDSEKFYTTQPRPLQLIYALYNTLVARSEMVCYFVIILNHMISASMITLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPWNKNVD-YTKDKPYFPPNIMGIEKKEGYVHYDLVQLLALFFHRSILKCHGLWDEDDVTEKATDKDDTDGEISEASGRRDSVGSLKSVNLAASVESVHVHFPEEKTAIRRKSTSSGSQISRRSSYSSSQKGSSIPSIKLKSRKELILEKLREQLIKAKAFTIKTILQIYVPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERKFSQNTVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVTNKPLDVSITITLGGYQPIFTMSAQQNQLQGLNDNEFKHLHNIYKGNTPAMQFLESYMQEDITIAGLEGNSNSLWTISPPSRTMMIERLIQEP---DFTAVISWS----------------IRRNVSLGAKAEVTG-----EKYTISLAGQTRRELADMMNNQEFVNISVLLRKENT-------------SEGVREWWVVNQSHKEF-------IKKDGLELWVFSDKVSPPSLGFL-AGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2277          

HSP 2 Score: 140.584 bits (353), Expect = 1.990e-32
Identity = 115/412 (27.91%), Postives = 199/412 (48.30%), Query Frame = 2
Query:  410 DFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNR---FTEHIHNTET-----------------TATGMPAISLPFIWSVITSLVKNS-----YIFS------FIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNI--NGDEIMNTIKIFFEPYFEISEFGIFEWKIP--FIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFED--NSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
             + NP  L  L+Y  +   ++WL +E I       +      + AA++ ++ R   ++ H    E                     G+ A ++  + + I+ L+ +      YIF+         + AWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +I    DE+   +             G+ E K P   +  +  I +   FWL LR ++ E+  L    ++  +   V  ED  ++  + L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y +WRR +  +W  V+VY++ VL  IYT+QFK F  LW N T   +E L D G E F+++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  180 QYTNPVMLLVLYYTLATLIRLWL-QEPIN----VEEEKEEDCSPAALTAERRRSLWYSSHYTTDERQVWLFRSRNIQLVLSLMAQMGLLAGNVGLLLNYISLLISSCSLCLHYIFTSSNTDCMYLLQAWSITYHSWLTFVLLIWSCALWMVRNRRKYAMLSSPFMVMYGNLLLTLQYIWSIALQSDELPEVM-------------GLLERKKPEELVSKVTIIKF--TFWLLLRQHLTEQKALK-QKELALSEIKVGSEDKGHNEMQVLGKLVQAMFVKYWIYVCGGMFFFVSFEGKIVMYKIIYMMLFLFCVALYQVHYEWWRRILKYFWMSVVVYTMLVLVFIYTYQFKSFPGLWMNMTGLDKEKLADLGLETFNLTDLFTRIFIPTSFLLVCILHLHYFHDRFLQLTDL 570          

HSP 3 Score: 117.087 bits (292), Expect = 2.805e-25
Identity = 93/320 (29.06%), Postives = 156/320 (48.75%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHC------IPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQN---------YGRPLPNEH-YLVLRSGDYFLFE 3203
            WL+ P ++  P    L+ D +  +C +LQ  VF+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K I+F + +W  L I+F  G  R ++FC+GY++    +   G   +L   + +L  W+ ++ YN  +I +K  L + +C YI+++I  S CWLI    + C      IP       +      G I     WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K +  R    H +         Y    P+ +  L+++SGDY+LFE
Sbjct:  962 WLYFPDFIVRPSPLFLVYDFLLLLCASLQREVFEEENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIYCR-SYLDMGKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIRIILRYWDWLIAYNVFVITMKNVLSIGACGYIEYLIKDS-CWLIQAFSLSCTVKGYFIPQNTPDCQLP-SGEAGII-----WDSICFAFLLLQRRVFMSYYFLHVVADIKSSQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQYGRFSFLHIHVLYIYLSSIYLSICPHTYSVLMVKSGDYYLFE 1273          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Match: chordc1 (cysteine and histidine rich domain containing 1 [Source:Xenbase;Acc:XB-GENE-962949])

HSP 1 Score: 440.654 bits (1132), Expect = 1.245e-124
Identity = 287/813 (35.30%), Postives = 458/813 (56.33%), Query Frame = 3
Query: 4029 ETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIES-DVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW---------------KGFKDKF--------------NIKEPEKKTNFNTLQTSSLTSRFILLKPFIT-------VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERN-PSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGL-PRFLVA---TKTDFQDALVLGSENSLNPLESYMIMLSIERSTS-----DWW--QLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFT 6317
            E S++Q F +S SR+  L++A+ N V  +S++LCY I+++N+M+S +++SL  P+ +FLW MLS  +PS  +W+  I++T+++++IKY+FQF F    +  +    +  PFF P  LG+ K++ Y   DL+QL +LF HR  L ++GLW               KG K +               ++++ ++K +  ++Q     S +     F +       VK F+ ++   +     DVY +MF+ + + F IIV G+ AFG  + +   A   L D ++P  F++M++ QF  ++IDRAL+LRK V+GKL+FQ+  VI IHVW+FF+ P ++   +N     Q  YF KC+YFALS+YQI+ GYP RILGNFLTKKYN+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL +WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL+++F     W PL+  S++ S+  V N P    +T +  G+  ++  +++   +Q  +  +Y  +   ++    A+ F+  +  +D+    I   S S+W I+PP+++   K L +    + L    + +R+         T   +T        ER E+A L    +   V ++ L P+++ A    + +    L    E S   +E  +  + +    S     +WW   L   +  DC        +     IF++++S    G L + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +IY+VRE     LEE+L AKLIF+YRS ETMI++T
Sbjct: 1351 ELSESQHFFQSQSRILRLLLALYNFVAAHSELLCYFIIILNNMVSASLISLFLPILIFLWGMLSIHKPSKRFWMTAIIFTEVMVVIKYLFQFGFFPWNNYTILVRNEGKPFFPPRVLGLEKSDSYIKYDLIQLLMLFFHRSLLMSYGLWDRKDLDLEERTPGKDKGSKTEIQASQDLEPAGGSSSSLRQRKRKESQGSVQERGAESNWTCAVQFTSLRNIYQPVKAFFHDILHTKNRAATDVYAFMFLADVVDFVIIVFGFWAFGKHSAAADIASS-LSDDQVPEAFLVMVLIQFSTMVIDRALYLRKTVLGKLIFQVILVIGIHVWMFFILPAVTERMFNQNTVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIIVFLICIIWFPLLFMSLVRSVVGVVNHPIDVTVTFKLGGYEPLFTMSAQQQSIQPFTPQQYEALTYEFERQPTAMQFITLYSYEDIVTARIEGSSGSVWGISPPSREQMRKELQNGSSDITLRFTWDFQRDLAKGGTVEHTSEKHTKDLEPGSQERMELADLLQGVRDTPVSIQHLFPKYIRAPNGPEANPVKQLQPDEEESYLDVEVQLNRMRVAEGNSTSSFVEWWVITLKDCEGEDC--------NILPMVIFNDKVSPPSLGFL-AGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIYVVRERGELELEEELYAKLIFLYRSPETMIKWT 2153          

HSP 2 Score: 148.673 bits (374), Expect = 6.838e-35
Identity = 101/289 (34.95%), Postives = 157/289 (54.33%), Query Frame = 2
Query:  677 FSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKI--RLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLT 1537
            FSFI  +   +TY SWLTFVLL+ AC++W++ + R   ++ SPFI+ YG+ L  + YV +++  E + T   F +    +S+ G+     P + +   + Y + FWL L  ++ EK   R    S +      V   + +  K     +    AKYWI+ C    ++VS   ++ +  +VYM+  ++ +  F   YS WR+ +  +WWLV+ Y++ VL  IYTFQF+ F E W N T  T E L D G E F +S L   +L P   L+  I+Q+HYFH PFM M++L 
Sbjct:  237 FSFILTITCGITYHSWLTFVLLLWACLIWMVRNRRQFAMLCSPFILMYGVTLCSLQYVWSMDLREELPTQLGFMK----LSQLGLVRAPYPCLNMGALLLYTLTFWLLLHQFVTEKFLKRKKFMSPL----LEVTVAEKNLLKRFGEQVKSFYAKYWIYVCGGMFIVVSFAGRLVVYKIVYMLLFLLCLVLFQVYYSLWRKLLTFFWWLVVAYTMLVLITIYTFQFEEFPEYWKNLTNLTDEQLGDIGLERFSVSELFTSILIPGFFLLACILQLHYFHRPFMHMTNLA 517          

HSP 3 Score: 100.523 bits (249), Expect = 2.969e-20
Identity = 75/258 (29.07%), Postives = 129/258 (50.00%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIE----------NNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSR 3017
            L  WL+LP +   P++  LI D +  + V  Q+ VF  E           N+ +Y+  ++RP   N +P     +FI N  SY+D +K  +F + +W  L +VF  G  R ++F LGY++        G   +    K  L  W+ ++ YN  +IL K  L L+SCV++   +  + CW+I +  + C            ++   S+ +E +         WD +CF+FL++QR++F +  F +VVLD++ ++  TSR
Sbjct:  854 LIKWLYLPDFYTTPKSVNLISDFVLLIGVAQQWKVFINEKKEEWYTMAGENVEEYEAPKDRP---NPVP-----NFI-NCQSYLDMVKVAVFRYLFWFVLTVVFITGATRISVFGLGYLMSCFYLLLSGTTLLQKPMKAKLVLWDCLILYNITVILSKNMLSLLSCVFVQQ-MQTNFCWVIQLFSLVCTVKGYYNPQDMDKDRDCSLPVEEA------GIIWDSICFLFLLLQRRVFLSCYFRHVVLDLRASSLQTSR 1095          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 397.897 bits (1021), Expect = 4.771e-111
Identity = 224/595 (37.65%), Postives = 349/595 (58.66%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF----TIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERSTSDWW--QLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP+K   ++ L D     ++      +RN +       +        L++  R  IA +     T      V ++ +  + V   +D     +  L SEN+   +   +   ++ +S S+WW   L   + F+  S+        +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2191 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMT-LGAKAEIATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLNLTGSRIFNQGSQ------ALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2776          

HSP 2 Score: 128.642 bits (322), Expect = 8.489e-29
Identity = 98/340 (28.82%), Postives = 159/340 (46.76%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRL----------SVSSQIDRARSSVI-------------------------------------FEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V Y  +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ    +   +                                      +D    K L   +  L  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  496 IMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 821          

HSP 3 Score: 123.25 bits (308), Expect = 3.637e-27
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 3
Query: 2271 RVYPFHF--PYLLED---WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            R YP+ F   Y  ++   WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  S CWLI    + C  T + +     ++ C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L   SG+    ++  EED  D+R  D
Sbjct: 1220 RDYPWRFKGAYFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGALVRNS-CWLIQAFSLAC--TVKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGEGQDIQKVSEED--DEREAD 1551          

HSP 4 Score: 110.538 bits (275), Expect = 2.077e-23
Identity = 65/149 (43.62%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM S ++++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     D+  + K+ P+F P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1918 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLE-IYKERPYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2065          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 397.897 bits (1021), Expect = 4.944e-111
Identity = 224/595 (37.65%), Postives = 349/595 (58.66%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF----TIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERSTSDWW--QLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP+K   ++ L D     ++      +RN +       +        L++  R  IA +     T      V ++ +  + V   +D     +  L SEN+   +   +   ++ +S S+WW   L   + F+  S+        +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2166 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMT-LGAKAEIATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLNLTGSRIFNQGSQ------ALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2751          

HSP 2 Score: 128.257 bits (321), Expect = 8.686e-29
Identity = 98/340 (28.82%), Postives = 159/340 (46.76%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRL----------SVSSQIDRARSSVI-------------------------------------FEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V Y  +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ    +   +                                      +D    K L   +  L  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  496 IMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 821          

HSP 3 Score: 123.25 bits (308), Expect = 3.660e-27
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 3
Query: 2271 RVYPFHF--PYLLED---WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            R YP+ F   Y  ++   WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  S CWLI    + C  T + +     ++ C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L   SG+    ++  EED  D+R  D
Sbjct: 1195 RDYPWRFKGAYFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGALVRNS-CWLIQAFSLAC--TVKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGEGQDIQKVSEED--DEREAD 1526          

HSP 4 Score: 110.538 bits (275), Expect = 2.108e-23
Identity = 65/149 (43.62%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM S ++++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     D+  + K+ P+F P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1893 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLE-IYKERPYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2040          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 397.512 bits (1020), Expect = 7.034e-111
Identity = 224/595 (37.65%), Postives = 349/595 (58.66%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF----TIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERSTSDWW--QLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP+K   ++ L D     ++      +RN +       +        L++  R  IA +     T      V ++ +  + V   +D     +  L SEN+   +   +   ++ +S S+WW   L   + F+  S+        +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2237 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMT-LGAKAEIATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLNLTGSRIFNQGSQ------ALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2822          

HSP 2 Score: 123.25 bits (308), Expect = 3.683e-27
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 3
Query: 2271 RVYPFHF--PYLLED---WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            R YP+ F   Y  ++   WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  S CWLI    + C  T + +     ++ C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L   SG+    ++  EED  D+R  D
Sbjct: 1210 RDYPWRFKGAYFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGALVRNS-CWLIQAFSLAC--TVKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGEGQDIQKVSEED--DEREAD 1541          

HSP 3 Score: 122.479 bits (306), Expect = 6.365e-27
Identity = 97/335 (28.96%), Postives = 157/335 (46.87%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIF------------------------------------------EDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V Y  +L+ + Y+ +    EI          + E  E G    KI F    +T   L+   LT +  ++EK  L    +I                                                   +D    K L   +  L  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  496 IMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---ITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKEDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 822          

HSP 4 Score: 110.538 bits (275), Expect = 2.138e-23
Identity = 65/149 (43.62%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM S ++++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     D+  + K+ P+F P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1964 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLE-IYKERPYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2111          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 328.946 bits (842), Expect = 3.778e-100
Identity = 153/360 (42.50%), Postives = 234/360 (65.00%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLD 5645
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP+K   ++ L D
Sbjct:    5 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTD 363          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Match: Piezo2 (piezo-type mechanosensitive ion channel component 2 [Source:MGI Symbol;Acc:MGI:1918781])

HSP 1 Score: 325.479 bits (833), Expect = 1.290e-98
Identity = 150/350 (42.86%), Postives = 228/350 (65.14%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPN 5615
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP 
Sbjct:   60 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADITSS-LSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPK 408          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|M9MSG8|PIEZO_DROME (Piezo-type mechanosensitive ion channel component OS=Drosophila melanogaster OX=7227 GN=Piezo PE=2 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 6.344e-116
Identity = 271/896 (30.25%), Postives = 471/896 (52.57%), Query Frame = 3
Query: 3891 QTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK-GFKD-----------------KFNIKEPEK---------------------------KTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPG-TGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----------------TIPK-KYAVLVKGL-PRFL-VATKTDFQDALVLGSEN-SLNPLESYMIMLSIERSTSD-WWQL--HSHKEF--DCLSRNPFSPDKTKFFIFSERISDNLFGQLFS---RXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMD 6353
            Q   H +    ++EL    V     +   I++ P           +E       Q+    +  ++++    ++  +D++CY+++ +N +++ +++SL  P+ VFLW  LS PRP+  +W+ +I YTQ ++LIK +FQFK I   S+ + L  + P       G+    HYA+ DL+ L VLFLHR  LK+ GLWK G+KD                   N+ +P+                            KT  N L+ +  TS         ++ KF+ +L  ++     DVY  MF+C+F++FF+++ G+ AFG   T S      +L ++K+PIPF++ML+ QF+ I+IDRAL+LRK ++ K++F  F VI IH+W+FF+ P ++   +N+   P   Y  KC Y  LSSYQIKSGYP RILGNF TK ++ +N+  FK Y+ +PFLYELR ++DW+  D+ ++++ W+++ED+F+ I++++C R+SE ++P  R   +  ++K ++GG +++   +C WGPL L ++  ++   N PFH  L++    +  IY  N+   + + ++ + Y+ + + Y     AL+F+  ++  DV  + ++  S S+W+I PP++   +  L +        S     + P+         ++    + S   R  +  +                  T P+ +  V++ G+ P+F+ V    D     VL  ++    PL   +I +  +  T+  WW++  + +  F  + LS+  +S   +   +++   +D  F   FS     GIIG+Y  ++ +A R +++     +  I  E+LPYVDR+L+L  +IYLVRE   F LEE L AKL+F+YRS ET+I++TR K+  +D+  D
Sbjct: 1657 QQHQHIRAAEEIIELPVDTVDGVAHRKQSINSSPPAKGAGEFNLEEENFA----QRDHHIIVEVLISSWYALLANTDLICYIVVFINQVVNASLISLPLPIMVFLWGTLSLPRPTKTFWVTLIAYTQAIVLIKCIFQFKLI--WSNYHQL-PNQPLTPAKIFGVENKAHYAIYDLILLLVLFLHRYLLKSQGLWKSGYKDTDNQFTKPTASIDERDDSDNLSQPDSRQLNDDAAQKLSLQVSQASLPGSPEFSKTGINQLERTKYTS---------SLYKFFFSLV-HKSRLATDVYALMFLCDFVNFFVLLFGFTAFGTQQTESDEGVQTYLAENKVPIPFLIMLLVQFLLIVIDRALYLRKALVNKIIFHFFSVIGIHIWMFFVVPAVTERTFNSLAPPIIFYVIKCFYMLLSSYQIKSGYPKRILGNFFTKGFSMVNMIAFKVYMQIPFLYELRTILDWVCIDSTMTIFDWLKMEDIFSNIYLIRCTRQSETDFPAMRAQKKASLSKLIMGGTIVLLIVICIWGPLCLFALGNAVGTSNVPFHVSLSIRIGPYDPIYTTNNYDSIFE-INPEMYSQMTNAYIKEKQALTFIAGYDATDVAAVRLAGNSPSLWNIAPPDRQRLLNDLRNNHTLKARFSYSLTRKAPAKGLKENVGDEHAISLDESFEGRAALIHMLSETHDVEPIYSNGTTNGTTPEVEEVVVIPGMIPKFIKVLNSGDAAVVSVLSPKHYDYRPL---VIKMHRDNETNGLWWEIRDYCNDTFYNETLSKFAYSNCTSGIVMYT--FNDKKFPSTFSFLTAGGIIGLYTTFVLLASRFMKSFIGGQNRKIMFEDLPYVDRVLQLCLDIYLVREALEFALEEDLFAKLLFLYRSPETLIKWTRPKEEYVDDDGD 2529          

HSP 2 Score: 156.377 bits (394), Expect = 2.189e-36
Identity = 111/364 (30.49%), Postives = 163/364 (44.78%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYK---YKGGENRPIV-----FNELP-KTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT---------RENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQ-------------NYGRPLPNE----------HYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLK 3263
            ++ W  LP  L+     KLI D I  + +N Q  +F IE        Y GG NR ++        +P      DF S   +Y D LK  + C FYW TL +VF  G     L  LGY+I A ++ W G  F L     ++  W  +L +N   ILIK + Q+  C+++  +     CWL+H+LGI C             E  +++     C  I +     WD +CF F+I Q +IF +  F +++ D K  N   SRGA +I       +    + E Q+  K+K K+ RI  T Q              +G PLP            H    R+GDY++FEE  ++ E  D I D  +FL+
Sbjct: 1063 IQRWAMLPGALHFNHVPKLIFDFIVLVILNRQKSIFCIEQRYASNDDYPGGSNRSVIADIAQLGRVPFDNPTHDFCSYIRNYSDILKNGVLCGFYWFTLAVVFLAGTNIADLLALGYLIGAFIFLWQGSDFYLRPIHTIIFRWKWLLAFNVANILIKTSFQMAGCLFMTQLTK-DCCWLVHMLGITCTSNVLTEQIMLPEEAELALK-PGECPKITHQVVLLWDTICFAFIIFQLRIFKSHYFCHIITDTKANNILASRGADIIESLRHKQIAHRHDHEKQVLHKIKRKMERIRATQQKMLRPLDKQTHFDEHGYPLPAPTVRRRKEIKLHPHATRAGDYYMFEEMDDKFEL-DLIHDEIDFLE 1423          

HSP 3 Score: 147.517 bits (371), Expect = 9.784e-34
Identity = 127/435 (29.20%), Postives = 206/435 (47.36%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFF--DFMNPFALFALFYIHSLDSK----IWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFT----EHIHNTETTATG-MPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEIS-EFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQ-----------IDRARSSVIFEDNST----FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQ-VKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTP 1540
             +L+GL   I++ C     V +   +     ++NPFALF  ++  +L +K      L R++ +         S  +   +V+Q+ N       E     E T T  +  IS  F+ SV   + +NSYIF+ I MMAWS+ Y SWLTFVLL+ A +LW++P+ R A +  SPFIV Y   L+   Y+   ++N +E+  ++        +I  E  I     P +PL++   ++++FW+T R + KEK      S            +  A SS +  D        K     +  L  + WI+   + + L +I  + +    + YM   +  +  F  S   W + MY +W  +I Y++ +L  IYT+QF  F   W +Y   +    KD G + +    L   L+SP I++I+T+IQVHYFH  F+      P
Sbjct:  294 ARLIGLEPLIESYCSPDIRVFLYNNKLSLDSYLNPFALFFAYFALALTTKHLIKPRLVRQSTRKARTPQPLESGSSVAPSVTQRGNDMQLESMEQRSEQENTTTSILDQISYGFV-SVGGFIYQNSYIFTNILMMAWSIVYHSWLTFVLLLSANVLWMIPNQRKAMMRSSPFIVLYAEALLIAQYIYGMDLNNEELPTSVPTAGINLQQIGFERPIENQMRPCVPLIVKTAFVLMFWVTSRQFFKEKRDRRRDSTLADFIAPLQITVGSAGSSYLINDGKKTSKFLKKAGDVIKNLLVRLWIWLLVLVIFLCAITGENMTGFRICYMALFLFFLLVFQSSSKAWVKIMYGFWLFLIFYAMSILILIYTYQFDKFDTYWSDYLNVSATLQKDIGLKRYQTKDLFLHLVSPTIIVILTVIQVHYFHKRFIASLQQQP 727          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q9H5I5|PIEZ2_HUMAN (Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens OX=9606 GN=PIEZO2 PE=1 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 1.048e-110
Identity = 229/597 (38.36%), Postives = 353/597 (59.13%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERT---EIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERST---SDWWQLHSHKEFDCLSRNPFSPDKT--KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M    +N     +  +  A+ F++++E +D+T+  +   S S+W+I+PP+K   +  LLD   + ++      +RN S    ++   D       ++T +     IA   T   K  V ++ +  + V   +D     +  L SEN+   +    I+LS + +T   S+WW L      +      ++P+    +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2165 LEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDI---TIILSRDNTTKYNSEWWVL------NLTGNRIYNPNSQALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2750          

HSP 2 Score: 130.568 bits (327), Expect = 1.479e-28
Identity = 99/342 (28.95%), Postives = 163/342 (47.66%), Query Frame = 2
Query:  641 SVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLS----------VSSQIDRARSSVIFE----------------------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            SV   ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V YG +L+ + Y+ +    EI          + E  E G    KI F          + FWL LR ++ E+  L           + SQ +  +   + +                                  +    K L   +  +  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  491 SVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYGNLLLILQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---------ITFWLLLRQHLTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQEEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 818          

HSP 3 Score: 128.642 bits (322), Expect = 5.003e-28
Identity = 66/149 (44.30%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM+S +M++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     +V  + KD P+  P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1892 DELEESEKFYVGQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKNVE-VNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2039          

HSP 4 Score: 122.094 bits (305), Expect = 4.496e-26
Identity = 91/320 (28.44%), Postives = 158/320 (49.38%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  +++ S CWLI    + C  T + +   +  + C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L    G+    ++  EED  D+R  D
Sbjct: 1211 WLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNS-CWLIQAFSLAC--TVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQEPGEGQDMQKLSEED--DEREAD 1524          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q8CD54|PIEZ2_MOUSE (Piezo-type mechanosensitive ion channel component 2 OS=Mus musculus OX=10090 GN=Piezo2 PE=1 SV=2)

HSP 1 Score: 397.512 bits (1020), Expect = 4.872e-110
Identity = 224/595 (37.65%), Postives = 349/595 (58.66%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF----TIPKKYAVLVKGLPRFLVATKTDFQDALV--LGSENSLNPLESYMIMLSIERSTSDWW--QLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +++F+ +L    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  K++  +  Q  YF KCVYF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IF+LKCWR SE  YP PRG  +    KY +GG++++      W PL+  S+I S+  V N P    +T+   G+  I+  +++   L+ M + +YN     +  N  A+ F++++E +DVT+  +   S S+W+I+PP+K   ++ L D     ++      +RN +       +        L++  R  IA +     T      V ++ +  + V   +D     +  L SEN+   +   +   ++ +S S+WW   L   + F+  S+        +  +F++++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2235 LQIYVPIRQFFYDLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPGVTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKAVKYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDNSKYNEFLKSFGPNSGAMQFLENYEREDVTVAELEGNSNSLWTISPPSKQKMIQELTDPNSCFSVVFSWSIQRNMT-LGAKAEIATDKLSFPLAVATRNSIAKMIAGNDTESSNTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMNITIILFRDNVTKSNSEWWVLNLTGSRIFNQGSQ------ALELVVFNDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2820          

HSP 2 Score: 123.25 bits (308), Expect = 2.470e-26
Identity = 97/338 (28.70%), Postives = 166/338 (49.11%), Query Frame = 3
Query: 2271 RVYPFHF--PYLLED---WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPIVFNELPKTEDK-----DFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDD 3245
            R YP+ F   Y  ++   WL+ P ++  P    L+ D +  +C +LQ  +F+ EN    +   G+N  I  N    +  +     DFI  + SY+D  K IIF + +W  L I+F  G  R ++FC+GY++    +   G   +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  S CWLI    + C  T + +     ++ C   + +    WD +CF FL++QR++F +  F +VV D+K +    SRGA L    ++  +    E+E +   ++K ++ RI+   Q Y +       L   SG+    ++  EED  D+R  D
Sbjct: 1210 RDYPWRFKGAYFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVEICMNLDAASFSQHNPVPDFIHCR-SYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGALVRNS-CWLIQAFSLAC--TVKGYQMPEDDSRCKLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLSLTQESGEGQDIQKVSEED--DEREAD 1541          

HSP 3 Score: 122.094 bits (305), Expect = 4.527e-26
Identity = 97/335 (28.96%), Postives = 157/335 (46.87%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIF------------------------------------------EDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFVLLI +C LW++ + R   ++ SPF+V Y  +L+ + Y+ +    EI          + E  E G    KI F    +T   L+   LT +  ++EK  L    +I                                                   +D    K L   +  L  KYWI+ C      VS + ++ +  ++YM+  +  +  +   Y +WR+ +  +W  V++Y++ VL  IYT+QF+ F  LW N T   +E L+D G + F ++ L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  496 IMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYAMISSPFMVVYANLLLVLQYIWSFELPEIKKV-----PGFLEKKEPGELASKILFT---ITFWLLLRQHLTEQKALREKEALLSEVKIGSQELEEKEDEELQDVQVEGEPTEKEEEEEEEIKEERHEVKKEEEEEVEEDDDQDIMKVLGNLVVALFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVALYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLKQFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDL 822          

HSP 4 Score: 110.538 bits (275), Expect = 1.470e-22
Identity = 65/149 (43.62%), Postives = 98/149 (65.77%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            DE  ++++F     R  LL  A+ N ++  S+M+CY ++++NHM S ++++LL P+ +FLWAMLS PRPS  +W+  I+YT++ I++KY FQF F     D+  + K+ P+F P  +G+ K E Y L DL+QL  LF HR  LK HGLW
Sbjct: 1962 DELEESEKFYVDQPRFLLLFYAMYNTLVARSEMVCYFVIILNHMTSASIITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKYFFQFGFFPWNKDLE-IYKERPYFPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLW 2109          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q92508|PIEZ1_HUMAN (Piezo-type mechanosensitive ion channel component 1 OS=Homo sapiens OX=9606 GN=PIEZO1 PE=1 SV=4)

HSP 1 Score: 345.51 bits (885), Expect = 3.742e-94
Identity = 218/593 (36.76%), Postives = 338/593 (57.00%), Query Frame = 3
Query: 4587 VKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSL----TERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTS-----DWWQLHSHK-EFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            +++F+ ++   +Y    DVY  MF+ + + F II+ G+ AFG  + +T      L D ++P  F++ML+ QF  +++DRAL+LRK V+GKL FQ+  V+ IH+W+FF+ P ++   +N  +  Q  YF KC+YFALS+YQI+ GYP RILGNFLTKKYN+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL  WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL+++F     W PL+  S++ S+  V N P    +TL+  G+  ++  +++   +   +   Y  +   +    +A+ F+  + P+D+    I   S ++W I+PP++    + L +    + L      +R   D     TV        L+L    T R ++ASL       +V++  L P+++ A      + +     N         I L  E+        +WW +   +   DC        +     IFS+++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE +   LEE+L AKLIF+YRS ETMI++TR K+
Sbjct: 1942 LRRFFHDILHTKYRAATDVYALMFLADVVDFIIIIFGFWAFGKHSAATDIT-SSLSDDQVPEAFLVMLLIQFSTMVVDRALYLRKTVLGKLAFQVALVLAIHLWMFFILPAVTERMFNQNVVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSSWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQR---DLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDC--------NLLPMVIFSDKVSPPSLG-FLAGYGIMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREKE 2521          

HSP 2 Score: 172.94 bits (437), Expect = 1.686e-41
Identity = 103/297 (34.68%), Postives = 165/297 (55.56%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLC----AKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++  SY+ + IAMM WS+TY SWLTFVLL+ AC++W +       ++ SP I+ YG+ L  + YV  +   ++   +     P   + + G+   + P + L   + Y + FWL LR ++KEK+     S       +V   + +  ++L+  L +L     AKYWI+ C    ++VS   ++ +  +VYM   ++ +T F   YS WR+ +  +WWLV+ Y++ VL  +YTFQF+ F   W N T FT E L D G E F +S L   +L P   L+  I+Q+HYFH PFM+++D+
Sbjct:  419 IMDQSYVCALIAMMVWSITYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGMTLCCLRYVWAM---DLRPELPTTLGP-VSLRQLGLEHTRYPCLDLGAMLLYTLTFWLLLRQFVKEKLLKWAESPAALTEVTVADTEPTRTQTLLQSLGELVKGVYAKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYSLWRKLLKAFWWLVVAYTMLVLIAVYTFQFQDFPAYWRNLTGFTDEQLGDLGLEQFSVSELFSSILVPGFFLLACILQLHYFHRPFMQLTDM 711          

HSP 3 Score: 107.842 bits (268), Expect = 1.078e-21
Identity = 59/145 (40.69%), Postives = 90/145 (62.07%), Query Frame = 3
Query: 4059 SSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALE-KDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDK 4490
               R   L+ A+   V  +S++LCY I+++NHM++ +  SL+ P+ VFLWAMLS PRPS  +W+  I++T++ +++KY+FQF F    S V     ++ P+F P  LG+ KT+ Y   DL+QL  LF HR  L  +GLW   +D 
Sbjct: 1668 GQGRALRLLRAVYQCVAAHSELLCYFIIILNHMVTASAGSLVLPVLVFLWAMLSIPRPSKRFWMTAIVFTEIAVVVKYLFQFGFFPWNSHVVLRRYENKPYFPPRILGLEKTDGYIKYDLVQLMALFFHRSQLLCYGLWDHEEDS 1812          

HSP 4 Score: 91.2781 bits (225), Expect = 1.208e-16
Identity = 96/374 (25.67%), Postives = 161/374 (43.05%), Query Frame = 3
Query: 2241 PKLCI--L*NGSRVYPFHFPYLLEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGEN----RPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHC----------IPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRI--EQTHQNYGR------------------PLPN-----------------EHYLVLRSGDYFLF 3200
            P LCI      SR  P +    L  WL+LP +   P +  LI D +  +C + Q+ VF  E    ++   G N     P+     P     +FI  + SY+D LK  +F + +WL L +VF  G  R ++F LGY++        G   +    +  L  W+ ++ YN  +I+ K  L L++CV+++  +    CW+I +  + C          +  R+    + +E +         WD +CF FL++QR++F +  + +V  D++ T    SRG  L N   +  +   +  E +   ++K ++ RI  +Q     GR                  P P+                 +H  V+ SGDYFLF
Sbjct: 1061 PALCIDYPWRWSRAVPMN--SALIKWLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAERTEEWQRMAGVNTDRLEPLRGEPNPV---PNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTALLQRDTRARLVLWDCLILYNVTVIISKNMLSLLACVFVEQ-MQTGFCWVIQLFSLVCTVKGYYDPKEMMDRDQDCLLPVEEA------GIIWDSVCFFFLLLQRRVFLSHYYLHVRADLQATALLASRGFALYNAANLKSIDFHRRIEEKSLAQLKRQMERIRAKQEKHRQGRVDRSRPQDTLGPKDPGLEPGPDSPGGSSPPRRQWWRPWLDHATVIHSGDYFLF 1421          
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Match: sp|Q0KL00|PIEZ1_RAT (Piezo-type mechanosensitive ion channel component 1 OS=Rattus norvegicus OX=10116 GN=Piezo1 PE=1 SV=3)

HSP 1 Score: 338.961 bits (868), Expect = 4.747e-92
Identity = 225/638 (35.27%), Postives = 351/638 (55.02%), Query Frame = 3
Query: 4482 KDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSL----TERTEIASLF-TIPKKYAVLVKGLPRFLVATKTDFQDAL----------VLGSENSLNPLESYMIMLSIERSTS------DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            ++   I+E  K      LQ+  L+      +P   +++F+ ++   +Y    DVY  MF+ + +   +I+ G+ AFG  + +T  A   L D ++P  F+ ML+ QF  ++IDRAL+LRK V+G L FQ+  V+ IH+W+FF+ P ++   +      Q  YF KC+YFALS+YQI+ GYP RILGNFLTKKYN+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL +WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL+++F     W PL+  S+I S+  V N P    +TL+  G+  ++  +++   +   + ++Y  +   +    +A+ F+  + P+D+    I   S ++W I+PP++      L +    + L      +R   D     +V        L L    T R ++A L    P +  V+    P+++ A      + +           LG    L   E      S E++ +      +WW +      DC +     P      IFS+++S    G   + YGI+G+Y + + V  + +R  +S+IS+ I  EELP VDRILKL  +I+LVRE +   LEE+L AKLIF+YRS ETMI++TR K+
Sbjct: 1915 REGLKIREKMKAAG-RRLQSFCLSLAQSFYQP---LRRFFHDILHTKYRAATDVYALMFLADIVDIVVIIFGFWAFGKHSAATDIA-SSLSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGNLAFQVVLVVAIHLWMFFILPAVTERMFRQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPEDYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKHELYNGTADITLRFTWNFQR---DLAKGGSVEYTNEKHTLELAPNSTARRQLAQLLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQPDEEEDYLGVRIQLR-REQVGTGTSGEQAGTKASDFLEWWVIELQ---DCQAECNLLP----MVIFSDKVSPPSLG-FLAGYGIVGLYVSIVLVVGKFVRGFFSDISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTREKE 2535          

HSP 2 Score: 157.147 bits (396), Expect = 9.991e-37
Identity = 104/297 (35.02%), Postives = 166/297 (55.89%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKI---RLSVSSQIDRARSSVIFEDNSTF-KSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++  SY+ + IAMM WS+ Y SWLTFVLL+ AC++W +       ++ SP I+ YG+ L  + YV  +   E+  T+         + + G+   + P + L   + YL+ FWL LR ++KEK+   R + S+ ++   S        T  +SL   +  +  KYWI+ C    ++VS   ++ +  +VYM   ++ +T F   Y+ WR+ + ++WWLV+ Y++ VL  +YTFQF+ F   W N T FT E L D G E F +S L   +L P   L+  I+Q+HYFH PFM+++DL
Sbjct:  417 ILDQSYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRYVWAMELPELPTTLGPV-----SLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFVKEKLLKKRKAPSTLLEVTVSDTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIVYMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFTDEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDL 708          

HSP 3 Score: 114.005 bits (284), Expect = 1.307e-23
Identity = 66/183 (36.07%), Postives = 107/183 (58.47%), Query Frame = 3
Query: 4023 VDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALE-KDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKD---KFNIKEPEKKTNFNTLQTSSLTSR 4559
            + E  +A+QF+    R   L+ A+   V  +S++LCY I+++NHM++ +  SL+ P+ VFLWAML+ PRPS  +W+  I++T+++++ KY+FQF F    S +     ++ P+F P  LG+ KT+ Y   DL+QL  LF HR  L  +GLW   +D   K + +  EK         + L S+
Sbjct: 1643 IPELEEAEQFEAQQGRTLRLLRAMYQCVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFPWNSYIVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDGVPKDHCRSSEKDQEAEEESEAKLESQ 1825          

HSP 4 Score: 98.5969 bits (244), Expect = 6.010e-19
Identity = 90/344 (26.16%), Postives = 154/344 (44.77%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGEN----RPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHC----------IPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGR---------------PLPN-----------------EHYLVLRSGDYFLF 3200
            WL+LP +   P +  LI D +  +C + Q+ VF  E    ++   G N     P+     P     +FI  + SY+D LK  +F + +WL L +VF  G  R ++F LGY++        G   +    +  L  W+ ++ YN  +I+ K  L L+SCV+++ +   + CW+I +  + C          + TR+    + +E +         WD +CF FL++QR++F +  F +V  D+K T    SRG  L N   +  +   ++ E +   ++K ++ RI    + Y +               P P+                 +H  V+ SGDYFLF
Sbjct: 1070 WLYLPDFFRAPNSTNLISDFLLLLCASQQWQVFSAEQTEEWQRMAGVNTDHLEPLRGEPNPI---PNFIHCR-SYLDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVLWDCLILYNVTVIISKNMLSLLSCVFVEQM-QSNFCWVIQLFSLVCTVKGYYDPKEMKTRDRDCLLPVEEA------GIIWDSICFFFLLLQRRVFLSHYFLHVSADLKATALQASRGFALYNAANIKNINFHRQTEERSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSTDPQEPGPDSPGGSSPPRTQWWRPWQDHATVIHSGDYFLF 1402          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A504YS87 (Piezo-type mechanosensitive ion channel component OS=Fasciola gigantica OX=46835 GN=FGIG_01349 PE=3 SV=1)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 429/1013 (42.35%), Postives = 605/1013 (59.72%), Query Frame = 3
Query: 3582 DTIE--KDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQ-----AQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDS----PFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKD---------------------KFNIKEPEKKTNFNTL---------------QTSSLTSRFILL----KPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTER----------------TEIASLFTIPK----KYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYM-IMLSIER---STSDWWQLHSHKE-------FDCL------SRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            DTI+  + S ++     W K  +     Y F ++ +D LI  +N LT+  R +R  ++ EKRL+K R+I   +     S  +             +   +   +  T +  Q L R     N++        N+     H+ + +  + +  T Q      + F++S S  FLL++A+GNL I+YS+  CY +L++NHM S  +LSL YPL+VFLW MLS PRP+  +WIF+I YT++VI+IKY+FQF+FI      + LEK S      +LP   G++K +HYAL DL+QL  LFLHRGYLKN+GLW+   +                     + +++ P+++++ + +               Q S++  R         PF  + +FY+ +   RY+K+VDVY+YMF+CEFI+F+I++ GY +FGP TG    A +F+K ++IP+PFI ML+ QFIFIIIDR LFL+K V+GK +FQI +V+LIH W+ F+ P I+RS +NA +APQ LY  KCVYF+LS+YQI+SGYP RILGNFLTK YNYLNL LFKGYL++PFLYELRNVMDW+WT +ALSLYHWME+ED++AKIFVLKCWRRSE+ YPTPRG NR    K LVGGLL+ FFFLCFWGP+ L S IG+ F  NPP  C  ++ F GF  I+E+ SR   +  +S+  +   K C++ +     F+ +FE  DV  + I   S +IW+ITPP+     + L D K  + L+  + C R+  + +T +T V+  F + L   E+                 E AS    P        VL   +PR+++  K   + A        L   E+Y+ +  +I      T  WW+L   +        F+ L      S+   +        ++ER+SD+LFG++FS YGIIG+YAAYIF+A+RLLR +YSNISY+IR EELP+VDRIL L NEIYLVREN + RLEEQLVAKL F+YRS ETMI++TR  + I+D+  DK
Sbjct: 2194 DTIDVTQGSIQQREEGCWSKFKASCMIGYMFIISSVDSLIRLLNGLTRQYRRIRRTIDQEKRLVKRRLIANIDATQEHSRHH-------------LEAAMFEVVANTAEQLQPLMR----NNVESA---PCTNRDLPHEHMRSEHYTVPMGSTYQHHYQREKAFRQSRSHAFLLLIAMGNLAIVYSEWFCYFLLILNHMRSSTILSLPYPLTVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFIYFN---DPLEKPSVSAEALWLPRLFGLDKNDHYALFDLIQLISLFLHRGYLKNNGLWRDHTEFAQDLELVVEENRAAQMRRASRHSVERPKRESSSHAVLEGENSNNQVLSTSQQLSTINPRMSATGKSWNPFAKLHRFYLKMTDPRYNKKVDVYIYMFLCEFIAFWIMIFGYVSFGPSTGMGDNAFEFIKSNRIPLPFISMLLVQFIFIIIDRGLFLQKQVLGKFIFQIIHVLLIHGWLSFILPHITRSPFNASVAPQLLYLIKCVYFSLSAYQIRSGYPHRILGNFLTKNYNYLNLILFKGYLIIPFLYELRNVMDWMWTRSALSLYHWMELEDIYAKIFVLKCWRRSEIAYPTPRGVNRPAGKKALVGGLLLSFFFLCFWGPMALSSFIGATFDFNPPVLCTFSISFGGFPPIFEFTSREGNILRISESVHLDFKRCHEKDKQTFGFLNNFEAKDVRYITIDGFSGNIWAITPPSHSTLREKLADSKSDLLLHFHMRCRRHTKEIQTGQTSVEDIFSRRLGSNEKHQLLRVLNQSTSVEGLEESASSQEEPSFRTTDPVVLDATMPRYVLLRKDRLRAAYA-----KLGQKETYVNVSFNIHHDRLQTQSWWELKEREGPEPVDPCFEVLRGSVLGSKQRAAAKVLSIVTYNERVSDSLFGKVFSNYGIIGMYAAYIFLANRLLRTIYSNISYVIRLEELPHVDRILNLCNEIYLVRENNLLRLEEQLVAKLFFLYRSSETMIKWTRHPKHIIDKFTDK 3178          

HSP 2 Score: 280.026 bits (715), Expect = 1.711e-71
Identity = 140/314 (44.59%), Postives = 204/314 (64.97%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN--NIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIP--TRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLP--NEHYLVLRSGDYFLFEEHQEEDE 3224
            L  WLFLP     P A KL  D  Q++ V LQY+VFKIE   +   Y GG NRP++ N  P   +KDFIS+K SY+DY++  +F W YW++L IV   G+   TLFCLGYMIL+ +Y W+GQ  +L +R  L+ SWN+I+ YNF +IL KC+LQ+V CVY   + N  +CW + + G+ C+   +       + +  C  +++  +WDV CF+F++ QRKIF T+SF +VVLD+ + ++F SRGA LIN+KLM +++E+  +E +   K++EK+  I++     GR     NEHY++LRSGDY+LFE   EED+
Sbjct: 1130 LLQWLFLPGIYGSPNARKLTADFFQFVAVALQYHVFKIEQRPDAESYGGGPNRPVLANTPPGENEKDFISSKESYLDYMRHAVFYWSYWVSLAIVLATGVTWITLFCLGYMILSFIYLWMGQNVMLRKRINLIKSWNVIIGYNFCVILAKCSLQVVGCVYWTRLAN--QCWFVQLFGVQCMDPLSWSKFPPPAYDEECVTVSSGLHWDVFCFLFILFQRKIFMTRSFSHVVLDLNVQSQFASRGAYLINRKLMLVISEQAAREQRSLEKIREKLDVIQRRQAALGRNTANINEHYIMLRSGDYYLFEGDPEEDD 1441          

HSP 3 Score: 160.999 bits (406), Expect = 3.538e-52
Identity = 95/258 (36.82%), Postives = 133/258 (51.55%), Query Frame = 2
Query: 1082 DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHHEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELNYLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIVVAI 1855
            DN+ ++     L  LC KYWI  C + +LL+S+Q+ V I  +VYMM L+  +  F  SYSFWRRQM  +WW+ +VYS+ VL  IYT+QF+    LW  +T  ++E LKD G E F  ++L + LL+PV+ L+V I+QVHYFH PF+K S L   R S  +   E    L H         STS + +N+                           + D N     +  KL      +    WR LEIH+ K+I +AI
Sbjct:  662 DNTAYQKFTEVLRSLCVKYWIVVCCLSMLLISLQQPVVIFRIVYMMMLIYFLFVFQVSYSFWRRQMLFFWWINVVYSMAVLLCIYTYQFQNSPTLWRKFTGLSEEVLKDIGLETFHSAALFQRLLTPVVFLVVIILQVHYFHEPFLKRSALDRFR-SVPQQENEASGSLLHRGHTSLPSVSTSTSLSNF---------------------------MEDVNSMFQTVVSKLTSWAVSLTNCCWRFLEIHWIKVIALAI 891          

HSP 4 Score: 77.411 bits (189), Expect = 3.538e-52
Identity = 43/133 (32.33%), Postives = 67/133 (50.38%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQL-IILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE 2274
            + +F    +Q++  M FQL  +  N     + S            QMDN  +IGL K +DF  ++  +   MI+C  WH I Y Q ++Y+   + +P   +VFP  T  S+ + L + VK  +N+ FYK GLE
Sbjct:  925 TIMFFWTGLQVLCKMCFQLSFVPGNLSLPCDVS--------HNTSQMDNPTWIGLTKINDFYHYSLPMGMVMIVCVCWHAIAYRQRQFYSGPCNVRPREGIVFPRVTIDSMGYDLLNVVKFAVNYGFYKFGLE 1049          

HSP 5 Score: 100.908 bits (250), Expect = 4.406e-17
Identity = 62/133 (46.62%), Postives = 88/133 (66.17%), Query Frame = 2
Query:  629 PFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYV--TNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKE 1021
            P + S+  S ++NSYI + I+MMAWSVTY+SWL+F+LL+ ACILW++P+SR ACL  SP IV Y I+LI I YV   N+  +E+  ++         +SE G+  W+     L L I YL+ FWLTLRL++ +
Sbjct:  436 PLLLSLHYSAIRNSYILTLISMMAWSVTYRSWLSFILLLSACILWIMPNSRLACLYASPLIVLYAIVLILIQYVFGMNLTSEELPQSVT---PDGLRLSELGMQRWENAIGALSLQITYLICFWLTLRLFVMD 565          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A4S2LI04 (Piezo-type mechanosensitive ion channel component OS=Opisthorchis felineus OX=147828 GN=CRM22_007115 PE=3 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 401/934 (42.93%), Postives = 567/934 (60.71%), Query Frame = 3
Query: 3837 KNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEP-HINNT-------------------NNVIFVDETSQAQQ----FQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDI-ESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKG---FKDKFNI-----KEPEKKTN--------FNTLQTSSLTSRFI----------------------LLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSR-GDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-------------------TIPKKYAVLVKGLPRFLVATKTDFQDA-LVLGSENS-LNPLESYMIMLSIERSTSDWWQLHSH---KEFDCLSRNPFS------PDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            +  GQ   I++++N  L        I+  V E +   + +     N +   P H++                      ++  +D   + QQ    F++S SR FLL++A+GN+ I+YS+  CY++LV+NHM S N+LSL+YPL VFLW MLS PRP+  +WIF+I YT++VI+IKY+FQF+FI   +  +   +     ++P  LG+ K+ HYA+ DL+QL  LFLHRG+LKN GLW+    F     +     K  E+  N           L T S  S+ +                         PF  +++FY  +   +++K+VDVY+YMF+CEFISF+II+ GY +FGP TG    A +F++ +++P PF+ ML+ QFIFIIIDR LFLRK V+GK +FQI +V+LIH W+FF+ P I++S + A  APQ LY  KCVYF+LS+YQI+SGYPLRILGNFLTKKYNY+NL LFKGYL+VPFLYELRN+MDW+WT++ LSLYHWME+EDV+AKIFV KCWRRSE+ YPTPRG NR    K LVGGL++ FFF C W PL L S IG+ FV NPP  C  +L   GF  ++E+ SR G++L+    D  ++ + C++ ++  + F+ +FE DD+  + I   S +IW+ITPP+ D  +K L D    + L+S ++C R   + +T++  V+  F + L   E+ E+  +                     +      L   +PR+LV  +   + A   LG EN+ +N   S++I     ++ S WW+L          C  +  F        D      F+ER+SD+LFG+ F  YGI+G+Y AY+F+ +RL R VY+NISY+IR EELP+VDRIL L NEIYLVRENK+ RLEEQLVAKL F+YRS ETMI++TR  + I+D+  D+
Sbjct: 2372 RTSGQPTSISVRINRSLIHKHRPDSIIRSVAEDQFYPLDIEVAVFNVVSKSPEHVSGGVPFLDPQISDRCRAALVPGQSIEHLDALDRHQQREKAFRQSRSRPFLLLIALGNMAIVYSEWFCYLLLVVNHMRSSNILSLVYPLVVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFITFNDPSLKPADSAEALWIPRLLGVEKSGHYAIFDLVQLISLFLHRGFLKNDGLWRDHTEFVQDLQLVAERNKVAERVQNGEQVGPDFLRLLSTESAASQMVEGHNVDAVTSGRLTVSRRDALHTWNPFAKLRRFYHKMTDPQFNKKVDVYIYMFLCEFISFWIIMFGYVSFGPSTGMGDNAFEFIRSNRVPFPFVCMLLVQFIFIIIDRGLFLRKQVLGKFIFQILHVLLIHGWLFFILPHITKSPFTAGFAPQLLYLIKCVYFSLSAYQIRSGYPLRILGNFLTKKYNYINLILFKGYLIVPFLYELRNIMDWMWTNSTLSLYHWMELEDVYAKIFVHKCWRRSEIAYPTPRGVNRPAGKKALVGGLILAFFFACLWIPLALSSFIGATFVFNPPVLCTFSLSIGGFPPVFEFTSREGNILKIRQQDLDSFTR-CHEKDLQTVGFLNNFEVDDLRYITIDGFSGNIWAITPPSYDTLVKKLSDASSDLLLHSHMQCRRKTKEIQTSQISVEDIFSRKLQPLEKIELYDVLNTTAVGSAANNTQVKLSSRVLSSSPVTLNAVMPRYLVLKRDRLRPAYATLGRENTYIN--VSFVIHRDPAKNQS-WWELKERAITSSDACFEKLRFPTLGDSWADALSIMTFNERVSDSLFGKWFFTYGILGMYGAYLFLVNRLFRTVYTNISYVIRLEELPHVDRILNLCNEIYLVRENKLLRLEEQLVAKLFFLYRSSETMIKWTRHPKRIIDQFTDR 3301          

HSP 2 Score: 235.343 bits (599), Expect = 9.880e-73
Identity = 164/446 (36.77%), Postives = 238/446 (53.36%), Query Frame = 2
Query:  629 PFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRL-----------SVSSQIDRARS------SVIFE------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHHEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELN--------YLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIVVAI 1855
            P + S+  S +++SYI + IAMMAW+VTY+SWL+F+LL+ ACI+W+ P+SRAACL  SP IV Y I+LI I YV  +N        K       E++E G+ +W      L L I +LV FWLTLRL++ E+              SV   I R  S      +   E            DN+ ++     L  LC KYWI  C + +LL+SIQ+ V I  + YM+ L+  M FF  SY FWRRQM  +WW+ +VYS+ +L  IYT+QFK   E W   T  ++E LKD G E FD ++L   LL+PV+ L+V I+QVHYFH PF+K S             L+  N+L +E++ +   +ST+  Q+    + ++   +  L K    +AK           Y + D N A + +  KLI     +    WR +E+H+ K++ + I
Sbjct:  559 PLLLSLHFSAIRHSYIVTLIAMMAWAVTYRSWLSFILLLSACIVWISPNSRAACLYASPLIVLYAIVLILIQYVYGLNL-TTAELPKQVTPDGLEMAELGMKKWDNSVGALGLQITFLVFFWLTLRLFVNERSYRRFTTRSPTGYPSVGHPIGRGTSIWDRHLATSVESWFGSTFAFGTVDNTAYRRFTELLRALCVKYWIVVCCLSMLLISIQQPVVIFRIFYMVMLIYFMFFFQVSYGFWRRQMIFFWWINVVYSMAILLCIYTYQFKNSPEFWQRTTGLSEEVLKDIGLETFDSAALFARLLTPVLFLVVIILQVHYFHEPFLKRS------------ALDRFNRL-YELRDL---ASTTPQQSADHAATLSPSTTSSLSKLLRGFAKHNRRPMPRQTLYFIEDVNSAFHTIVTKLIAWAISLTNCCWRFMEVHWIKVVALLI 987          

HSP 3 Score: 71.633 bits (174), Expect = 9.880e-73
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE 2274
            + +F+   +  +  M FQL  ++       C+  NK         ++N  + GL+K  +F  +   +   M +C  WH I Y Q ++YN   + +P   +VFP  T  S+D+ L + VK  +N+ FYK GLE
Sbjct: 1021 TIVFVWTGLFTLCKMCFQLNFVQ-LNVTIVCADSNK------TTHLENASWAGLVKVQNFNHYILPMGALMFVCVFWHAISYRQKQFYNSPHNLRPHEGVVFPDVTIASLDNDLRNVVKFAINYGFYKFGLE 1145          

HSP 4 Score: 278.485 bits (711), Expect = 5.704e-71
Identity = 140/318 (44.03%), Postives = 207/318 (65.09%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN--NIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI-PTRENHISISI-ENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPN--EHYLVLRSGDYFLFEEHQEEDEYDDR 3236
            L  WLF+P     P A KL  D  Q++ V LQY VFKIE   ++ +Y GG N+P++ N +P  E++DF+S K SY+DYL+ +IF W YW++L IV   G+   TLFCLGYMIL+ +Y W+GQ  +L RR  L+ SWN+I+ YNF +IL KC+LQ+V CVY   + +  +CW I + G+ C+ P   +     + +  C  +++  +WDV+CFIF++ QRK+F T+SF +VV D+ + ++F SRGA LIN+KLM  ++E+  +E     K++EK+  I++     GR   N  EHY+++RSGDY+LFE   EED+   R
Sbjct: 1226 LLQWLFVPGQYGSPTAKKLTADFFQFVAVALQYQVFKIEKRFSVKEYGGGSNKPVLINNVPGKEERDFVSAKESYLDYLRHLIFYWSYWVSLAIVLATGVTWITLFCLGYMILSFIYLWMGQNVMLRRRSSLIKSWNVIIGYNFCVILAKCSLQVVGCVYWARMSH--QCWFIQLFGVQCMDPMSWSRFEPPVYDKQCETVSSGLHWDVICFIFILFQRKVFMTQSFSHVVFDLNVQSQFASRGAYLINRKLMTDISEQLAREELSLAKIREKLAVIQRRQAVLGRNTDNITEHYIMIRSGDYYLFEGDPEEDDEMPR 1541          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A4S2LHI2 (Piezo-type mechanosensitive ion channel component OS=Opisthorchis felineus OX=147828 GN=CRM22_007115 PE=3 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 401/934 (42.93%), Postives = 567/934 (60.71%), Query Frame = 3
Query: 3837 KNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEP-HINNT-------------------NNVIFVDETSQAQQ----FQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDI-ESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKG---FKDKFNI-----KEPEKKTN--------FNTLQTSSLTSRFI----------------------LLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSR-GDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-------------------TIPKKYAVLVKGLPRFLVATKTDFQDA-LVLGSENS-LNPLESYMIMLSIERSTSDWWQLHSH---KEFDCLSRNPFS------PDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            +  GQ   I++++N  L        I+  V E +   + +     N +   P H++                      ++  +D   + QQ    F++S SR FLL++A+GN+ I+YS+  CY++LV+NHM S N+LSL+YPL VFLW MLS PRP+  +WIF+I YT++VI+IKY+FQF+FI   +  +   +     ++P  LG+ K+ HYA+ DL+QL  LFLHRG+LKN GLW+    F     +     K  E+  N           L T S  S+ +                         PF  +++FY  +   +++K+VDVY+YMF+CEFISF+II+ GY +FGP TG    A +F++ +++P PF+ ML+ QFIFIIIDR LFLRK V+GK +FQI +V+LIH W+FF+ P I++S + A  APQ LY  KCVYF+LS+YQI+SGYPLRILGNFLTKKYNY+NL LFKGYL+VPFLYELRN+MDW+WT++ LSLYHWME+EDV+AKIFV KCWRRSE+ YPTPRG NR    K LVGGL++ FFF C W PL L S IG+ FV NPP  C  +L   GF  ++E+ SR G++L+    D  ++ + C++ ++  + F+ +FE DD+  + I   S +IW+ITPP+ D  +K L D    + L+S ++C R   + +T++  V+  F + L   E+ E+  +                     +      L   +PR+LV  +   + A   LG EN+ +N   S++I     ++ S WW+L          C  +  F        D      F+ER+SD+LFG+ F  YGI+G+Y AY+F+ +RL R VY+NISY+IR EELP+VDRIL L NEIYLVRENK+ RLEEQLVAKL F+YRS ETMI++TR  + I+D+  D+
Sbjct: 2353 RTSGQPTSISVRINRSLIHKHRPDSIIRSVAEDQFYPLDIEVAVFNVVSKSPEHVSGGVPFLDPQISDRCRAALVPGQSIEHLDALDRHQQREKAFRQSRSRPFLLLIALGNMAIVYSEWFCYLLLVVNHMRSSNILSLVYPLVVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFITFNDPSLKPADSAEALWIPRLLGVEKSGHYAIFDLVQLISLFLHRGFLKNDGLWRDHTEFVQDLQLVAERNKVAERVQNGEQVGPDFLRLLSTESAASQMVEGHNVDAVTSGRLTVSRRDALHTWNPFAKLRRFYHKMTDPQFNKKVDVYIYMFLCEFISFWIIMFGYVSFGPSTGMGDNAFEFIRSNRVPFPFVCMLLVQFIFIIIDRGLFLRKQVLGKFIFQILHVLLIHGWLFFILPHITKSPFTAGFAPQLLYLIKCVYFSLSAYQIRSGYPLRILGNFLTKKYNYINLILFKGYLIVPFLYELRNIMDWMWTNSTLSLYHWMELEDVYAKIFVHKCWRRSEIAYPTPRGVNRPAGKKALVGGLILAFFFACLWIPLALSSFIGATFVFNPPVLCTFSLSIGGFPPVFEFTSREGNILKIRQQDLDSFTR-CHEKDLQTVGFLNNFEVDDLRYITIDGFSGNIWAITPPSYDTLVKKLSDASSDLLLHSHMQCRRKTKEIQTSQISVEDIFSRKLQPLEKIELYDVLNTTAVGSAANNTQVKLSSRVLSSSPVTLNAVMPRYLVLKRDRLRPAYATLGRENTYIN--VSFVIHRDPAKNQS-WWELKERAITSSDACFEKLRFPTLGDSWADALSIMTFNERVSDSLFGKWFFTYGILGMYGAYLFLVNRLFRTVYTNISYVIRLEELPHVDRILNLCNEIYLVRENKLLRLEEQLVAKLFFLYRSSETMIKWTRHPKRIIDQFTDR 3282          

HSP 2 Score: 278.485 bits (711), Expect = 5.268e-71
Identity = 139/314 (44.27%), Postives = 206/314 (65.61%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN--NIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI-PTRENHISISI-ENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPN--EHYLVLRSGDYFLFEEHQEEDE 3224
            L  WLF+P     P A KL  D  Q++ V LQY VFKIE   ++ +Y GG N+P++ N +P  E++DF+S K SY+DYL+ +IF W YW++L IV   G+   TLFCLGYMIL+ +Y W+GQ  +L RR  L+ SWN+I+ YNF +IL KC+LQ+V CVY   + +  +CW I + G+ C+ P   +     + +  C  +++  +WDV+CFIF++ QRK+F T+SF +VV D+ + ++F SRGA LIN+KLM  ++E+  +E     K++EK+  I++     GR   N  EHY+++RSGDY+LFE   EED+
Sbjct: 1207 LLQWLFVPGQYGSPTAKKLTADFFQFVAVALQYQVFKIEKRFSVKEYGGGSNKPVLINNVPGKEERDFVSAKESYLDYLRHLIFYWSYWVSLAIVLATGVTWITLFCLGYMILSFIYLWMGQNVMLRRRSSLIKSWNVIIGYNFCVILAKCSLQVVGCVYWARMSH--QCWFIQLFGVQCMDPMSWSRFEPPVYDKQCETVSSGLHWDVICFIFILFQRKVFMTQSFSHVVFDLNVQSQFASRGAYLINRKLMTDISEQLAREELSLAKIREKLAVIQRRQAVLGRNTDNITEHYIMIRSGDYYLFEGDPEEDD 1518          

HSP 3 Score: 234.187 bits (596), Expect = 1.341e-57
Identity = 141/331 (42.60%), Postives = 191/331 (57.70%), Query Frame = 2
Query:  629 PFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRL-----------SVSSQIDRARS------SVIFE------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            P + S+  S +++SYI + IAMMAW+VTY+SWL+F+LL+ ACI+W+ P+SRAACL  SP IV Y I+LI I YV  +N        K       E++E G+ +W      L L I +LV FWLTLRL++ E+              SV   I R  S      +   E            DN+ ++     L  LC KYWI  C + +LL+SIQ+ V I  + YM+ L+  M FF  SY FWRRQM  +WW+ +VYS+ +L  IYT+QFK   E W   T  ++E LKD G E FD ++L   LL+PV+ L+V I+QVHYFH PF+K S L
Sbjct:  559 PLLLSLHFSAIRHSYIVTLIAMMAWAVTYRSWLSFILLLSACIVWISPNSRAACLYASPLIVLYAIVLILIQYVYGLNL-TTAELPKQVTPDGLEMAELGMKKWDNSVGALGLQITFLVFFWLTLRLFVNERSYRRFTTRSPTGYPSVGHPIGRGTSIWDRHLATSVESWFGSTFAFGTVDNTAYRRFTELLRALCVKYWIVVCCLSMLLISIQQPVVIFRIFYMVMLIYFMFFFQVSYGFWRRQMIFFWWINVVYSMAILLCIYTYQFKNSPEFWQRTTGLSEEVLKDIGLETFDSAALFARLLTPVLFLVVIILQVHYFHEPFLKRSAL 888          

HSP 4 Score: 71.633 bits (174), Expect = 2.831e-8
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE 2274
            + +F+   +  +  M FQL  ++       C+  NK         ++N  + GL+K  +F  +   +   M +C  WH I Y Q ++YN   + +P   +VFP  T  S+D+ L + VK  +N+ FYK GLE
Sbjct: 1002 TIVFVWTGLFTLCKMCFQLNFVQ-LNVTIVCADSNK------TTHLENASWAGLVKVQNFNHYILPMGALMFVCVFWHAISYRQKQFYNSPHNLRPHEGVVFPDVTIASLDNDLRNVVKFAINYGFYKFGLE 1126          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: A0A4S2LHK5 (Piezo-type mechanosensitive ion channel component OS=Opisthorchis felineus OX=147828 GN=CRM22_007115 PE=3 SV=1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 416/999 (41.64%), Postives = 596/999 (59.66%), Query Frame = 3
Query: 3582 DTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVDETSQAQQ----FQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDI-ESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKG---FKDKFNI-----KEPEKKTN--------FNTLQTSSLTSRFI----------------------LLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSR-GDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-------------------TIPKKYAVLVKGLPRFLVATKTDFQDA-LVLGSENS-LNPLESYMIMLSIERSTSDWWQLHSH---KEFDCLSRNPFS------PDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            D     ++++     W K  +     Y F L+ +D LI  +N LTK  R +R  +E EKR +K  +I  T+                +   L+I + +   ++++ +H       ++ +  D                +    ++  +D   + QQ    F++S SR FLL++A+GN+ I+YS+  CY++LV+NHM S N+LSL+YPL VFLW MLS PRP+  +WIF+I YT++VI+IKY+FQF+FI   +  +   +     ++P  LG+ K+ HYA+ DL+QL  LFLHRG+LKN GLW+    F     +     K  E+  N           L T S  S+ +                         PF  +++FY  +   +++K+VDVY+YMF+CEFISF+II+ GY +FGP TG    A +F++ +++P PF+ ML+ QFIFIIIDR LFLRK V+GK +FQI +V+LIH W+FF+ P I++S + A  APQ LY  KCVYF+LS+YQI+SGYPLRILGNFLTKKYNY+NL LFKGYL+VPFLYELRN+MDW+WT++ LSLYHWME+EDV+AKIFV KCWRRSE+ YPTPRG NR    K LVGGL++ FFF C W PL L S IG+ FV NPP  C  +L   GF  ++E+ SR G++L+    D  ++ + C++ ++  + F+ +FE DD+  + I   S +IW+ITPP+ D  +K L D    + L+S ++C R   + +T++  V+  F + L   E+ E+  +                     +      L   +PR+LV  +   + A   LG EN+ +N   S++I     ++ S WW+L          C  +  F        D      F+ER+SD+LFG+ F  YGI+G+Y AY+F+ +RL R VY+NISY+IR EELP+VDRIL L NEIYLVRENK+ RLEEQLVAKL F+YRS ETMI++TR  + I+D+  D+
Sbjct: 2204 DDSNTPAAQQREEGCWSKFKAFCLVTYLFLLSSVDSLIYLLNGLTKHYRNIRRRIEREKRCVKLNVINNTQ--------------HPEQSPLDIEVAVFNVVSKSPEHVSGGVPFLDPQISD-----------RCRAALVPGQSIEHLDALDRHQQREKAFRQSRSRPFLLLIALGNMAIVYSEWFCYLLLVVNHMRSSNILSLVYPLVVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFITFNDPSLKPADSAEALWIPRLLGVEKSGHYAIFDLVQLISLFLHRGFLKNDGLWRDHTEFVQDLQLVAERNKVAERVQNGEQVGPDFLRLLSTESAASQMVEGHNVDAVTSGRLTVSRRDALHTWNPFAKLRRFYHKMTDPQFNKKVDVYIYMFLCEFISFWIIMFGYVSFGPSTGMGDNAFEFIRSNRVPFPFVCMLLVQFIFIIIDRGLFLRKQVLGKFIFQILHVLLIHGWLFFILPHITKSPFTAGFAPQLLYLIKCVYFSLSAYQIRSGYPLRILGNFLTKKYNYINLILFKGYLIVPFLYELRNIMDWMWTNSTLSLYHWMELEDVYAKIFVHKCWRRSEIAYPTPRGVNRPAGKKALVGGLILAFFFACLWIPLALSSFIGATFVFNPPVLCTFSLSIGGFPPVFEFTSREGNILKIRQQDLDSFTR-CHEKDLQTVGFLNNFEVDDLRYITIDGFSGNIWAITPPSYDTLVKKLSDASSDLLLHSHMQCRRKTKEIQTSQISVEDIFSRKLQPLEKIELYDVLNTTAVGSAANNTQVKLSSRVLSSSPVTLNAVMPRYLVLKRDRLRPAYATLGRENTYIN--VSFVIHRDPAKNQS-WWELKERAITSSDACFEKLRFPTLGDSWADALSIMTFNERVSDSLFGKWFFTYGILGMYGAYLFLVNRLFRTVYTNISYVIRLEELPHVDRILNLCNEIYLVRENKLLRLEEQLVAKLFFLYRSSETMIKWTRHPKRIIDQFTDR 3173          

HSP 2 Score: 278.485 bits (711), Expect = 5.159e-71
Identity = 140/318 (44.03%), Postives = 207/318 (65.09%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN--NIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI-PTRENHISISI-ENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPN--EHYLVLRSGDYFLFEEHQEEDEYDDR 3236
            L  WLF+P     P A KL  D  Q++ V LQY VFKIE   ++ +Y GG N+P++ N +P  E++DF+S K SY+DYL+ +IF W YW++L IV   G+   TLFCLGYMIL+ +Y W+GQ  +L RR  L+ SWN+I+ YNF +IL KC+LQ+V CVY   + +  +CW I + G+ C+ P   +     + +  C  +++  +WDV+CFIF++ QRK+F T+SF +VV D+ + ++F SRGA LIN+KLM  ++E+  +E     K++EK+  I++     GR   N  EHY+++RSGDY+LFE   EED+   R
Sbjct: 1207 LLQWLFVPGQYGSPTAKKLTADFFQFVAVALQYQVFKIEKRFSVKEYGGGSNKPVLINNVPGKEERDFVSAKESYLDYLRHLIFYWSYWVSLAIVLATGVTWITLFCLGYMILSFIYLWMGQNVMLRRRSSLIKSWNVIIGYNFCVILAKCSLQVVGCVYWARMSH--QCWFIQLFGVQCMDPMSWSRFEPPVYDKQCETVSSGLHWDVICFIFILFQRKVFMTQSFSHVVFDLNVQSQFASRGAYLINRKLMTDISEQLAREELSLAKIREKLAVIQRRQAVLGRNTDNITEHYIMIRSGDYYLFEGDPEEDDEMPR 1522          

HSP 3 Score: 234.572 bits (597), Expect = 1.287e-57
Identity = 141/331 (42.60%), Postives = 191/331 (57.70%), Query Frame = 2
Query:  629 PFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRL-----------SVSSQIDRARS------SVIFE------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            P + S+  S +++SYI + IAMMAW+VTY+SWL+F+LL+ ACI+W+ P+SRAACL  SP IV Y I+LI I YV  +N        K       E++E G+ +W      L L I +LV FWLTLRL++ E+              SV   I R  S      +   E            DN+ ++     L  LC KYWI  C + +LL+SIQ+ V I  + YM+ L+  M FF  SY FWRRQM  +WW+ +VYS+ +L  IYT+QFK   E W   T  ++E LKD G E FD ++L   LL+PV+ L+V I+QVHYFH PF+K S L
Sbjct:  559 PLLLSLHFSAIRHSYIVTLIAMMAWAVTYRSWLSFILLLSACIVWISPNSRAACLYASPLIVLYAIVLILIQYVYGLNL-TTAELPKQVTPDGLEMAELGMKKWDNSVGALGLQITFLVFFWLTLRLFVNERSYRRFTTRSPTGYPSVGHPIGRGTSIWDRHLATSVESWFGSTFAFGTVDNTAYRRFTELLRALCVKYWIVVCCLSMLLISIQQPVVIFRIFYMVMLIYFMFFFQVSYGFWRRQMIFFWWINVVYSMAILLCIYTYQFKNSPEFWQRTTGLSEEVLKDIGLETFDSAALFARLLTPVLFLVVIILQVHYFHEPFLKRSAL 888          

HSP 4 Score: 71.633 bits (174), Expect = 3.069e-8
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE 2274
            + +F+   +  +  M FQL  ++       C+  NK         ++N  + GL+K  +F  +   +   M +C  WH I Y Q ++YN   + +P   +VFP  T  S+D+ L + VK  +N+ FYK GLE
Sbjct: 1002 TIVFVWTGLFTLCKMCFQLNFVQ-LNVTIVCADSNK------TTHLENASWAGLVKVQNFNHYILPMGALMFVCVFWHAISYRQKQFYNSPHNLRPHEGVVFPDVTIASLDNDLRNVVKFAINYGFYKFGLE 1126          
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Match: G7YE70 (Piezo-type mechanosensitive ion channel component OS=Clonorchis sinensis OX=79923 GN=CLF_105772 PE=3 SV=1)

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 386/843 (45.79%), Postives = 545/843 (64.65%), Query Frame = 3
Query: 4038 QAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDI-ESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKG----------FKDKFNIKE---------PE---------------KKTNFNTLQTSSLT-SRFILL---KPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSR-GDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEI-------------------ASLFTIPKKYAVLVKGLPRFLVATKTDFQDA-LVLGSENS-LNPLESYMIMLSIERSTSDWWQLHSH---KEFDCLSRNPFS------PDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            + + F++S SR FLL++A+GN+ I+YS+  CY++LV+NHM S N+LSL+YPL VFLW MLS PRP+  +WIF+I YT++VI+IKY+FQF+FI   +  +   +     ++P  LG+ K+ HYA+ DL+QL  LFLHRG+LKN GLW+             ++  + E         P+               ++ N + + +  LT SR   L    PF  +++FY  +   +++K+VDVY+YMF+CEFISF+II++GY +FGP TG    A +F++ +++P PF+ ML+ QFIFII+DR LFLRK V+GK +FQI +V+LIH W+FF+ P I++S + A  APQ LY  KCVYF+LS+YQI+SGYPLRILGNFLTKKYNY+NL LFKGYL++PFLYELRN+MDW+WT++ LSLYHWME+EDV+AKIFV KCWRRSE+ YPTPRG NR    K LVGGL++ FFF C W PL L S IG+ FV NPP  C  +L   GF  ++E+ SR G++L+    D  ++ + C++ ++  + F+ +FE DD+  + I   S +IW+ITPP+ D  +K L D    + L+S ++C R   + +T++  V+  F + L   E+ E+                    S   I      L   +PR+LV  +   + A   LG E++ +N   S++I     ++ S WW+L          C  +  F        D      F+ER+SD+LFG+ F  YGI+G+Y AY+F+ +RL R VY+NISY+IR EELP+VDRIL L NEIYLVRENK+ RLEEQLVAKL F+YRS ETMI++TR  + I+D+  D+
Sbjct: 2351 REKAFRQSRSRPFLLLIALGNMAIVYSEWFCYLLLVVNHMRSSNILSLVYPLVVFLWGMLSVPRPTKTFWIFLITYTEVVIVIKYIFQFRFITFNDPSLKPADSAEALWIPRLLGVEKSGHYAIFDLVQLISLFLHRGFLKNDGLWRDHTEFVQDLQLVAERNKVAERVQNGEQVGPDFLRLLSTESAASQMTERHNVDGVTSGRLTVSRRDALHTWNPFAKLRRFYHKMTDPQFNKKVDVYIYMFLCEFISFWIIMLGYVSFGPSTGMGDNAFEFIRSNRVPFPFVCMLLVQFIFIIVDRGLFLRKQVLGKFIFQILHVLLIHGWLFFILPHITKSPFTAGFAPQLLYLIKCVYFSLSAYQIRSGYPLRILGNFLTKKYNYINLILFKGYLIIPFLYELRNIMDWMWTNSTLSLYHWMELEDVYAKIFVHKCWRRSEIAYPTPRGVNRPAGKKALVGGLILAFFFACLWIPLALSSFIGATFVFNPPVLCTFSLSIGGFPPVFEFTSREGNILKIRQQDLDSFTR-CHEKDLQTVGFLNNFEVDDLRYITIDGFSGNIWAITPPSYDTLVKKLSDASSDLLLHSHMQCRRKTKEIQTSQISVEDIFSRKLQPLEKIELYGVLNTTAVGSAYNNTQVKPSSRVISSSPVTLNAVMPRYLVLKRDRLRPAYATLGLESTYIN--VSFVIHRDPAKNQS-WWELKERAITSSDACFEKLRFPTLGDSWADALSIMTFNERVSDSLFGKWFFTYGILGMYGAYLFLVNRLFRTVYTNISYVIRLEELPHVDRILNLCNEIYLVRENKLLRLEEQLVAKLFFLYRSSETMIKWTRHPKRIIDQFTDR 3189          

HSP 2 Score: 236.884 bits (603), Expect = 2.351e-73
Identity = 162/449 (36.08%), Postives = 245/449 (54.57%), Query Frame = 2
Query:  629 PFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFE---PYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKI--RLSVSSQIDR-------ARSSVIFE--------------------DNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHHEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELN--------YLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIVVAI 1855
            P + S+  S +++SYI + IAMMAW+VTY+SWL+F+LL+ ACI+W+ P+SRAACL  SP IV Y I+LI I Y+  +N    + T ++  +      E++E G+ +W+I    L L I +LV FWLTLRL++ E+   R +  S            R + I++                    DN+ ++     L  LC KYWI  C + +LL+SIQ+ V I  + YM+ L+  M FF  SY FWRRQM  +WW+ +VYS+ +L  IYT+QF+   E W   T  ++E LKD G E FD ++L   LL+PV+ L+V I+QVHYFH PF+K S L      F+R          +E++ +   +ST+  Q+    + ++   +  L K   S+AK           Y + D N A + +  KLI     +    WR +E+H+ K++ + I
Sbjct:  445 PLLLSLHFSAIRHSYIVTLIAMMAWAVTYRSWLSFILLLSACIMWISPNSRAACLYASPVIVLYAIVLILIQYIYGLN----LTTAELPQQVTPDGLEMAELGMKKWEISVGALGLQITFLVFFWLTLRLFVNERSYRRYATRSPTGYPSVGHFVGRGTSIWDRHLATSFGSWFGSTFAFGTVDNTAYRRFTELLRALCVKYWIVVCCLSMLLISIQQPVVIFRIFYMVMLIYFMFFFQVSYGFWRRQMIFFWWINVVYSMAILLCIYTYQFRNSPEFWQRTTGLSEEVLKDIGLETFDSAALFARLLTPVLFLVVIILQVHYFHEPFLKRSALD----RFNR---------MYELRDL---ASTTPQQSADHAATLSPSTTSSLSKLLRSFAKRNRRPMPRQTLYFIEDVNSAFHTIVTKLIAWAISLTNCCWRFMEVHWIKVVALLI 873          

HSP 3 Score: 72.4034 bits (176), Expect = 2.351e-73
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE 2274
            + +F+   +  +  M FQL  ++       C+  NK         ++N  + GL+K  +F  +   +   M +C  WH I Y Q ++YN   + +P   +VFP  T  S+D+ L + VK  +N+ FYK GLE
Sbjct:  907 TIVFVWTGLLTLCKMCFQLNFVQ-LNVTIVCADSNK------TTHLENASWAGLIKVQNFNHYILPMGALMFVCVFWHAISYRQKQFYNSPHNLRPHEGVVFPDVTMASLDNDLRNVVKFAINYGFYKFGLE 1031          

HSP 4 Score: 278.87 bits (712), Expect = 3.690e-71
Identity = 144/343 (41.98%), Postives = 216/343 (62.97%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIEN--NIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI-PTRENHISISI-ENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPN--EHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNE 3311
            L  WLF+P     P A KL  D  Q++ V LQY VFKIE   ++ +Y GG N+P++ N +P  +++DF+S K SY+DYL+ +IF W YW++L IV   G+   TLFCLGYMIL+ +Y W+GQ  +L +R  L+ SWN+I+ YNF +IL KC+LQ+V CVY   + +  +CW I + G+ C+ P   +     + +  C  +++  +WDV+CFIF++ QRK+F T+SF +VV D+ + ++F SRGA LIN+KLM  ++E+  +E  L  K++EK+  I++     GR   N  EHY+++RSGDY+LFE   EE   DD +  S     G   K   +I+  + E
Sbjct: 1112 LLQWLFVPGQYGSPTAKKLTADFFQFVAVALQYQVFKIEKRFSVKEYGGGSNKPVLINNVPGKDERDFVSAKESYLDYLRHLIFYWSYWVSLAIVLATGVTWITLFCLGYMILSFIYLWMGQNVMLRKRSSLIKSWNVIIGYNFCVILAKCSLQVVGCVYWARMSH--QCWFIQLFGVQCMDPMSWSRFEPPVYDKQCETVSSGLHWDVICFIFILFQRKVFMTQSFSHVVFDLNVQSQFASRGAYLINRKLMTDISEQLAREELLLAKIREKLAVIQRRQAVLGRNTDNITEHYIMIRSGDYYLFEGDPEE---DDEMPRSAPAKGGKKRKPPPKIQGSAPE 1449          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:HGNC Symbol;Acc:HGNC:26270])

HSP 1 Score: 388.652 bits (997), Expect = 2.483e-108
Identity = 224/595 (37.65%), Postives = 347/595 (58.32%), Query Frame = 3
Query: 4578 FITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLF-----TIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHK----EFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            ++ +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG   G        L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  +++     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ L+PFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    ++L   GF  I+  +++   L +++  +++     +  N  A+ F++++   D+T+ ++   S S+W+I+PP+K   +  L        L      +RN S       +     + NL    + ++A L      T   K  V +K + PR+L A  +D    L+      ++     + +   E S  +WW ++  K    + + +  N  SP + + +IFS+++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K+
Sbjct: 2106 YLPIRQFFYNLIHPDYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHQGGADIT-SSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVVLVFGIHFWMFFILPGVTERRFSQNRIAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLIPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNTPLDVSVSLTLGGFQPIFTMSAQQKNLNSITSAKFDNFVKHFSKNSFAVQFLEAYVYQDLTVAHLEGSSNSMWTISPPSKKNLIGMLNQADSDFPLTMTWSIQRNLS-LGAKSEMATGKKIINLDKETKIQLAKLLIETNSTDAHKKPVCIKSIFPRYLRA-PSDSNAKLIEQLSTDID-----LFLNRAEDSNKEWWVVNQTKFGLLKLESVKIND-SP-RLELYIFSDQVSPPSLG-FLAGYGIMGLYMSVVLVIGKFVREFFSGISHTIMFEELPNVDRILKLCTDIFLVRETGELDLEEDLYAKLIFLYRSPETMIKWTREKK 2689          

HSP 2 Score: 124.02 bits (310), Expect = 1.640e-27
Identity = 109/362 (30.11%), Postives = 167/362 (46.13%), Query Frame = 3
Query: 2277 YPFHFPYLLED-----WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPI----------VFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI-----PTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKEN-----------------QLFTKVKEKILRIEQTHQNYGRPLPNEH---------------YLVLRSGDYFLFE 3203
            YP+ FP    +     WLFLP +   P +  L+ D +  +  +LQ  VF  EN    +   G+N  I          V N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K LL  W+ ++ YN  +I +K    L++C YID +   S CWLI +L + C      P   +   +  ++  G I     WD +CF FL++QR++F +  F +VV D++      SRGA L    ++  +    E+EN                 Q F K KEK+L + Q   +    +P E                  V+RSGDY+LFE
Sbjct: 1085 YPWRFPSSTTNSNVIKWLFLPDFSTRPNSMFLLYDFMLLLSASLQRQVFDEENKAAVRLMAGDNVEICRDLDAASFSVHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKLLHYWDFLIAYNVFVITMKNIFSLLACGYIDSMQKNS-CWLIQLLSLACTIKEYTPPNTDRCDLP-KDEAGII-----WDSICFSFLLLQRRVFMSYYFLHVVADIRAGQILASRGAELFQASIVKAVRARLEEENKSMEQLKRQMDRIKTRQQKFKKGKEKMLSMTQESGDGQNLIPPEEEDDDDAFVFTFPTFLLSVVRSGDYYLFE 1433          

HSP 3 Score: 110.538 bits (275), Expect = 1.792e-23
Identity = 66/171 (38.60%), Postives = 109/171 (63.74%), Query Frame = 3
Query: 4008 NNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDKFNIKEPEKKT 4520
            N + + +E   +++F K+      L  A+ NL++ +S+M+ Y+++++NHMIS +M++L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     + N ++++ P+  P  +G+ K + Y   DL+QL  LF HR  LK HGLW    D+ + K  +K T
Sbjct: 1813 NKMFYDEELEGSERFYKTQPLGLQLCYALYNLLVAHSEMVSYLVIILNHMISASMVTLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFSF--FPFNQNMIDRNKPYHPPNIIGVEKKDGYVHYDLIQLLTLFFHRSILKCHGLW----DEDDPKAKKKDT 1977          

HSP 4 Score: 108.997 bits (271), Expect = 5.041e-23
Identity = 94/326 (28.83%), Postives = 156/326 (47.85%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRL-YMKEKIRLS-VSSQIDR-------------------------ARSSVIFEDNSTFKSLVYFLHKLC----AKYWIFGCTICLLLVSIQK--QVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SY+ + IAMM WS+TY SWLTFV L+ +C LW++ D R   ++ SPF+V YG +L+ + Y+ +   + + +   IF  P    SE          +  LL+   L+   LT R   +KE+  LS V+ + ++                         A      E++     LV  + KL      KYWI+ C     LVS +    + +  + YMM  +  +  +   +  WRR +  +W  V+VY++ V+  IYT QF      W   T  + E+L   G + F+++ L   +  P   L+V I+ +HYFH  F++++D+
Sbjct:  396 IMKQSYVCALIAMMTWSITYVSWLTFVFLLWSCALWMVRDRRKYAMLTSPFMVAYGNLLLVLQYIWSF--ETLKDVPDIFKTPTVPFSELS------SKVLCLLSFWLLLRQTLTERQDKLKEEAVLSEVTVETEKKGETQTRPENKWFTGHKHFKIFVCFADEEKQVEEDGMENDLVQVVGKLVMAMLVKYWIYICGSMFFLVSFEDVDHIAMYKVFYMMMFLFCVAMYQVDFERWRRILKYFWMSVVVYTMLVVILIYTCQFTTSVPFWSKVTGVSTESLGKLGLKQFEVTELFRRIFIPTSFLLVCILHLHYFHEHFLELTDI 713          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 383.645 bits (984), Expect = 1.026e-106
Identity = 226/606 (37.29%), Postives = 352/606 (58.09%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESYM-------IMLSIERSTS------DWWQLHSHKEFDCLSRNPFSPDKT-----KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ +I +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  +++  M  Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++ + L+ +++ E+    + Y     A+ F++++  +DVT   +   S S+W+I+PP++   M+ +L K+    +      +RN S       V     V  L    R E+ +L    +  AV++K + P F+ A            S+++  P++          I L ++RS +      +WW +          ++    ++      + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2234 LEIYIPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLKFMNSYNYIPGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLME-VLSKEDQFPVTMSWTIQRNLS-LGAKAEVAMDKHVTYLDTNTRQELINLLNGTRNKAVIIKEVFPCFIRAP-----------SDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2824          

HSP 2 Score: 129.028 bits (323), Expect = 4.587e-29
Identity = 99/308 (32.14%), Postives = 159/308 (51.62%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRAR-SSVIFEDNST--------------FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            ++K SYI + IAMMAWS+TY SWLTFV LI +C LW++ D R   ++ SPF+V YG +LI + Y+ +    E +  +   F            + ++PF  L   I  L+ FWL LR  + E+       Q D  + S +  ED S                  L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y  WR  +  +W  ++VY++ VL  IYTFQF+    +W N T  ++E L+D G E F +++L   +  P   L+V I+ +HYFH+ F++++D+
Sbjct:  520 IMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYAMLTSPFMVFYGNLLIVLQYIWSF---ETLTPVPGLF-----------LKKEVPFRELGSKILCLLSFWLLLRQALTER----RERQRDETQLSDIRVEDCSPEKEMEEEPGEQREMMDVLGSTVMAMLNKYWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQVHYERWRWMLKYFWMSIVVYTMLVLILIYTFQFESSIHVWSNMTGLSKEKLEDLGLEQFSVAALFTRIFIPTSFLLVCILHLHYFHDRFLQLTDI 809          

HSP 3 Score: 119.013 bits (297), Expect = 5.127e-26
Identity = 64/155 (41.29%), Postives = 103/155 (66.45%), Query Frame = 3
Query: 4008 NNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            N + + +E  ++++F  S  ++  L  A+ N+++ +S+M+CY+++++NHMIS ++ +L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     ++  L+K  PF  P  +G+ K E Y   DL+QL  LF HR  LK HGLW
Sbjct: 1953 NRMFYDEELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQNIE-LDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLW 2106          

HSP 4 Score: 115.546 bits (288), Expect = 6.277e-25
Identity = 85/308 (27.60%), Postives = 150/308 (48.70%), Query Frame = 3
Query: 2277 YPFHFPYLLED-----WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENN-IYKYKGGENRPIV----------FNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGR 3146
            YP+  P    D     WL+LP +   P +  L+ D +  +C +LQ  VF+ E++   +   G+N  I            N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  + CWLI +  + C     +         C   +++    WD +CF  L++QR++F +  F +VV D++ +    SRGA L    ++  +    E+E +    +K ++ RI+   Q + R
Sbjct: 1189 YPWRNPSSSMDSNVVKWLYLPDFRTKPNSLFLLYDFMLLLCASLQRRVFEEEDDSAVRLLAGDNVEICRDLDAASFSQHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKALVT-NHCWLIQLFSLACTIKGYSRPEQQANKQCELPSDEAGIIWDSICFASLLLQRRVFMSYYFLHVVADIRSSQVLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQKFKR 1489          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo2a.2 (piezo-type mechanosensitive ion channel component 2-like [Source:NCBI gene;Acc:103047759])

HSP 1 Score: 379.022 bits (972), Expect = 2.556e-105
Identity = 227/609 (37.27%), Postives = 354/609 (58.13%), Query Frame = 3
Query: 4563 ILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEY-NYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGL-PRFLVATKTDFQDALVLGSENSLNPLESYM-------IMLSIERSTS------DWWQLHSHKEFDCLSRNPFSPDKT-----KFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            I L+ +I +++F+ NL    YS   DVYV MF+ + + F IIV G+ AFG  + +       L + ++P  F++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P ++  +++  M  Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++ + L+ +++ E+ N + +       A+ F++++  +DVT   +   S S+W+I+PP++   M+ +L K+    +      +RN S       V     V  L    R E+ +L    +  AV++K + P F+ A            S+++  P++          I L ++RS +      +WW +          ++    ++      + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE L AKLIF+YRS ETMI++TR K
Sbjct: 2085 ITLEIYIPIRQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADIT-SSLSEDQVPEAFLVMVLIQFGTMVVDRALYLRKTVMGKVIFQVILVFGIHFWMFFILPGVTERRFSQNMVAQLWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFVLKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVMLLICIVWFPLLFMSLVKSVAGVVNKPLDVSVTITLGGFQPIFTMSAQQNQLKDVTEAEFLNLMCNICFFPQGAMQFLEAYTAEDVTEAELEGNSNSLWTISPPSRKSLME-VLSKEDQFPVTMSWTIQRNLS-LGAKAEVAMDKHVTYLDTNTRQELINLLNGTRNKAVIIKEVFPCFIRAP-----------SDSNAKPIDHLYGDNGYKDITLDLKRSDNSSGEIQEWWIVDQPSAGMIDMKSGVKTEQKREAGLRLYVFSDKVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREK 2678          

HSP 2 Score: 130.568 bits (327), Expect = 1.336e-29
Identity = 106/349 (30.37%), Postives = 172/349 (49.28%), Query Frame = 2
Query:  557 KKNRFTEHIHNTETTATGMP-AISLPFIWSVITSLVK-------NSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRAR-SSVIFEDNST--------------FKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            K  R    ++  +     +P A+S P     + ++VK        SYI + IAMMAWS+TY SWLTFV LI +C LW++ D R   ++ SPF+V YG +LI + Y+ +    E +  +   F            + ++PF  L   I  L+ FWL LR  + E+       Q D  + S +  ED S                  L   +  +  KYWI+ C      VS + ++ +  ++YMM  +  +  +   Y  WR  +  +W  ++VY++ VL  IYTFQF+    +W N T  ++E L+D G E F +++L   +  P   L+V I+ +HYFH+ F++++D+
Sbjct:  421 KAERMDSSMYEIDPVQDELPGALSSPEKAERVNAVVKTFRFIMKQSYICALIAMMAWSITYVSWLTFVFLIWSCTLWMVRDRRKYAMLTSPFMVFYGNLLIVLQYIWSF---ETLTPVPGLF-----------LKKEVPFRELGSKILCLLSFWLLLRQALTER----RERQRDETQLSDIRVEDCSPEKEMEEEPGEQREMMDVLGSTVMAMLNKYWIYICGGMFFFVSFEGRIVMYKIIYMMMFLFCVALYQVHYERWRWMLKYFWMSIVVYTMLVLILIYTFQFESSIHVWSNMTGLSKEKLEDLGLEQFSVAALFTRIFIPTSFLLVCILHLHYFHDRFLQLTDI 751          

HSP 3 Score: 118.242 bits (295), Expect = 7.708e-26
Identity = 64/155 (41.29%), Postives = 103/155 (66.45%), Query Frame = 3
Query: 4008 NNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            N + + +E  ++++F  S  ++  L  A+ N+++ +S+M+CY+++++NHMIS ++ +L+ P+ +FLWAMLS PRPS  +W+  I+YT++ I+IKY FQF F     ++  L+K  PF  P  +G+ K E Y   DL+QL  LF HR  LK HGLW
Sbjct: 1800 NRMFYDEELEESERFYSSQPQILQLCYALYNMLVAHSEMVCYLVIILNHMISASVATLVLPILIFLWAMLSVPRPSKRFWMTAIVYTEVTIVIKYFFQFGFFPFNQNIE-LDKSKPFHPPNIIGVEKKEGYVHYDLVQLLALFFHRSILKCHGLW 1953          

HSP 4 Score: 115.161 bits (287), Expect = 8.184e-25
Identity = 85/308 (27.60%), Postives = 150/308 (48.70%), Query Frame = 3
Query: 2277 YPFHFPYLLED-----WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENN-IYKYKGGENRPIV----------FNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGR 3146
            YP+  P    D     WL+LP +   P +  L+ D +  +C +LQ  VF+ E++   +   G+N  I            N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L + +C YI  ++  + CWLI +  + C     +         C   +++    WD +CF  L++QR++F +  F +VV D++ +    SRGA L    ++  +    E+E +    +K ++ RI+   Q + R
Sbjct: 1102 YPWRNPSSSMDSNVVKWLYLPDFRTKPNSLFLLYDFMLLLCASLQRRVFEEEDDSAVRLLAGDNVEICRDLDAASFSQHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKSILHYWDFLIAYNVFVITMKNILSIAACGYIKALVT-NHCWLIQLFSLACTIKGYSRPEQQANKQCELPSDEAGIIWDSICFASLLLQRRVFMSYYFLHVVADIRSSQVLASRGAELFQATIVKAVKARIEEEKKSMDLLKRQMDRIKSRQQKFKR 1402          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 355.525 bits (911), Expect = 4.037e-98
Identity = 226/595 (37.98%), Postives = 343/595 (57.65%), Query Frame = 3
Query: 4593 KFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTE----RTEIASLFTIPKKYAVLVKGL-PRFLVA---TKTDFQDALVLGSENSLNPLESYM-IMLSIERSTS-------DWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            +F+ N+    Y    DVY  MF+ + + F IIV G+ AFG  + +   A   L + ++P  F++ML+ QF  ++IDRAL+LRK V+GKL+FQI  V  IH+W+FF+ P ++   +N     Q  YF KC+YF LS+YQ++ GYP RILGNFLTKKYN+LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL +WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL++ F     W PL+  S++ S+  V N P    +T++  G+  ++  + +   +Q  ++ +YN++ + + +N VA+ F+  +  +D+    I   S S+W I+PP++   +K LL     M L      +R   D     TV +     +++L      R ++ASL    +   V V  + P ++ A    +      L  G E      E Y  + LS+ R  S       +WW +      DC  ++  +       IF++++S    G   + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE+L +KLIF+YRS ETMI++TR K
Sbjct: 1900 RFFHNILHAEYRAATDVYALMFLTDVVDFIIIVFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIQFSTMVIDRALYLRKAVLGKLIFQIILVFGIHLWMFFILPAVTERMFNQNFVAQLWYFVKCIYFTLSAYQVRCGYPTRILGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSPADMTLRLAWNFQR---DLNKGGTVENTFDKHSINLEPGNPVRADLASLLVGNRTEPVRVPHMFPNYIRAPNGAEAKPVSQLYEGDE------EGYQNVTLSLMRDGSLNGSGAQEWWDISVA---DC-DQSSGACGVLPMIIFNDKVSPPSLG-FLAGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTREK 2479          

HSP 2 Score: 149.828 bits (377), Expect = 1.921e-35
Identity = 115/356 (32.30%), Postives = 188/356 (52.81%), Query Frame = 2
Query:  485 EAIQNLALFTKSSSSQNTNAAVSQKK--NRFTEHIHNTETTATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGD-EIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKE---KIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            +  + + L +  S  Q +N   +++   N   +H     T+A          +  V   +++ SYI + IAMM WS+TY SWLTFVLL+ AC++W+L   R   ++ SPFI+ YG+ L  + YV  ++ + E+   +      Y  + + G+     P + L   + + + FWL LR  +K+   + +   +   +         D+S  K L   +  L AKYWI+ C    ++VS   ++    +VYM+  ++ M  +   YS WRR +  +WWLV+ Y++ VL  IYT+QF+ F + W N+T FT+E L D G E F +S L   ++ P   L+  I+Q+HYFH PFMK++DL
Sbjct:  324 DDTKQMLLASGESPGQESNPTNTKEHVTNGSGQHDLGLSTSAVQQEEEEDSALLLVGRMIMQQSYICALIAMMVWSITYHSWLTFVLLLWACLIWMLRARRHFAMLCSPFILLYGLGLCCLQYVWAMHLEPELPQHVG-----YMSLRQMGLDRATYPCLRLGAMLLFTLTFWLLLRQSVKDIFWRKKKQTAPLQEVTTGENTGRDDSILKLLGRVVMSLYAKYWIYVCGGMFIMVSFAGKLVGYKIVYMLLFLLCMCLYQVYYSLWRRLLKPFWWLVVAYTMLVLIAIYTYQFEDFPDYWRNFTGFTEEQLSDIGLETFKLSELFTSIMIPGFFLLACILQLHYFHKPFMKITDL 674          

HSP 3 Score: 117.857 bits (294), Expect = 9.727e-26
Identity = 60/151 (39.74%), Postives = 103/151 (68.21%), Query Frame = 3
Query: 4023 VDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNA-LEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            ++E   ++ F  S +R+  L+ A+ N++  +S++ CY I+V+N+ ++ +++SL+ P+ +FLWAML+ PRPS  +W+  I+YT++++++KY+FQF F    S+    L ++ PFF P  LG+ KT++Y   DLLQL  LF HR  L+ +GLW
Sbjct: 1590 IEELVHSRDFYSSQNRMLKLLFALYNVLACHSELACYFIIVLNNAVTASVISLVLPILIFLWAMLAVPRPSKSFWMTAIVYTEVMVVVKYLFQFGFFPWNSEYETRLNENKPFFPPRILGLEKTDNYIRYDLLQLLALFFHRSLLQRYGLW 1740          

HSP 4 Score: 110.923 bits (276), Expect = 1.449e-23
Identity = 90/335 (26.87%), Postives = 152/335 (45.37%), Query Frame = 3
Query: 2361 GDVIQYMCVNLQYYVFKIEN-NIYKYKGGENR--PIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCI------PTREN--HISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNY--GRPLPNE----------------------------------HYLVLRSGDYFLFEEHQEEDE 3224
             D +  MC + Q+ VF+ E    +   GGEN   P   + LP     +FI N  SY+D +K ++F + +W  L +VF  G  R ++F LGY++ +  +   G + ++ R    L  W+ ++ YN  +I+ K  L +++CV++   +    CW+I +  + C       P   N    S+ +E +         WD +CF FL++QR++F +  F +V  D++ + +  SRG  L    ++  +   K+ E +   ++K  + RI    Q Y  GR  P+E                                  H  VL SGDY+LFE    E+E
Sbjct: 1042 ADFLLLMCASQQWKVFENEKKEEWMVLGGENNDNPDPMDRLPFNPAPNFI-NCRSYLDMMKVLVFRYMFWFVLAVVFVTGSTRISVFGLGYLLASFFFLLFGTRLLIKRSCTRLLMWDCLIIYNVTVIISKNILSILACVFVAD-MQARFCWVIQLFSLVCTVKDYYDPASLNDKECSLPVEEA------GIIWDSICFFFLLLQRRVFLSFYFLHVTADLQASARQASRGFELFRASIIKNMRFHKQAEKKSIQQLKNSMQRIRDKQQKYKEGRK-PSEREEQPTESQEELERKQRKERKTSKHKEWHRPWIDHATVLHSGDYYLFESDSGEEE 1367          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:ZFIN;Acc:ZDB-GENE-041111-255])

HSP 1 Score: 72.0182 bits (175), Expect = 2.867e-12
Identity = 35/129 (27.13%), Postives = 69/129 (53.49%), Query Frame = 3
Query: 5283 YLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNL 5666
            Y +GGL++ F     W PL+  S++ S+  V N P    +T++  G+  ++  + +   +Q  ++ +YN++ + + +N VA+ F+  +  +D+    I   S S+W I+PP++   +K LL     M L
Sbjct:   44 YGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPVDVTVTVKLGGYEPLFTMSVQQQSIQPFTEADYNHLTELFGSNAVAMQFITLYSYEDIVTANIEGSSGSVWRISPPSRQEVIKELLGSPADMTL 172          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009619.1 (pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gene:ENSPMAG00000008693.1 transcript:ENSPMAT00000009619.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 6.584e-21
Identity = 59/131 (45.04%), Postives = 83/131 (63.36%), Query Frame = 3
Query: 5937 STSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQ 6329
            S ++WW L   +  DC  R     D  +  +FS+R+S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDR+LKL  +I+LVRE    +LEE L AKLIF+YRS ETMI++TR K+
Sbjct:   71 SHAEWWSLRQLRS-DCPGRRC---DDIRIIVFSDRVSPPSLG-FLAGYGILGLYASVVLVVGKFVREFFSGISHSIMFEELPNVDRVLKLCTDIFLVRETGELQLEEDLYAKLIFLYRSPETMIKWTREKE 196          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO30292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T173])

HSP 1 Score: 235.343 bits (599), Expect = 5.031e-66
Identity = 121/323 (37.46%), Postives = 193/323 (59.75%), Query Frame = 3
Query: 4749 LKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKN-----------------NVVALSFMKSFEPD-----DVTIMYISNVSESIWSITPPNKDLFMKSLLDKK 5651
            ++++ +P  F+ ML++QF  IIIDR L+LRK+V  KL F +F  +  HV++F + P++++  +   +   F+Y F C+YF LS+YQ++SGYP RILGNFLTK Y   +  LF+G+  +PFL ELR+V+DW+ TDT L+LYHW+++ED++A I+VLKC+R SE  +   RG   W ++K+ VGGLL+    +  W PL+  S I S++  NPP     TL   G+  ++  +++   L+ +++ + + IK  +                   N V    + +F  D      V ++ I+  S SIW I+PP++ L M  LL +K
Sbjct:  161 VEENVVPKTFLYMLLSQFFLIIIDRCLYLRKYVFAKLFFLLFLTVSFHVFMFIVVPYVTKRPFFKNIPAIFMYIFMCMYFGLSAYQVRSGYPTRILGNFLTKSYTLTSGVLFQGFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIKTQHPGLHQGADTQPPLQVAIIFNCVLKIQIDTFLADYHDRGTVVLVKITGNSSSIWQISPPSRQLMMHDLLGEK 483          

HSP 2 Score: 73.559 bits (179), Expect = 5.979e-13
Identity = 34/74 (45.95%), Postives = 58/74 (78.38%), Query Frame = 3
Query: 6111 FVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQS 6332
            ++  + +R  +++ISY I  +E+P VD++LKL  +I++VRE+K F+LEE L AKL+F+YRS ET+I++T+ K++
Sbjct:  505 WLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKYKRA 578          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM3])

HSP 1 Score: 134.035 bits (336), Expect = 8.060e-32
Identity = 123/424 (29.01%), Postives = 201/424 (47.41%), Query Frame = 3
Query: 3651 WKYYTFFLTCLDKLIIKINLLTKDIRYVRNILENE---KRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLNAFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVD-ETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYV--FQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWK---GFKDKFNIKEPEKKTNF------------NTLQTSSLTSRF----------ILLKPFITVKKFYMNLASYRY-SKRVDVYVYMFICEFISFFIIVIGYEAF-GPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDR 4823
            W YY +F   +DK+I  ++ ++KD R + + L++E   KRL K R          G Y  S      + +TL  +                       E  D  +  +K +         ++ +V+ +D + + A  ++ S  R+    VA    ++ ++D++CY+++++NHM+   +LS+  P  VF+W MLS PRP+  YWI +I YTQ+VI+IKY+  FQFKFI+  +  +  +K+ P      +GI +  H +  DLL L  L+ HR  LK HGLW+      D   + EP    N             N   +S  + ++          +  K   +VK F   +      S  VDVY  MF C+FI F II+  + AF  P     +  +  ++++ +P  F+ ML++QF  IIIDR
Sbjct:  118 WIYY-YFAIAIDKVIDVLSDISKDYREIADQLKHERKEKRLEKLR---------RGRYSYSSL----RARTLAAS-------------------ASAAEVSDSDVIENKGSATSRSDEDADSWSVLNIDLDDTDASNWKHSHMRVARFSVAFVYALLAHTDIICYLLMILNHMVYACLLSMPLPFLVFMWGMLSIPRPTKRYWITVITYTQIVIVIKYLFKFQFKFINNCNSSDGPDKNDPLCPARIIGIERDSHTSAYDLLLLLALYFHRYSLKVHGLWRDKAAHDDHDELYEPPLSPNSPKSEPTPFAGSRNMAASSPDSEQYQSDVEDSGESLWNKICRSVKAFLNRIYDPEVGSGAVDVYAIMFACQFIIFIIILFSWSAFSSPEPQRQAQFVKIVEENVVPKTFLYMLLSQFFLIIIDR 508          

HSP 2 Score: 120.553 bits (301), Expect = 1.786e-27
Identity = 53/141 (37.59%), Postives = 88/141 (62.41%), Query Frame = 3
Query: 5073 LFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIK 5495
            L +   +  +PFL ELR+V+DW+ TDT L+LYHW+++ED++A I+VLKC+R SE  +   RG   W ++K+ VGGLL+    +  W PL+  S I S++  NPP     TL   G+  ++  +++   L+ +++ + + IK
Sbjct:  503 LIIIDRFQAIPFLLELRSVLDWVCTDTTLTLYHWLKMEDIYANIYVLKCYRESEKTWFQGRGQKYWMLSKWTVGGLLVALLVIVIWFPLLFMSYINSVYTSNPPQDATFTLSIGGYQPLFRVSAQEQFLERLNNTKIDRIK 643          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM6])

HSP 1 Score: 97.0561 bits (240), Expect = 5.298e-23
Identity = 50/139 (35.97%), Postives = 76/139 (54.68%), Query Frame = 2
Query: 1130 AKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR 1546
            AKYWI  C    LLV +Q +V +  + YM   + ++  +  S + WR  +   WW++++YS+ +L  IYT+QF      W N T  + + L + G      +SLL  LL+P    I+ +IQ+H+FH PFM M DL   R
Sbjct:    8 AKYWILLCCGAFLLVGLQNEVSVYQIGYMAIFLFILICYQISITTWRLILRPLWWVMVIYSICILLIIYTYQFDNMPLYWHNATGLSDQWLYNLGLRQHTKASLLMELLTPTAFSIIIVIQLHFFHQPFMAMIDLRNAR 146          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47371 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM5])

HSP 1 Score: 84.3445 bits (207), Expect = 6.697e-17
Identity = 69/244 (28.28%), Postives = 118/244 (48.36%), Query Frame = 3
Query: 2301 LEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGE-NRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINY-SKCWLIHILGIHCIPTRENHISISIENSCGHINND---FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSR 3017
            L  WL+L     P +   L+GD  Q +    Q  V+ +E   +  +  E +R        K    DF+ N  +++D+ K  +F   YW+TL +V+       ++F  G+++    + W GQ   L  RK LL  W + + YN++ +L K  LQ+V+CV+ D++  Y S C  + +L + C+  R +  S   +     +  D      D  CF FL+ Q +IFT++ F +VV D +  ++   R
Sbjct:  126 LSHWLYLTDVSFPSDPKLLLGDFFQLLFACCQENVYGLERYSWTAEETEQSRQTRRGSRVKFSTPDFMWNI-TWLDFCKVTLFQHMYWVTLAVVYITVQSTVSIFNFGFILWCFFFLWHGQALYLQPRKKLLRLWKLFICYNYLTLLAKVCLQVVACVWQDYVTQYTSNCLPLQLLSMFCL--RNSTYSGKPQTGMDCVAPDDTGLAMDCACFTFLLTQYRIFTSEYFRHVVRDHREQSEMAYR 366          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Match: EDO47369 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMM2])

HSP 1 Score: 73.1738 bits (178), Expect = 1.232e-15
Identity = 34/74 (45.95%), Postives = 58/74 (78.38%), Query Frame = 3
Query: 6111 FVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQS 6332
            ++  + +R  +++ISY I  +E+P VD++LKL  +I++VRE+K F+LEE L AKL+F+YRS ET+I++T+ K++
Sbjct:   10 WLVGKFVRLFFTSISYRIMFDEMPNVDKVLKLCLDIFMVRESKSFKLEEDLFAKLMFLYRSPETLIKWTKYKRA 83          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: piezo1 (piezo type mechanosensitive ion channel component 1 [Source:NCBI gene;Acc:101175341])

HSP 1 Score: 410.223 bits (1053), Expect = 3.209e-115
Identity = 291/808 (36.01%), Postives = 453/808 (56.06%), Query Frame = 3
Query: 4044 QQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVN-ALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGL-WKGFKD-----------------------KFNIKEPEKKTNFNTLQT-----SSLTSRFILLKPFITVK--------KFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTE----RTEIASLFTIPKKYAVLVKG-LPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERS-----TSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTR 6320
            ++F +S +RL  L++A+ +L+  +S++LCY+I+V+N+++S +++S++ P+ VFLWAML+ PRPS  +W+  I+YT++++++KY+FQF F    S     + KD PFF P  LG+ KT++Y   DLLQL  LF HR  L    L  K F+                            KE E++      +      + LT     LK + ++K         F+ NL   ++    DVY  MF+ + + F II+ G+ AFG  + +   A   L + ++P  F++ML+  F  +IIDRAL+LRK V+GKL+FQ   V+ IHVW+FF+ P ++  K+N     Q  YF KC+YF LS+YQI+ GYP RILGNFLTK + +LNLFLF+G+ LVPFL ELR VMDW+WTDT LSL +WM VED++A IF++KC R +E +YP P+G  +  + KY +GGL++ F     W PL+  S++ S+  V N P    +T++  G+  ++  + +   +Q  ++ +Y  +   +K+N  A+ F+  +  +D+    I   S S+W I+PP++   +K LL  ++ + L      +R   D     TV       ++ L      R E+ASL    +   VLV    P ++ A        +    +   +      + L  +RS     T +WW +       C+   P S    +  IF++++S    G L + YGI+G+Y + + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE+L +KLIF+YRS ETMI++TR
Sbjct: 1471 REFFESQNRLLKLLLALYSLLSAHSELLCYLIIVLNNVVSASVISVVLPILVFLWAMLALPRPSKRFWMTAIVYTEVMVVLKYIFQFGFFSWNSAHEMTVNKDRPFFPPRILGLEKTDNYLRYDLLQLLALFFHRALLMVCTLNLKSFRPDQEALLAKAAALRKKEALVPEEIHLRAKEEEEEMRLRAKKEQLELETDLTVASARLKVYESLKDVQSSPAQNFFKNLMHNKHQASTDVYALMFLTDMVDFVIIIFGFWAFGKHSAAADIA-STLSEDQVPEAFLVMLLIHFSTMIIDRALYLRKAVLGKLIFQGILVLGIHVWMFFILPSVTERKFNQNFVAQLWYFVKCIYFGLSAYQIRCGYPTRILGNFLTKNFGHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKYPQPKGQKKKKIVKYGMGGLIVFFLICIIWFPLLFISLVRSVVGVVNHPIDVTVTVKLGGYEPLFTMSVQQQSIQPFNNSQYEELTKMFKDN-TAMQFITLYSYEDIVTAQIEGSSGSVWRISPPSRQEVIKELLGSQVDLTLRLAWNFQR---DLGKGGTVEHTFDKYSIDLEPGNLVRAELASLLIGNRTEPVLVPNFFPNYIRAPNGAEAKPVSQLYKGGEDGYLGITLSLKSDRSSNSSGTREWWDIAVE---GCV---PPSCGVLRMVIFNDKVSPPSLGFL-AGYGIMGLYVSVVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCTDIFLVRETGELELEEELYSKLIFLYRSPETMIKWTR 2266          

HSP 2 Score: 171.785 bits (434), Expect = 4.792e-42
Identity = 123/403 (30.52%), Postives = 202/403 (50.12%), Query Frame = 2
Query:  656 LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNIN-GDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHH-EMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELNYLVYDANGAIY----ILTRXXXXXXXXXXXXXWRILEIHFTKIIV 1846
            +++ SY+ + IAMM WS+TY SWLTFVLL+ AC++W+L   R A  + SPFI+ YG++L  + Y+  +    E+  ++         + + G+ + + P + L   + +++ FWL LR  + E  R   SSQ      +   ++ S  K +   +    AKYWI+ C    ++VS   ++    +VYM+  ++ + F+   YS WR  + ++WWLV+ Y++ VL  IYT+QF+ F   W N T FT E L   G E FD+S L   +L P   L+  I+Q+HYFH PFM+++DL     +  R N +        E+      S+T  + +                  E    K    L+    G +     +L+RK   I   +   +WR+LE+H  K++ 
Sbjct:  384 VMQQSYVSALIAMMVWSITYHSWLTFVLLLWACLIWILRARRHAATLCSPFILLYGLVLCCLQYIWAMELHPELPTSVGTM-----SLRQLGLDKAQYPCLRLGAMLLFVLTFWLLLRQAVMENFRRKSSSQTPLQEVATKGQNQSMLKVVGGMVMSCYAKYWIYVCGGMFIMVSFAGKLVAYKIVYMLLFLLCLCFYQVYYSLWRHLLKLFWWLVVAYTMLVLITIYTYQFEDFPVYWKNLTGFTDEQLAAIGLETFDLSELFTSILIPGFFLLACILQLHYFHKPFMRITDLENVTPTHKRRNSDAVGSADAVELNTEEDPSNTEESAD------------------EGRTQKTTKELMPSKWGLVMDRLLVLSRKFSEILSKVQVFLWRLLELHILKMVA 763          

HSP 3 Score: 109.768 bits (273), Expect = 2.878e-23
Identity = 85/309 (27.51%), Postives = 153/309 (49.51%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIE-NNIYKYKGGEN----RPI---VFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPT----RENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLF 3200
            WL+LP +   P +  L+ D +  MC + Q+ VF  E    +    GEN     P+   +FN  P     +FI N  SY+D LK ++F +F+W  L +VF  G  R ++F LGY++    +   G + ++ R +  L  W+ ++ YN  +I+ K  L +++CV++   +    CW+I +  + C       R++  ++ IE +         WD  CFI L++QR++F +  F +V  +++ + K  SRG  L    +M  +   K+ E++  +++K              + L +    V+ SG+Y+LF
Sbjct: 1028 WLYLPDFFTVPNSGNLMADFVLLMCASQQWKVFDCERTEEWMVLAGENSDEPEPMEGRLFNPAP-----NFI-NCRSYLDMLKVLVFRYFFWFVLSVVFITGASRISVFGLGYLLGCFFFLLFGTKLMVKRSRTRLILWDCLIIYNVAVIISKSVLSILACVFVFK-MQERFCWVIQLFSLVCTVKGYYDRDDTCTLPIEEA------GILWDGFCFICLLLQRRVFLSFYFLHVSAELQASAKQASRGFELFRASMMKNMDFHKQAEDKSLSQLKRS------------QTLMSCCAAVIHSGEYYLF 1311          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 372.474 bits (955), Expect = 2.275e-103
Identity = 225/600 (37.50%), Postives = 345/600 (57.50%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYM-------IMLSIERSTSD------WWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG    ST+     L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P I+  ++N     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT+LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++   L       +N  K        A+ +++++ P+D+ I  +   S S+W+I+PP++D             NL  M+  +   S        V ++  +NLSL    E A      K   VL +   + L+         L+ G+ ++ N    ++       I L+++R+ +D      WW ++  ++              + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE + +KLIF+YRS ETMI++TR K
Sbjct: 2047 LEIYLPMKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFG--KHSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQL-------WNVTK-------TAIQWLENYTPEDLIIAELKGSSNSLWTISPPSRD-------------NLIDMLRSQEEFS------ITVSWSIQRNLSLGAEAESA----YGKNVMVLNQETKQNLI--------LLLNGAADAANTQVIFLTGNKMIDIHLTMQRAQNDSGQAQEWWIVNQTEQSIIPKIGRKHEAGLEIYVFSDQVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTREK 2598          

HSP 2 Score: 139.043 bits (349), Expect = 4.281e-32
Identity = 143/542 (26.38%), Postives = 239/542 (44.10%), Query Frame = 2
Query:  137 FVYYYWHLIMTKMFLIGMVIILLVVSITFTLCHPIVHILIIFYPNFLKNCSSPYVLYMYQIGITKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQ-----------NTNAAVSQKKNRFTEHIHNTET----------TATGMPA-----------------------ISLPFIWSVITS----------------------LVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIR--------LSVSSQIDRARSSVIFEDN--STFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            F+  +W L  T   LI   + +L+    ++  H IV  L  F   F +   SP   Y+   GI+ ++    + + SC    SV    ++++ F++P  L  L+Y  +   ++WL +E I +L + +  + ++           NT A +++  N  ++   N  T          T  G P                        +SLP   S                          ++K SYI + IAMMAWS+TY SWLTFV L+ +CILW++ D R   ++ SPF+V YG ++I + Y  +    E    +  FF            E K PF  L   +  ++ FWL LR  + E+          LS     D+ +    +E +    F S+V     +  KYWI+ C      VS +  + +  ++YMM  +  +  +   + +WRR +  +W  V++Y++ VL  +YTFQF   ++ W        E+L D G E F +S+L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  275 FLCTWWSLCRTFNTLIFSCMCVLMA--IYSAGHIIVLYLYQF--QFFQESVSPQDEYIRVFGISPIV----QSNCSCTWKLSVHS-DRKWYHFVSPIMLLVLYYTLATLIRLWL-QEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFITETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPEKKEECVYEVSLPPEDSAAKETEDEENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWSF---ERAKPVAGFF-----------VEKKNPFHSLSSKMLCMLSFWLLLRQTLTERQEKQKEESAGLSDVHVEDQKKKGKPYEQDIMHVFGSMVM---AVLVKYWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDL 789          

HSP 3 Score: 129.798 bits (325), Expect = 2.370e-29
Identity = 105/341 (30.79%), Postives = 172/341 (50.44%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIY-KYKGGENRPI----------VFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALL----INKKLMGILTEEKEKENQL-------------FTKVKEKILRIEQTHQNYGRPL-------------PNEHYLVLRSGDYFLFE 3203
            WL++P +   P+   LI D +  +C ++Q  VF+ EN    +   G+N  I          V N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L +++C YID ++  + CWLI +  + C  T + ++ I + ++C    N+    WD +CF FL++QR++F +  F +VV D++ +    SRGA L    I K +   L EE +   QL             F + K+KIL + Q     G+P+             P   + V+RSGDY+LFE
Sbjct: 1154 WLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEICRDLDAASFSVHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLME-NNCWLIQLFSLSC--TIKGYV-IKL-DTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASQVLASRGAELFQATIVKAVKARLEEEHKSVEQLKRQMERIKVRQQKFKRGKDKILSLAQESAE-GQPVVQPEEDDDDGMVNPTPTHSVVRSGDYYLFE 1482          

HSP 4 Score: 113.62 bits (283), Expect = 2.233e-24
Identity = 60/149 (40.27%), Postives = 97/149 (65.10%), Query Frame = 3
Query: 4026 DETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            +E  Q+  F ++   +     A+ N+++ +S+ +CY+++++NHM+S + +SL+ P+++FLWAMLS PRPS  YW+  I+YT++ I+IKY  QF F    S    L K++P++    +G+ K + Y L DL+QL  LF HR  LK HGLW
Sbjct: 1772 EELEQSDHFYQNQPLILQFSYALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGFFP-HSKNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLW 1919          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: ENSORLT00000004626.2 (pep primary_assembly:ASM223467v1:7:7477416:7483305:1 gene:ENSORLG00000003710.2 transcript:ENSORLT00000004626.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.732 bits (870), Expect = 1.360e-101
Identity = 203/588 (34.52%), Postives = 317/588 (53.91%), Query Frame = 3
Query: 4578 FITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLS--IERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQS 6332
            ++ +++F+ ++    YS   DVY  MF+ + ++F + + GY AFG  + + +   + L + ++P  F++ML+ QF  +I+DRAL+L+K ++GK VFQ+  V  IH W+FF+ P ++  ++N     Q  YF KC+YF LS+YQIK GYP RILGNFLTK YNYLNLFLF+G+ +VPFL ELR VMDW+WTDT LSL  W+ VED++A IFVLKCWR SE +YP P G  +  V KY +GG ++       W PL+  S++ S   V N P    + L   G+  ++           MS  E N +   +     A+ F+ ++E +D+ +  I + +  +WSI+P ++   ++ L    I+ +LN+                          S++   E     T+      L  G+   L    +   D   L +     P+   +   S   ++    WW +        L+ +       +  +F++++S +  G   + +GI+G+Y + + V  + +R  ++ IS  I  EELP VDR+LKL  +I++VRE     LEE L  KLIF+YRS ETMI+ TR K S
Sbjct:   23 YLPIRQFFYDIIHPEYSPVCDVYALMFLIDVVNFIVTIYGYWAFGKYS-AVADITESLSEDQVPEAFLVMLLMQFGTMIVDRALYLKKSLLGKCVFQVVLVFGIHFWMFFILPGVTERRFNRNPIAQLWYFVKCIYFGLSAYQIKCGYPNRILGNFLTKNYNYLNLFLFQGFRMVPFLTELRAVMDWVWTDTTLSLSSWICVEDIYANIFVLKCWRESEKKYPHPPGQKKKKVVKYGMGGFIIFALISIIWFPLLFMSLVQSAAGVTNQPVEVSIQLSIAGYEPLF----------TMSAQEQNLVASLFLLQ-SAMQFLMNYEAEDIIVAKIKSDASLLWSISPASRAAMIEEL---SISSHLNA--------------------------SISMNVEAVGEHTVKFNDKALKDGIVSMLKGNSSKPSDRPDLQALAFFRPMSIKLQQASGASDKEADQWWVVEECS--PVLTSSEPKCHSIEIVVFNDKVSPSSLG-FLAGHGIVGLYMSVVLVIGKFVREFFNGISRSIMFEELPCVDRVLKLCTDIFVVRETGEMELEETLFEKLIFLYRSPETMIKMTREKDS 566          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 358.992 bits (920), Expect = 3.588e-99
Identity = 226/611 (36.99%), Postives = 352/611 (57.61%), Query Frame = 3
Query: 4569 LKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIF-VRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSIT-PPNKDL--FMKSLLDKKITM--------NLNS--MIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPK----KYAVLVKGLPRFLVA-TKTDFQDALVLGSENSLNPLESYMIMLSIERSTSD------WWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLK 6326
            L+ ++ +K+F+ NL    YS   DVYV MF+ + + F IIV G+ AFG    ST+     L + ++P PF++M++ QF  +++DRAL+LRK V+GK++FQ+  V  IH W+FF+ P I+  ++N     Q  YF KC+YF LS+YQI+ GYP R+LGNFLTK YNY+NLFLF+G+ LVPFL ELR VMDW+WTDT+LSL  W+ VED++A IF+LKCWR SE  YP PRG  +  V KY +GG++++      W PL+  S++ S+  V N P    +T+   GF  I+  +++   L       +N  K        A+ +++++ P+D+ I  +   S S+W+I+ P   +L   ++S  +  IT+        N++S  M+     P   +         +V  L++ +   +   F   K    +   L K +PR++ A +K+D      LG++          I L+++R+ +D      WW ++  ++              + ++FS+++S    G   + YGI+G+YA+ + V  + +R  +S IS+ I  EELP VDRILKL  +I+LVRE     LEE + +KLIF+YRS ETMI++TR K
Sbjct: 2161 LEIYLPMKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFG--KHSTADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVLLVFGIHFWMFFILPIITEKRFNENTVAQMWYFVKCIYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRLVPFLTELRAVMDWVWTDTSLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVVKYGMGGMIVVLLICIVWFPLLFMSLVKSVAGVVNAPLDVSVTITLAGFQPIFTMSAQQKQL-------WNVTK-------TAIQWLENYTPEDLIIAELKGSSNSLWTISPPSRDNLIDMLRSQEEFSITVSWSIQRYPNIDSPLMMFDHIIPHTLQLCLKKKKLFYVILLNIFQFLFVIFYFIFFKQNLFRKKTLTKLIPRYIRAPSKSDATSVEQLGNK-------MIDIHLTMQRAQNDSGQAQEWWIVNQTEQSIIPKIGRKHEAGLEIYVFSDQVSPPSLG-FLAGYGIMGLYASVVLVIGKFVREFFSGISHKIMFEELPNVDRILKLCTDIFLVRETGELDLEEDMYSKLIFLYRSPETMIKWTREK 2747          

HSP 2 Score: 136.732 bits (343), Expect = 2.264e-31
Identity = 143/539 (26.53%), Postives = 238/539 (44.16%), Query Frame = 2
Query:  137 FVYYYWHLIMTKMFLIGMVIILLVVSITFTLCHPIVHILIIFYPNFLKNCSSPYVLYMYQIGITKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQ-----------NTNAAVSQKKNRFTEHIHNTET----------TATGMPAI---SLP--------------------------------FIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNS-----------------TFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            F+  +W L  T   LI   + +L+    ++  H IV  L  F   F +   SP   Y+   GI+ ++    + + SC    SV    ++++ F++P  L  L+Y  +   ++WL +E I +L + +  + ++           NT A +++  N  ++   N  T          T  G P +   S P                                 +  V   ++K SYI + IAMMAWS+TY SWLTFV L+ +CILW++ D R   ++ SPF+V YG ++I + Y  +             FE    ++ F + E K PF  L   +  ++ FWL LR  + E  R     +     S V  ED                    F S+V     +  KYWI+ C      VS +  + +  ++YMM  +  +  +   + +WRR +  +W  V++Y++ VL  +YTFQF   ++ W        E+L D G E F +S+L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  220 FLCTWWSLCRTFNTLIFSCMCVLMA--IYSAGHIIVLYLYQF--QFFQESVSPQDEYIRVFGISPIV----QSNCSCTWKLSVHS-DRKWYHFVSPIMLLVLYYTLATLIRLWL-QEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFITETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPGDSTEDSAAKETEDEENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWS-------------FERAKPVAGFFV-EKKNPFHSLSSKMLCMLSFWLLLRQTLTE--RQEKQKEESAGLSDVHVEDQKKKEEEESKEEEEQDIMHVFGSMVM---AVLVKYWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDL 729          

HSP 3 Score: 128.642 bits (322), Expect = 5.675e-29
Identity = 105/354 (29.66%), Postives = 171/354 (48.31%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPI----------VFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALL----INKKLMGILTEEKEKENQL-------------FTKVKEKILRIEQTHQNYGRPL--PNE------------------------HYLVLRSGDYFLFE 3203
            WL++P +   P+   LI D +  +C ++Q  VF+ EN    +   G+N  I          V N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L +++C YID ++  + CWLI +  + C   +   I ++  ++C    N+    WD +CF FL++QR++F +  F +VV D++ +    SRGA L    I K +   L EE +   QL             F + K+KIL + Q     G+P+  P E                        H  ++RSGDY+LFE
Sbjct: 1100 WLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEICRDLDAASFSVHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLME-NNCWLIQLFSLSCT-IKGYVIKLASSDTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASQVLASRGAELFQATIVKAVKARLEEEHKSVEQLKRQMERIKVRQQKFKRGKDKILSLAQESAE-GQPVVQPEEDDDDGAQRTKAKPKKKQWWRPWVDHASMVRSGDYYLFE 1444          

HSP 4 Score: 115.161 bits (287), Expect = 7.273e-25
Identity = 61/155 (39.35%), Postives = 100/155 (64.52%), Query Frame = 3
Query: 4008 NNVIFVDETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLW 4472
            N + + +E  Q+  F ++   +     A+ N+++ +S+ +CY+++++NHM+S + +SL+ P+++FLWAMLS PRPS  YW+  I+YT++ I+IKY  QF F    S    L K++P++    +G+ K + Y L DL+QL  LF HR  LK HGLW
Sbjct: 1877 NKMFYDEELEQSDHFYQNQPLILQFSYALYNMLVAHSEFVCYLVIIINHMVSASCVSLVLPVTIFLWAMLSVPRPSKRYWMTAIVYTEVTIVIKYFCQFGFFP-HSKNYRLYKNAPYYPANIIGVEKKDGYVLYDLVQLLALFFHRSILKCHGLW 2030          
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Match: PIEZO2 (piezo type mechanosensitive ion channel component 2 [Source:NCBI gene;Acc:101174622])

HSP 1 Score: 138.658 bits (348), Expect = 3.963e-32
Identity = 130/502 (25.90%), Postives = 223/502 (44.42%), Query Frame = 2
Query:  248 ILIIFYPNFLKNCSSPYVLYMYQIGITKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQ-----------NTNAAVSQKKNRFTEHIHNTET----------TATGMPAIS-----------------------------------LPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDN-----------------STFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDL 1534
            +L ++   F +   SP   Y+   GI+ ++    + + SC    SV    ++++ F++P  L  L+Y  +   ++WL +E I +L + +  + ++           NT A +++  N  ++   N  T          T  G P ++                                   +  +  V   ++K SYI + IAMMAWS+TY SWLTFV L+ +CILW++ D R   ++ SPF+V YG ++I + Y  +             FE    ++ F + E K PF  L   +  ++ FWL LR  + E  R     +     S V  ED                    F S+V     +  KYWI+ C      VS +  + +  ++YMM  +  +  +   + +WRR +  +W  V++Y++ VL  +YTFQF   ++ W        E+L D G E F +S+L   +  P   L+V I+ +HYFH+ F++++DL
Sbjct:  253 VLYLYQFQFFQESVSPQDEYIRVFGISPIV----QSNCSCTWKLSVHS-DRKWYHFVSPIMLLVLYYTLATLIRLWL-QEPIDHLMVSSADTPAEHQLNVPFLLFGNTCAFITETLNVISDDRQNGPTSNGTSLDFMATENGPPCLNFYSTPQYKMDQPGDSTEDSAAKETEDEENDIKKKGVGAMVKVFHFVMKQSYICALIAMMAWSITYVSWLTFVFLMWSCILWMVRDRRRYAMMSSPFMVAYGNLIIVLQYFWS-------------FERAKPVAGFFV-EKKNPFHSLSSKMLCMLSFWLLLRQTLTE--RQEKQKEESAGLSDVHVEDQKKKEEEESKEEEEQDIMHVFGSMVM---AVLVKYWIYICGGMFFFVSFEGNIVMYKIIYMMMFLSCVALYQVHFEYWRRILKYFWMSVVIYTMLVLTVVYTFQFDGSKDFWSGMLNVKNESLNDLGLEQFSVSTLFTRIFIPTSFLLVCILHLHYFHDHFLQLTDL 729          

HSP 2 Score: 107.457 bits (267), Expect = 1.220e-22
Identity = 76/248 (30.65%), Postives = 132/248 (53.23%), Query Frame = 3
Query: 2310 WLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNI-YKYKGGENRPI----------VFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINND--FYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTS 3014
            WL++P +   P+   LI D +  +C ++Q  VF+ EN    +   G+N  I          V N +P     DFI  + SY+D LK I+F + +W  L I+F  G  R ++FC+GY++    +   G + +L   K +L  W+ ++ YN  +I +K  L +++C YID ++  + CWLI +  + C   +   I ++  ++C    N+    WD +CF FL++QR++F +  F +VV D++ +  F S
Sbjct: 1089 WLYIPDFYKKPDPLFLIYDFMLLLCASMQRQVFEDENKAAVRLIAGDNVEICRDLDAASFSVHNPVP-----DFIHCR-SYLDMLKVIMFSYLFWFVLTIIFITGTTRISIFCMGYLVACFYFLLFGGELLLKPIKKILHYWDFLIAYNIFVITMKNILSILACGYIDSLME-NNCWLIQLFSLSC-TIKGYVIKLASSDTCDIPKNEAGIIWDSICFAFLLLQRRVFMSYYFLHVVADIRASGSFAS 1328          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000080325.1 (SMESG000080325.1)

HSP 1 Score: 1431.39 bits (3704), Expect = 0.000e+0
Identity = 741/741 (100.00%), Postives = 741/741 (100.00%), Query Frame = 3
Query: 4134 MILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            MILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK
Sbjct:    1 MILVMNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 741          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000080325.1 (SMESG000080325.1)

HSP 1 Score: 1424.07 bits (3685), Expect = 0.000e+0
Identity = 737/737 (100.00%), Postives = 737/737 (100.00%), Query Frame = 3
Query: 4146 MNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            MNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK
Sbjct:    1 MNHMISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 737          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000080325.1 (SMESG000080325.1)

HSP 1 Score: 1416.36 bits (3665), Expect = 0.000e+0
Identity = 734/734 (100.00%), Postives = 734/734 (100.00%), Query Frame = 3
Query: 4155 MISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYAXXXXXXXXXXXXHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDXXXXXXXXXXXXXXNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRXXXXXXXXXXXFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 6356
            MISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK
Sbjct:    1 MISVNMLSLLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESDVNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKGFKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYSKRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPFILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISRSKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLFLFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRRSELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRNPPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALSFMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMIECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLPRFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEFDCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRLLRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLIFVYRSDETMIRFTRLKQSILDEHMDK 734          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000080326.1 (SMESG000080326.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 501/525 (95.43%), Postives = 505/525 (96.19%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTETTATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHHEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELNYLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIVVAISKYATSHFQQFLSCY 1900
            ++LLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTET ATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVLLILACILWLLPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR             LHHEMKVISRESSTSRNQNNYLISIIAKLLSKLLHKKEDSYAKELNYLVYDANGAIYILTRKLIIIFKYIYYKIWRILEIHFTKII+VAISKYATSH   +   Y
Sbjct:   50 SRLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTETAATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVLLILACILWLLPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR-------------LHHEMKVISRESSTSRNQNNYLISIIAKLLSKLLHKKEDSYAKELNYLVYDANGAIYILTRKLIIIFKYIYYKIWRILEIHFTKIIIVAISKYATSHVSAYNGIY 561          

HSP 2 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 485/497 (97.59%), Postives = 489/497 (98.39%), Query Frame = 3
Query: 2241 PKLCIL*NGSRVYPFHFPYLLEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY 3731
            P LC      +VYPFHFPYLL+DWLFLPSYLNPPEA KLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWNIILFYNFIIILIKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTK+KEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEKSSYKVNKNKSNKIFFKKD+VVLNSEEHSSSESSISASPVNNSEDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY
Sbjct:  774 PLLC------KVYPFHFPYLLDDWLFLPSYLNPPEASKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWNIILFYNFIIILIKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKIKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEKSSYKVNKNKSNKIFFKKDYVVLNSEEHSSSESSISASPVNNSEDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY 1264          

HSP 3 Score: 275.018 bits (702), Expect = 0.000e+0
Identity = 133/140 (95.00%), Postives = 135/140 (96.43%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLECILFIFLI 2298
            SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE    + +I
Sbjct:  580 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLEICFIVTVI 719          
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Match: SMESG000080326.1 (SMESG000080326.1)

HSP 1 Score: 915.605 bits (2365), Expect = 0.000e+0
Identity = 501/525 (95.43%), Postives = 505/525 (96.19%), Query Frame = 2
Query:  326 TKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTETTATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVXXXXXXXXXXXPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKRISFSR*NLETRNKLHHEMKVISRESSTSRNQNNYXXXXXXXXXXXXXXXXEDSYAKELNYLVYDANGAIYILTRXXXXXXXXXXXXXWRILEIHFTKIIVVAISKYATSHFQQFLSCY 1900
            ++LLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTET ATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVLLILACILWLLPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR             LHHEMKVISRESSTSRNQNNYLISIIAKLLSKLLHKKEDSYAKELNYLVYDANGAIYILTRKLIIIFKYIYYKIWRILEIHFTKII+VAISKYATSH   +   Y
Sbjct:   50 SRLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLDSKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTETAATGMPAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVLLILACILWLLPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFEISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRARSSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVYMMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQELWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNPFMKMSDLTPKR-------------LHHEMKVISRESSTSRNQNNYLISIIAKLLSKLLHKKEDSYAKELNYLVYDANGAIYILTRKLIIIFKYIYYKIWRILEIHFTKIIIVAISKYATSHVSAYNGIY 561          

HSP 2 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 485/498 (97.39%), Postives = 489/498 (98.19%), Query Frame = 3
Query: 2241 PKLCIL*NGSRVYPFHFPYLLEDWLFLPSYLNPPEAYKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWXXXXXXXXXXXXXKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISIS-IENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEXXXXXXXXXXXXXXXXXXXXVVLXXXXXXXXXXXXXXXXXXXXXDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY 3731
            P LC      +VYPFHFPYLL+DWLFLPSYLNPPEA KLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWNIILFYNFIIILIKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISIS IENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTK+KEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEKSSYKVNKNKSNKIFFKKD+VVLNSEEHSSSESSISASPVNNSEDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY
Sbjct:  774 PLLC------KVYPFHFPYLLDDWLFLPSYLNPPEASKLIGDVIQYMCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDYLKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSRRKYLLSSWNIILFYNFIIILIKCNLQLVSCVYIDHIINYSKCWLIHILGIHCIPTRENHISISSIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYVVLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKIKEKILRIEQTHQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGKSDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMPIARSHTEKSSYKVNKNKSNKIFFKKDYVVLNSEEHSSSESSISASPVNNSEDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIRY 1265          

HSP 3 Score: 275.018 bits (702), Expect = 0.000e+0
Identity = 133/140 (95.00%), Postives = 135/140 (96.43%), Query Frame = 1
Query: 1879 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLECILFIFLI 2298
            SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLE    + +I
Sbjct:  580 SAIFILLSMQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYSDFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFRSIDHRLTSAVKGFLNFAFYKMGLEICFIVTVI 719          
The following BLAST results are available for this feature:
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO22.093e-11138.36piezo type mechanosensitive ion channel component ... [more]
PIEZO22.123e-11138.36piezo type mechanosensitive ion channel component ... [more]
PIEZO22.182e-11138.36piezo type mechanosensitive ion channel component ... [more]
PIEZO17.791e-9536.76piezo type mechanosensitive ion channel component ... [more]
PIEZO25.047e-6651.35piezo type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pezo-19.242e-11725.65Piezo-type mechanosensitive ion channel component ... [more]
pezo-19.242e-11725.65Piezo-type mechanosensitive ion channel component ... [more]
pezo-11.309e-11625.65Piezo-type mechanosensitive ion channel component ... [more]
pezo-13.596e-11525.65Piezo-type mechanosensitive ion channel component ... [more]
pezo-13.958e-11525.65Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo4.737e-11730.25gene:FBgn0264953 transcript:FBtr0335175[more]
Piezo4.969e-11730.25gene:FBgn0264953 transcript:FBtr0335182[more]
Piezo5.080e-11730.25gene:FBgn0264953 transcript:FBtr0347414[more]
Piezo5.421e-11731.91gene:FBgn0264953 transcript:FBtr0335176[more]
Piezo6.328e-11730.25gene:FBgn0264953 transcript:FBtr0335179[more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo2a.23.057e-11637.38piezo-type mechanosensitive ion channel component ... [more]
LO018508.11.939e-11438.37pep chromosome:GRCz11:2:54327160:54353625:1 gene:E... [more]
piezo2a.27.984e-10937.38piezo-type mechanosensitive ion channel component ... [more]
piezo12.271e-10038.10piezo-type mechanosensitive ion channel component ... [more]
si:dkey-11f4.74.507e-7944.76si:dkey-11f4.7 [Source:ZFIN;Acc:ZDB-GENE-070912-36... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO21.259e-14836.98piezo-type mechanosensitive ion channel component ... [more]
PIEZO22.397e-14837.13piezo-type mechanosensitive ion channel component ... [more]
PIEZO23.755e-14737.99piezo-type mechanosensitive ion channel component ... [more]
PIEZO21.497e-14235.42piezo-type mechanosensitive ion channel component ... [more]
chordc11.245e-12435.30cysteine and histidine rich domain containing 1 [S... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piezo24.771e-11137.65piezo-type mechanosensitive ion channel component ... [more]
Piezo24.944e-11137.65piezo-type mechanosensitive ion channel component ... [more]
Piezo27.034e-11137.65piezo-type mechanosensitive ion channel component ... [more]
Piezo23.778e-10042.50piezo-type mechanosensitive ion channel component ... [more]
Piezo21.290e-9842.86piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|M9MSG8|PIEZO_DROME6.344e-11630.25Piezo-type mechanosensitive ion channel component ... [more]
sp|Q9H5I5|PIEZ2_HUMAN1.048e-11038.36Piezo-type mechanosensitive ion channel component ... [more]
sp|Q8CD54|PIEZ2_MOUSE4.872e-11037.65Piezo-type mechanosensitive ion channel component ... [more]
sp|Q92508|PIEZ1_HUMAN3.742e-9436.76Piezo-type mechanosensitive ion channel component ... [more]
sp|Q0KL00|PIEZ1_RAT4.747e-9235.27Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YS871.711e-7142.35Piezo-type mechanosensitive ion channel component ... [more]
A0A4S2LI049.880e-7342.93Piezo-type mechanosensitive ion channel component ... [more]
A0A4S2LHI25.268e-7142.93Piezo-type mechanosensitive ion channel component ... [more]
A0A4S2LHK55.159e-7141.64Piezo-type mechanosensitive ion channel component ... [more]
G7YE702.351e-7345.79Piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIEZO22.483e-10837.65piezo type mechanosensitive ion channel component ... [more]
piezo2a.21.026e-10637.29piezo-type mechanosensitive ion channel component ... [more]
piezo2a.22.556e-10537.27piezo-type mechanosensitive ion channel component ... [more]
piezo14.037e-9837.98piezo-type mechanosensitive ion channel component ... [more]
piezo12.867e-1227.13piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009619.16.584e-2145.04pep scaffold:Pmarinus_7.0:GL484020:1370:4517:1 gen... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302925.031e-6637.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473708.060e-3229.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473725.298e-2335.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473716.697e-1728.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473691.232e-1545.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piezo13.209e-11536.01piezo type mechanosensitive ion channel component ... [more]
PIEZO22.275e-10337.50piezo type mechanosensitive ion channel component ... [more]
ENSORLT00000004626.21.360e-10134.52pep primary_assembly:ASM223467v1:7:7477416:7483305... [more]
PIEZO23.588e-9936.99piezo type mechanosensitive ion channel component ... [more]
PIEZO23.963e-3225.90piezo type mechanosensitive ion channel component ... [more]
back to top
BLAST of Piezo-type mechanosensitive ion channel component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080325.10.000e+0100.00SMESG000080325.1[more]
SMESG000080325.10.000e+0100.00SMESG000080325.1[more]
SMESG000080325.10.000e+0100.00SMESG000080325.1[more]
SMESG000080326.10.000e+095.43SMESG000080326.1[more]
SMESG000080326.10.000e+095.43SMESG000080326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006368 ID=SMED30006368|Name=Piezo-type mechanosensitive ion channel component|organism=Schmidtea mediterranea sexual|type=transcript|length=6439bp
ATAAAATTGAATGTTAATGACCAGGAGATTCTAATGAATGTTGTATATCT
CTTGATCCTGAAAATACTTTTACCTTTAAGTTTATTAACATCAGCTGTAA
TTCGCTATAATGGGTTTTCAGGATTTTATTTAGTATTTTGTCTATTATTA
TTGGCATTTGATCATGACAAAAATGTTTCTCATTGGAATGGTAATTATAC
TACTGGTTGTTAGCATAACTTTTACTTTATGTCATCCGATAGTGCACATT
TTAATTATATTCTATCCAAATTTTTTGAAAAATTGTTCTTCGCCATATGT
CCTGTACATGTATCAAATAGGAATTACAAAATTGCTTGGCCTTTACTATA
AAATTGATACATCTTGTGAACGCCATGGATCTGTTACAATCCTTCAACAA
AGATTTTTTGATTTTATGAATCCATTCGCTTTATTTGCATTATTTTATAT
TCATTCCCTGGATTCGAAAATCTGGCTAGATCGAGAAGCAATACAAAATT
TGGCATTATTTACAAAATCATCCAGTTCTCAAAATACAAATGCTGCGGTC
TCTCAAAAAAAGAACAGATTTACCGAGCATATTCATAATACTGAAACAAC
TGCCACTGGAATGCCCGCTATAAGTCTTCCTTTTATATGGAGTGTAATAA
CTTCACTAGTAAAAAATAGCTACATATTTTCATTTATTGCCATGATGGCG
TGGAGCGTTACTTACAAATCATGGCTAACTTTTGTACTTCTAATTTTAGC
TTGCATCCTCTGGTTGCTTCCGGATTCTCGGGCGGCATGCCTTGTTATGA
GTCCTTTCATTGTTGGATACGGAATAATGCTAATATTTATAAATTATGTC
ACAAATATCAATGGAGACGAAATTATGAACACAATAAAAATATTTTTTGA
ACCATATTTTGAAATCAGTGAATTTGGAATATTTGAGTGGAAAATACCGT
TCATTCCGCTTTTACTAACTATTGGATATTTAGTTGTGTTTTGGTTGACT
CTACGATTATATATGAAAGAAAAGATTAGACTATCCGTTTCTTCACAGAT
AGATCGAGCACGAAGCTCAGTTATATTTGAAGATAATTCTACGTTTAAAA
GCTTAGTTTATTTTCTCCATAAACTTTGTGCTAAATATTGGATTTTCGGA
TGCACTATTTGCCTTTTACTCGTTTCTATTCAAAAACAAGTAAAGATTAT
TTACCTCGTCTACATGATGTTTTTGGTTATTCTAATGACCTTTTTCATGT
TTAGCTATTCATTCTGGAGAAGGCAAATGTACATTTACTGGTGGCTTGTA
ATTGTGTATTCTTTAGGAGTTTTATTTGGAATATATACTTTTCAATTCAA
AATATTCCAAGAATTGTGGTTTAATTACACAATTTTTACACAAGAAAATT
TGAAAGATTTTGGATTCGAAGTATTTGACATGTCGTCTCTTTTGGAAGGA
CTTTTAAGTCCAGTTATACTCTTAATTGTAACTATCATTCAAGTCCATTA
TTTTCACAATCCATTCATGAAAATGTCAGATTTAACACCGAAAAGAATAT
CCTTCTCGCGGTAGAATTTAGAAACCAGAAATAAGCTTCACCATGAAATG
AAGGTCATCAGTAGAGAATCTTCAACCTCAAGAAACCAAAATAACTATTT
GATTTCCATAATAGCAAAGTTATTGTCGAAACTACTTCATAAGAAAGAAG
ACTCTTATGCAAAAGAATTAAATTATTTAGTATACGATGCCAATGGAGCT
ATTTATATTTTAACGAGAAAATTAATCATAATATTTAAATACATATATTA
TAAAATTTGGAGAATTCTAGAAATACATTTTACGAAAATCATCGTCGTTG
CAATTAGCAAATATGCAACATCTCATTTTCAGCAATTTTTATCTTGTTAT
CAATGCAAATGATTGCCAATATGATGTTTCAGTTAATTATTCTCGAAAAT
TTTGAATTTAAAACAAATTGCAGTTTAAAGAATAAATATTTTGCAAAGTT
TACTTTGGATCAAATGGATAATTTGGAATACATAGGCTTGCTAAAATATT
CAGATTTTCAGCCATTTGCATGGTCCATAGCCTTCAACATGATTTTATGT
TCTTTGTGGCACGTAATCAAATACCATCAAATTCGATATTATAATTTTAA
TACTTCTCACAAGCCTGAGCATAAACTAGTTTTTCCTTATTTCACATTCA
GAAGTATTGACCATCGGTTAACAAGTGCGGTTAAAGGATTCCTAAACTTT
GCATTTTATAAAATGGGTCTAGAGTGTATCCTTTTCATTTTCCTTATTTA
TTGGAAGATTGGTTATTTCTTCCAAGCTATTTAAATCCTCCAGAAGCATA
CAAATTGATAGGAGATGTTATTCAATATATGTGCGTAAATCTCCAATATT
ATGTATTTAAGATAGAAAACAATATTTATAAATATAAAGGGGGAGAAAAC
AGACCCATCGTTTTTAACGAATTGCCAAAAACAGAAGATAAAGACTTTAT
TAGCAATAAAAATTCATACATGGATTATTTAAAGCAAATCATTTTTTGTT
GGTTCTATTGGCTTACTCTAGGCATTGTTTTCTTCAATGGAATAATGAGG
AATACTTTATTTTGTCTGGGGTATATGATCCTTGCAACTGTTTACTTTTG
GGTTGGTCAACAATTTATTTTGAGTCGACGAAAATATTTACTGTCATCAT
GGAATATAATTTTGTTCTACAATTTTATAATAATTTTAATAAAATGTAAT
TTACAATTGGTAAGTTGTGTCTATATTGACCATATAATAAACTATTCAAA
ATGTTGGCTTATTCACATTTTGGGTATTCACTGCATCCCAACGAGAGAAA
ATCATATATCTATTTCAATTGAGAATAGTTGTGGACATATCAATAATGAT
TTCTATTGGGATGTGCTTTGCTTCATCTTTCTGATTATTCAACGTAAAAT
ATTTACAACAAAATCGTTTGGATATGTAGTTTTGGATATGAAAATTACCA
ATAAATTTACATCTAGAGGGGCACTACTTATTAATAAAAAATTAATGGGA
ATTTTAACAGAAGAAAAGGAAAAAGAGAATCAACTATTTACAAAAGTTAA
AGAAAAGATTTTACGAATCGAACAAACTCATCAAAACTACGGCAGACCTT
TACCGAATGAACATTATTTAGTTTTAAGATCAGGCGATTATTTTCTTTTT
GAAGAACATCAAGAAGAAGATGAATACGATGACAGGATAGATGATTCTTT
CGAATTCTTGAAAGGATTTCATGGAAAATCTGATGAACAAATAAAACACA
AATCGAATGAAATGCTTGATTATATGCTTGTGAATTCAATAGACGATATA
AAATTTAAAAGAAATTGTAGTACTCAACATTTTCAATTTGCAAATAATTT
ACTGAAAAATAGTGTTATTCCAATGCCCATAGCAAGAAGTCATACTGAAA
AGAGTAGTTATAAAGTTAACAAAAATAAAAGCAATAAAATTTTCTTCAAA
AAAGATTTTGTGGTTTTAAATTCTGAAGAACACTCAAGCAGTGAAAGTTC
TATTTCAGCATCCCCCGTTAACAATTCCGAAGATACTATAGAAAAGGATT
CAAGTGAAGAAGATCGTAGTAAATATTGGAAAAAGGAAGATAGCAAAATT
TGGAAATATTATACCTTTTTCCTTACTTGTCTTGATAAGTTAATTATAAA
AATAAACTTACTGACTAAAGACATTAGATATGTAAGAAATATTTTAGAAA
ATGAAAAAAGATTGATAAAAACTAGAATAATCACTTATACCGAAGGAGAT
TGGATGGGGAGCTATGAAAATTCTTTTTTTTTGTATAAAAATCAAGGACA
AACTTTAGAAATAAATATAAAATTGAATGCTTTTTTAACACAAACAGAAG
ATCATTTTCAAATTCTATATCGAGTAGTGGAGTTGGAAAACATTGATGTA
AAACTATATTATGACAAAATAAACAAAATTGATAACGAACCTCATATAAA
TAATACTAATAATGTTATTTTTGTGGATGAGACAAGTCAAGCACAACAAT
TTCAAAAATCTTCGTCTCGATTGTTCTTATTGATAGTGGCAATAGGAAAT
TTGGTGATCATTTACTCAGATATGCTATGTTACATGATCCTCGTCATGAA
TCATATGATCTCTGTCAATATGCTTTCACTGCTATATCCTTTATCTGTCT
TTCTTTGGGCAATGCTCTCCACTCCAAGGCCATCCACATTTTATTGGATA
TTTATAATTTTATATACACAGTTGGTTATTCTAATAAAATATGTATTTCA
ATTTAAATTCATCGACATAGAAAGCGATGTAAATGCATTAGAAAAAGACA
GTCCTTTCTTTCTTCCAGTTTTTCTTGGAATAAATAAGACTGAACATTAT
GCATTAATTGACCTACTGCAATTATTCGTATTGTTTCTTCATCGAGGTTA
CCTAAAAAATCATGGACTTTGGAAAGGGTTCAAAGATAAATTCAATATTA
AAGAACCAGAAAAGAAAACAAATTTCAATACTTTACAAACAAGTTCGCTA
ACTTCAAGATTTATATTATTGAAACCCTTTATAACAGTAAAAAAATTCTA
TATGAATTTGGCATCTTACAGATACTCGAAACGAGTCGATGTATATGTTT
ATATGTTCATATGTGAATTCATTTCCTTTTTCATTATTGTCATCGGCTAC
GAAGCCTTTGGACCTGGAACTGGATCGACAAGCACAGCTCTGGATTTCCT
CAAAGACAGCAAAATTCCAATTCCATTTATTCTCATGTTGATTACGCAAT
TTATATTCATTATCATTGACCGGGCTCTATTTCTTAGGAAACACGTTATT
GGCAAATTGGTTTTCCAAATTTTTTACGTAATACTCATCCATGTTTGGAT
TTTCTTTCTCAACCCGTTCATCTCCAGAAGTAAATATAATGCCCGAATGG
CACCTCAATTTCTATATTTCTTCAAATGCGTATATTTCGCCTTGTCTTCC
TATCAAATAAAATCGGGTTATCCGTTAAGAATTCTGGGGAATTTTTTGAC
GAAAAAATATAATTATTTGAATTTATTTTTGTTTAAAGGATATTTACTTG
TTCCGTTTCTTTACGAATTGAGAAATGTTATGGACTGGATTTGGACTGAT
ACGGCATTATCTCTTTACCATTGGATGGAAGTGGAAGACGTTTTCGCAAA
AATATTTGTTTTGAAATGTTGGCGCCGATCAGAATTGGAATACCCCACGC
CACGGGGAACCAACAGGTGGCATGTTACAAAATATCTTGTTGGTGGACTT
CTGATGATATTCTTTTTCTTATGTTTCTGGGGCCCGTTAGTGTTAGGAAG
TGTCATTGGAAGTATATTTGTTAGAAACCCACCTTTCCACTGCAAATTGA
CATTAGAATTTGACGGATTTTCTAAAATTTACGAATATAACTCCAGAGGT
GACATGTTGCAGGCTATGTCGGACGATGAGTATAACTACATAAAAGACTG
TTACAAAAATAATGTTGTTGCTTTGAGTTTCATGAAAAGCTTCGAACCGG
ATGACGTAACCATTATGTACATCTCAAATGTATCTGAAAGCATCTGGTCT
ATAACCCCACCGAATAAGGATTTATTTATGAAGAGTTTACTGGACAAGAA
AATTACTATGAATCTGAACTCCATGATAGAATGCGAACGAAATCCAAGTG
ACACTAAAACTACGAAAACTGTTGTCGATTATACATTTGTTAAAAATCTC
TCATTAACTGAAAGAACGGAAATTGCAAGTTTGTTTACAATTCCAAAAAA
GTATGCTGTATTAGTGAAAGGGTTACCACGATTTCTTGTTGCAACCAAAA
CTGATTTTCAAGATGCTTTAGTGCTTGGATCCGAAAACTCATTGAATCCT
TTAGAATCTTACATGATAATGTTAAGTATCGAAAGATCTACATCAGATTG
GTGGCAATTACATTCTCATAAGGAATTCGACTGTTTGTCGAGAAATCCGT
TTTCCCCAGATAAAACTAAATTCTTTATTTTTAGTGAAAGAATATCTGAT
AATTTATTTGGTCAACTCTTCAGCAGATATGGAATTATTGGAATTTATGC
AGCATATATTTTCGTTGCTCACAGATTGTTGAGAGCAGTTTATTCTAACA
TCTCTTACATAATCCGTTGCGAGGAACTGCCATACGTTGACAGAATATTA
AAATTACTAAATGAGATATATTTAGTAAGGGAAAATAAGATGTTTAGACT
GGAAGAACAATTAGTAGCAAAACTTATTTTTGTTTACCGTTCTGACGAGA
CAATGATCAGATTCACGAGACTTAAGCAAAGCATATTAGATGAACATATG
GACAAATAACGCAATTTGATAAATCCATATACTTTTAATACTAATAATTT
GGCAAACGATATTTCATAAATATTGTGTCTATAATAAAG
back to top

protein sequence of SMED30006368-orf-1

>SMED30006368-orf-1 ID=SMED30006368-orf-1|Name=SMED30006368-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=467bp
MTKMFLIGMVIILLVVSITFTLCHPIVHILIIFYPNFLKNCSSPYVLYMY
QIGITKLLGLYYKIDTSCERHGSVTILQQRFFDFMNPFALFALFYIHSLD
SKIWLDREAIQNLALFTKSSSSQNTNAAVSQKKNRFTEHIHNTETTATGM
PAISLPFIWSVITSLVKNSYIFSFIAMMAWSVTYKSWLTFVLLILACILW
LLPDSRAACLVMSPFIVGYGIMLIFINYVTNINGDEIMNTIKIFFEPYFE
ISEFGIFEWKIPFIPLLLTIGYLVVFWLTLRLYMKEKIRLSVSSQIDRAR
SSVIFEDNSTFKSLVYFLHKLCAKYWIFGCTICLLLVSIQKQVKIIYLVY
MMFLVILMTFFMFSYSFWRRQMYIYWWLVIVYSLGVLFGIYTFQFKIFQE
LWFNYTIFTQENLKDFGFEVFDMSSLLEGLLSPVILLIVTIIQVHYFHNP
FMKMSDLTPKRISFSR*
back to top

protein sequence of SMED30006368-orf-2

>SMED30006368-orf-2 ID=SMED30006368-orf-2|Name=SMED30006368-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MKVISRESSTSRNQNNYLISIIAKLLSKLLHKKEDSYAKELNYLVYDANG
AIYILTRKLIIIFKYIYYKIWRILEIHFTKIIVVAISKYATSHFQQFLSC
YQCK*
back to top

protein sequence of SMED30006368-orf-3

>SMED30006368-orf-3 ID=SMED30006368-orf-3|Name=SMED30006368-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MQMIANMMFQLIILENFEFKTNCSLKNKYFAKFTLDQMDNLEYIGLLKYS
DFQPFAWSIAFNMILCSLWHVIKYHQIRYYNFNTSHKPEHKLVFPYFTFR
SIDHRLTSAVKGFLNFAFYKMGLECILFIFLIYWKIGYFFQAI*
back to top

protein sequence of SMED30006368-orf-4

>SMED30006368-orf-4 ID=SMED30006368-orf-4|Name=SMED30006368-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1327bp
MCVNLQYYVFKIENNIYKYKGGENRPIVFNELPKTEDKDFISNKNSYMDY
LKQIIFCWFYWLTLGIVFFNGIMRNTLFCLGYMILATVYFWVGQQFILSR
RKYLLSSWNIILFYNFIIILIKCNLQLVSCVYIDHIINYSKCWLIHILGI
HCIPTRENHISISIENSCGHINNDFYWDVLCFIFLIIQRKIFTTKSFGYV
VLDMKITNKFTSRGALLINKKLMGILTEEKEKENQLFTKVKEKILRIEQT
HQNYGRPLPNEHYLVLRSGDYFLFEEHQEEDEYDDRIDDSFEFLKGFHGK
SDEQIKHKSNEMLDYMLVNSIDDIKFKRNCSTQHFQFANNLLKNSVIPMP
IARSHTEKSSYKVNKNKSNKIFFKKDFVVLNSEEHSSSESSISASPVNNS
EDTIEKDSSEEDRSKYWKKEDSKIWKYYTFFLTCLDKLIIKINLLTKDIR
YVRNILENEKRLIKTRIITYTEGDWMGSYENSFFLYKNQGQTLEINIKLN
AFLTQTEDHFQILYRVVELENIDVKLYYDKINKIDNEPHINNTNNVIFVD
ETSQAQQFQKSSSRLFLLIVAIGNLVIIYSDMLCYMILVMNHMISVNMLS
LLYPLSVFLWAMLSTPRPSTFYWIFIILYTQLVILIKYVFQFKFIDIESD
VNALEKDSPFFLPVFLGINKTEHYALIDLLQLFVLFLHRGYLKNHGLWKG
FKDKFNIKEPEKKTNFNTLQTSSLTSRFILLKPFITVKKFYMNLASYRYS
KRVDVYVYMFICEFISFFIIVIGYEAFGPGTGSTSTALDFLKDSKIPIPF
ILMLITQFIFIIIDRALFLRKHVIGKLVFQIFYVILIHVWIFFLNPFISR
SKYNARMAPQFLYFFKCVYFALSSYQIKSGYPLRILGNFLTKKYNYLNLF
LFKGYLLVPFLYELRNVMDWIWTDTALSLYHWMEVEDVFAKIFVLKCWRR
SELEYPTPRGTNRWHVTKYLVGGLLMIFFFLCFWGPLVLGSVIGSIFVRN
PPFHCKLTLEFDGFSKIYEYNSRGDMLQAMSDDEYNYIKDCYKNNVVALS
FMKSFEPDDVTIMYISNVSESIWSITPPNKDLFMKSLLDKKITMNLNSMI
ECERNPSDTKTTKTVVDYTFVKNLSLTERTEIASLFTIPKKYAVLVKGLP
RFLVATKTDFQDALVLGSENSLNPLESYMIMLSIERSTSDWWQLHSHKEF
DCLSRNPFSPDKTKFFIFSERISDNLFGQLFSRYGIIGIYAAYIFVAHRL
LRAVYSNISYIIRCEELPYVDRILKLLNEIYLVRENKMFRLEEQLVAKLI
FVYRSDETMIRFTRLKQSILDEHMDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR027272Piezo
IPR031334Piezo_RRas-bd_dom
IPR031805Piezo_dom
Vocabulary: molecular function
TermDefinition
GO:0008381mechanically-gated ion channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR031334Piezo non-specific cation channel, R-Ras-binding domainPFAMPF12166Piezo_RRas_bdgcoord: 907..1314
e-value: 2.6E-105
score: 353.2
IPR031805Piezo domainPFAMPF15917PIEZOcoord: 128..254
e-value: 1.4E-22
score: 80.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 389..412
NoneNo IPR availableTMHMMTMhelixcoord: 77..99
NoneNo IPR availableTMHMMTMhelixcoord: 797..819
NoneNo IPR availableTMHMMTMhelixcoord: 826..848
NoneNo IPR availableTMHMMTMhelixcoord: 858..875
NoneNo IPR availableTMHMMTMhelixcoord: 111..133
NoneNo IPR availableTMHMMTMhelixcoord: 54..73
NoneNo IPR availableTMHMMTMhelixcoord: 976..998
NoneNo IPR availableTMHMMTMhelixcoord: 621..640
NoneNo IPR availableTMHMMTMhelixcoord: 755..777
NoneNo IPR availableTMHMMTMhelixcoord: 895..912
NoneNo IPR availableTMHMMTMhelixcoord: 1230..1247
NoneNo IPR availableTMHMMTMhelixcoord: 567..589
NoneNo IPR availableTMHMMTMhelixcoord: 594..611
IPR027272Piezo familyPANTHERPTHR13167UNCHARACTERIZEDcoord: 1..1316