Ubiquitin-like protein 3

Overview
NameUbiquitin-like protein 3
Smed IDSMED30006363
Length (bp)1090
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-like protein 3 (SMED30006363) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-like protein 3 (SMED30006363) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-like protein 3 (SMED30006363) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-like protein 3 (SMED30006363) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006363

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30006363SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006363SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30006363SMESG000036610.1 dd_Smed_v4_5328_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006363SMESG000036610.1 dd_Smed_v6_5328_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30006363SMESG000036610.1 OX_Smed_1.0.21290ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-like protein 3 vs. Ensembl Human
Match: UBL3 (ubiquitin like 3 [Source:HGNC Symbol;Acc:HGNC:12504])

HSP 1 Score: 79.337 bits (194), Expect = 1.221e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Celegans
Match: C46F11.6 (Ubiquitin-like protein [Source:UniProtKB/TrEMBL;Acc:Q7YX48])

HSP 1 Score: 78.1814 bits (191), Expect = 1.239e-17
Identity = 39/99 (39.39%), Postives = 60/99 (60.61%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDW--DEKPDDNILRLIYHGRFLNFDMKLKDLNL-PDGLVVMHLIFRKSIPQPGTQEDVKKSKSPSHSCFR 385
            VSGK+   EF  LT+  ++ + +F+ WP++W  D+     +L+LIYHGRFL+  + L  L L P    VMHL+ R+++P+P + E + K KS    C R
Sbjct:   21 VSGKTHEFEFHPLTSAHDVTQMVFDQWPDEWYEDKVQSAQMLKLIYHGRFLHGSVTLHALQLMPGKTTVMHLVTRENLPEPNSSETLTKRKSA--GCCR 117          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Fly
Match: UBL3 (gene:FBgn0026076 transcript:FBtr0074174)

HSP 1 Score: 75.485 bits (184), Expect = 6.700e-15
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   +  +I + +F+NWP DW  +      ILRLIY GRFL+ ++ L  L LP G   VMHL+ R ++P+P +Q+  + SK  S  C
Sbjct:  243 VSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRC 339          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Fly
Match: UBL3 (gene:FBgn0026076 transcript:FBtr0300787)

HSP 1 Score: 75.485 bits (184), Expect = 6.700e-15
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   +  +I + +F+NWP DW  +      ILRLIY GRFL+ ++ L  L LP G   VMHL+ R ++P+P +Q+  + SK  S  C
Sbjct:  243 VSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRC 339          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Fly
Match: UBL3 (gene:FBgn0026076 transcript:FBtr0074175)

HSP 1 Score: 75.485 bits (184), Expect = 6.700e-15
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   +  +I + +F+NWP DW  +      ILRLIY GRFL+ ++ L  L LP G   VMHL+ R ++P+P +Q+  + SK  S  C
Sbjct:  243 VSGKTKEFIFSPSDSAGDIAQTVFDNWPEDWTHETVSKAEILRLIYQGRFLHCNVTLGALGLPLGKTTVMHLVPRDNLPEPNSQDQRQNSKGGSGRC 339          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Match: ubl3a (ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131-3431])

HSP 1 Score: 76.6406 bits (187), Expect = 5.416e-17
Identity = 37/97 (38.14%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW+E+     NI+RLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:    8 VSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNIVRLIYQGRFLHGNVTLGVLKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 104          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Match: ubl3a (ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131-3431])

HSP 1 Score: 76.6406 bits (187), Expect = 7.658e-17
Identity = 37/97 (38.14%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW+E+     NI+RLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNIVRLIYQGRFLHGNVTLGVLKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Match: ubl3b (ubiquitin-like 3b [Source:ZFIN;Acc:ZDB-GENE-040630-4])

HSP 1 Score: 75.0998 bits (183), Expect = 3.045e-16
Identity = 36/97 (37.11%), Postives = 58/97 (59.79%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I  ++F NWP  W+E+     +ILRLI+ GRFL+ ++ L  L LP G   VMHL+ R+++P+P +     + K+   SC
Sbjct:   17 VSGKTQDFTFSPNDSATDIARHVFENWPAGWEEESVSSPSILRLIFQGRFLHGNVTLGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESSC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Match: ubl3b (ubiquitin-like 3b [Source:ZFIN;Acc:ZDB-GENE-040630-4])

HSP 1 Score: 75.0998 bits (183), Expect = 3.045e-16
Identity = 36/97 (37.11%), Postives = 58/97 (59.79%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I  ++F NWP  W+E+     +ILRLI+ GRFL+ ++ L  L LP G   VMHL+ R+++P+P +     + K+   SC
Sbjct:   17 VSGKTQDFTFSPNDSATDIARHVFENWPAGWEEESVSSPSILRLIFQGRFLHGNVTLGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESSC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Match: ubl3a (ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131-3431])

HSP 1 Score: 56.225 bits (134), Expect = 6.122e-10
Identity = 27/65 (41.54%), Postives = 43/65 (66.15%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG 286
            VSGK+    F+   + ++I +++++NWP DW+E+     NI+RLIY GRFL+ ++ L  L LP G
Sbjct:   17 VSGKTKEFLFSPNDSAADIAKHVYDNWPMDWEEEQVSSPNIVRLIYQGRFLHGNVTLGVLKLPLG 81          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Xenopus
Match: ubl3 (ubiquitin like 3 [Source:NCBI gene;Acc:100135746])

HSP 1 Score: 77.7962 bits (190), Expect = 4.515e-17
Identity = 37/97 (38.14%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    ++   + ++I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   22 VSGKTKEFLYSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 118          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Xenopus
Match: ubl3 (ubiquitin like 3 [Source:NCBI gene;Acc:100135746])

HSP 1 Score: 77.7962 bits (190), Expect = 4.654e-17
Identity = 37/97 (38.14%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    ++   + ++I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLYSPNDSAADIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Mouse
Match: Ubl3 (ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:1344373])

HSP 1 Score: 79.337 bits (194), Expect = 9.082e-18
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Mouse
Match: Ubl3 (ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:1344373])

HSP 1 Score: 79.337 bits (194), Expect = 9.082e-18
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Mouse
Match: Ubl3 (ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:1344373])

HSP 1 Score: 79.337 bits (194), Expect = 9.082e-18
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. UniProt/SwissProt
Match: sp|O95164|UBL3_HUMAN (Ubiquitin-like protein 3 OS=Homo sapiens OX=9606 GN=UBL3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.861e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q2TA46|UBL3_BOVIN (Ubiquitin-like protein 3 OS=Bos taurus OX=9913 GN=UBL3 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.861e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5BJT2|UBL3_RAT (Ubiquitin-like protein 3 OS=Rattus norvegicus OX=10116 GN=Ubl3 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.352e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9Z2M6|UBL3_MOUSE (Ubiquitin-like protein 3 OS=Mus musculus OX=10090 GN=Ubl3 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.352e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + S+I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Match: A0A0V1HSJ1 (Ubiquitin-like protein 3 (Fragment) OS=Trichinella zimbabwensis OX=268475 GN=UBL3 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.672e-19
Identity = 44/99 (44.44%), Postives = 71/99 (71.72%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKS--PSHSC 379
            V GK+C   F S  + S++ +Y+F++WP+DW+E+     ++L+LIYHGRFL+ ++ L+ L+LP G   VMHL+ RK++P+P +Q+++KKSKS    H C
Sbjct:   41 VCGKTCDFLFDSSFSASDVAQYVFDHWPDDWEEERVQSASLLKLIYHGRFLHGNVTLRALSLPIGKTTVMHLVARKTLPEPNSQDNLKKSKSRLCCHCC 139          
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Match: A0A090MZ82 (Ubiquitin-like protein 3 OS=Strongyloides ratti OX=34506 GN=SRAE_2000313600 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 4.678e-19
Identity = 41/98 (41.84%), Postives = 69/98 (70.41%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSCF 382
            VSG+   I+F   T+ +++C+Y+FNNWP +WD++     ++L+LIYHGRFL+  + L  L+LP G   VMHL+ R+++P+P + + +KK+K  S+ C+
Sbjct:   20 VSGRVREIQFPPSTSAADVCDYVFNNWPPEWDDEKVTSSSLLKLIYHGRFLHGTVTLSALSLPLGKTTVMHLVTRENLPEPNSNDSLKKAKRGSNCCY 117          
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Match: A0A0V1G6D9 (Ubiquitin-like protein 3 (Fragment) OS=Trichinella pseudospiralis OX=6337 GN=UBL3 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 6.123e-19
Identity = 44/99 (44.44%), Postives = 70/99 (70.71%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKS--PSHSC 379
            V GK+C   F S  + S++ +Y+F++WP+DW E+     ++L+LIYHGRFL+ ++ L+ L+LP G   VMHL+ RK++P+P +Q+++KKSKS    H C
Sbjct:   41 VCGKTCDFLFDSSFSASDVAQYVFDHWPDDWQEERVQSASLLKLIYHGRFLHGNVTLRALSLPIGKTTVMHLVARKTLPEPNSQDNLKKSKSRLCCHCC 139          
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Match: A0A0V0TVG4 (Ubiquitin-like protein 3 OS=Trichinella murrelli OX=144512 GN=UBL3 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.745e-19
Identity = 44/99 (44.44%), Postives = 71/99 (71.72%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKS--PSHSC 379
            V GK+C   F S  + S++ +Y+F++WP+DW+E+     ++L+LIYHGRFL+ ++ L+ L+LP G   VMHL+ RK++P+P +Q+++KKSKS    H C
Sbjct:   64 VCGKTCDFLFDSSFSASDVAQYVFDHWPDDWEEERVQSASLLKLIYHGRFLHGNVTLRALSLPIGKTTVMHLVARKTLPEPNSQDNLKKSKSRLCCHCC 162          
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Match: A0A0V1BLV2 (Ubiquitin-like protein 3 OS=Trichinella spiralis OX=6334 GN=UBL3 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 6.745e-19
Identity = 44/99 (44.44%), Postives = 71/99 (71.72%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKS--PSHSC 379
            V GK+C   F S  + S++ +Y+F++WP+DW+E+     ++L+LIYHGRFL+ ++ L+ L+LP G   VMHL+ RK++P+P +Q+++KKSKS    H C
Sbjct:   64 VCGKTCDFLFDSSFSASDVAQYVFDHWPDDWEEERVQSASLLKLIYHGRFLHGNVTLRALSLPIGKTTVMHLVARKTLPEPNSQDNLKKSKSRLCCHCC 162          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Match: ubl3a (ubiquitin like 3 [Source:NCBI gene;Acc:103040894])

HSP 1 Score: 80.1073 bits (196), Expect = 3.352e-18
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + KS   +C
Sbjct:   17 VSGKTKEFPFSPNDSATDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKSGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Match: ubl3a (ubiquitin like 3 [Source:NCBI gene;Acc:103040894])

HSP 1 Score: 78.9518 bits (193), Expect = 1.043e-17
Identity = 39/97 (40.21%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + KS   +C
Sbjct:   25 VSGKTKEFPFSPNDSATDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKSGESNC 121          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Match: ubl3b (ubiquitin-like protein 3 [Source:NCBI gene;Acc:103021577])

HSP 1 Score: 75.0998 bits (183), Expect = 2.221e-16
Identity = 36/97 (37.11%), Postives = 57/97 (58.76%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I  ++F NWP  W+E+      ILRLI+ GRFL+ ++ L  L LP G   VMHL+ R+++P+P +     + K+   SC
Sbjct:   17 VSGKTQDFTFSPNDSATDIARHVFENWPAGWEEEQVSSPGILRLIFQGRFLHGNVTLGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESSC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Match: ubl3b (ubiquitin-like protein 3 [Source:NCBI gene;Acc:103021577])

HSP 1 Score: 75.0998 bits (183), Expect = 2.724e-16
Identity = 36/97 (37.11%), Postives = 57/97 (58.76%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I  ++F NWP  W+E+      ILRLI+ GRFL+ ++ L  L LP G   VMHL+ R+++P+P +     + K+   SC
Sbjct:   16 VSGKTQDFTFSPNDSATDIARHVFENWPAGWEEEQVSSPGILRLIFQGRFLHGNVTLGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESSC 112          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Match: ubl3a (ubiquitin like 3 [Source:NCBI gene;Acc:103040894])

HSP 1 Score: 75.0998 bits (183), Expect = 3.153e-16
Identity = 36/86 (41.86%), Postives = 58/86 (67.44%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQED 346
            VSGK+    F+   + ++I +++++NWP DW+E+     NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q +
Sbjct:   17 VSGKTKEFPFSPNDSATDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGN 102          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007563.1 (pep scaffold:Pmarinus_7.0:GL479599:3164:11915:1 gene:ENSPMAG00000006830.1 transcript:ENSPMAT00000007563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 4.296e-12
Identity = 30/68 (44.12%), Postives = 42/68 (61.76%), Query Frame = 2
Query:  185 DWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            DW+E+     NILRLIY GRFL+  + L  L LP G   VMHL+ R+++P+P +Q    + K+   SC
Sbjct:    2 DWEEEQVSSPNILRLIYQGRFLHGTVTLSALKLPMGKTTVMHLVARETLPEPNSQGQRNRGKTEESSC 69          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Nematostella
Match: EDO34674 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNL0])

HSP 1 Score: 74.7146 bits (182), Expect = 1.309e-16
Identity = 39/97 (40.21%), Postives = 58/97 (59.79%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   T   I + +F +WP DW E+     NIL+LIY GRFL+ ++ L  L+LP G   VMHL+ R+++P+P +Q    + K+   SC
Sbjct:   23 VSGKTHEFVFSPSDTAYYITQQVFEHWPEDWKEETVSSHNILKLIYQGRFLHGNVTLGALHLPLGKRTVMHLVARENLPEPASQGLRNREKTDERSC 119          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Medaka
Match: ubl3a (ubiquitin like 3 [Source:NCBI gene;Acc:101164944])

HSP 1 Score: 77.0258 bits (188), Expect = 5.226e-17
Identity = 37/97 (38.14%), Postives = 61/97 (62.89%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDW--DEKPDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW  ++    NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   17 VSGKTKEFVFSPNDSAADIAKHVYDNWPMDWEMEQVSSPNILRLIYQGRFLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Medaka
Match: ubl3a (ubiquitin like 3 [Source:NCBI gene;Acc:101164944])

HSP 1 Score: 76.2554 bits (186), Expect = 7.957e-17
Identity = 37/97 (38.14%), Postives = 61/97 (62.89%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDW--DEKPDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++++NWP DW  ++    NILRLIY GRFL+ ++ L  L LP G   VMHL+ R+++P+P +Q    + K+   +C
Sbjct:   12 VSGKTKEFVFSPNDSAADIAKHVYDNWPMDWEMEQVSSPNILRLIYQGRFLHGNVTLGALKLPLGKTTVMHLVARETLPEPNSQGQRNREKTGESNC 108          
BLAST of Ubiquitin-like protein 3 vs. Ensembl Medaka
Match: ubl3b (ubiquitin-like protein 3 [Source:NCBI gene;Acc:101173950])

HSP 1 Score: 73.9442 bits (180), Expect = 5.756e-16
Identity = 35/97 (36.08%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEK--PDDNILRLIYHGRFLNFDMKLKDLNLPDG-LVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            VSGK+    F+   + ++I +++F+NWP  W+E+     +ILRLI+ GRFL+ ++ L  L LP G   VMHL+ R+++P+P +     + K+   +C
Sbjct:   17 VSGKTQDFTFSPNDSATDIAKHVFDNWPAGWEEEQVSSPSILRLIFQGRFLHGNVTLGALKLPPGRTTVMHLVARETLPEPNSHGQRNREKTTESNC 113          
BLAST of Ubiquitin-like protein 3 vs. Planmine SMEST
Match: SMESG000036610.1 (SMESG000036610.1)

HSP 1 Score: 214.157 bits (544), Expect = 1.293e-69
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:   47 METTADSXXXXXXXXXXVSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEKPDDNILRLIYHGRFLNFDMKLKDLNLPDGLVVMHLIFRKSIPQPGTQEDVKKSKSPSHSCFRS 388
            METTADSLLMVNLKLLLVSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEKPDDNILRLIYHGRFLNFDMKLKDLNLPDGLVVMHLIFRKSIPQPGTQEDVKKSKSPSHSCFRS
Sbjct:    1 METTADSLLMVNLKLLLVSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEKPDDNILRLIYHGRFLNFDMKLKDLNLPDGLVVMHLIFRKSIPQPGTQEDVKKSKSPSHSCFRS 114          
BLAST of Ubiquitin-like protein 3 vs. Planmine SMEST
Match: SMESG000054551.1 (SMESG000054551.1)

HSP 1 Score: 92.0485 bits (227), Expect = 7.605e-23
Identity = 40/94 (42.55%), Postives = 59/94 (62.77%), Query Frame = 2
Query:   98 VSGKSCTIEFASLTTVSEICEYIFNNWPNDWDEKPDDNILRLIYHGRFLNFDMKLKDLNLPDGLVVMHLIFRKSIPQPGTQEDVKKSKSPSHSC 379
            V+G+     F+  TT  +IC +I+NNWP +W +KPD NILRLIY GRF   D  L+++N+     V+HL+ R+++P+P  Q  +KK K     C
Sbjct:   10 VNGQYKEYIFSPETTAQQICNHIYNNWPEEWTDKPDQNILRLIYQGRFFMDDTTLENMNIASETTVIHLVMRENVPKPAKQSQIKKIKIGHCGC 103          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
UBL31.221e-1740.21ubiquitin like 3 [Source:HGNC Symbol;Acc:HGNC:1250... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C46F11.61.239e-1739.39Ubiquitin-like protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
UBL36.700e-1540.21gene:FBgn0026076 transcript:FBtr0074174[more]
UBL36.700e-1540.21gene:FBgn0026076 transcript:FBtr0300787[more]
UBL36.700e-1540.21gene:FBgn0026076 transcript:FBtr0074175[more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubl3a5.416e-1738.14ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
ubl3a7.658e-1738.14ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
ubl3b3.045e-1637.11ubiquitin-like 3b [Source:ZFIN;Acc:ZDB-GENE-040630... [more]
ubl3b3.045e-1637.11ubiquitin-like 3b [Source:ZFIN;Acc:ZDB-GENE-040630... [more]
ubl3a6.122e-1041.54ubiquitin-like 3a [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ubl34.515e-1738.14ubiquitin like 3 [Source:NCBI gene;Acc:100135746][more]
ubl34.654e-1738.14ubiquitin like 3 [Source:NCBI gene;Acc:100135746][more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ubl39.082e-1840.21ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:134437... [more]
Ubl39.082e-1840.21ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:134437... [more]
Ubl39.082e-1840.21ubiquitin-like 3 [Source:MGI Symbol;Acc:MGI:134437... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O95164|UBL3_HUMAN5.861e-1740.21Ubiquitin-like protein 3 OS=Homo sapiens OX=9606 G... [more]
sp|Q2TA46|UBL3_BOVIN5.861e-1740.21Ubiquitin-like protein 3 OS=Bos taurus OX=9913 GN=... [more]
sp|Q5BJT2|UBL3_RAT6.352e-1740.21Ubiquitin-like protein 3 OS=Rattus norvegicus OX=1... [more]
sp|Q9Z2M6|UBL3_MOUSE6.352e-1740.21Ubiquitin-like protein 3 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V1HSJ13.672e-1944.44Ubiquitin-like protein 3 (Fragment) OS=Trichinella... [more]
A0A090MZ824.678e-1941.84Ubiquitin-like protein 3 OS=Strongyloides ratti OX... [more]
A0A0V1G6D96.123e-1944.44Ubiquitin-like protein 3 (Fragment) OS=Trichinella... [more]
A0A0V0TVG46.745e-1944.44Ubiquitin-like protein 3 OS=Trichinella murrelli O... [more]
A0A0V1BLV26.745e-1944.44Ubiquitin-like protein 3 OS=Trichinella spiralis O... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubl3a3.352e-1840.21ubiquitin like 3 [Source:NCBI gene;Acc:103040894][more]
ubl3a1.043e-1740.21ubiquitin like 3 [Source:NCBI gene;Acc:103040894][more]
ubl3b2.221e-1637.11ubiquitin-like protein 3 [Source:NCBI gene;Acc:103... [more]
ubl3b2.724e-1637.11ubiquitin-like protein 3 [Source:NCBI gene;Acc:103... [more]
ubl3a3.153e-1641.86ubiquitin like 3 [Source:NCBI gene;Acc:103040894][more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007563.14.296e-1244.12pep scaffold:Pmarinus_7.0:GL479599:3164:11915:1 ge... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346741.309e-1640.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ubl3a5.226e-1738.14ubiquitin like 3 [Source:NCBI gene;Acc:101164944][more]
ubl3a7.957e-1738.14ubiquitin like 3 [Source:NCBI gene;Acc:101164944][more]
ubl3b5.756e-1636.08ubiquitin-like protein 3 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Ubiquitin-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000036610.11.293e-69100.00SMESG000036610.1[more]
SMESG000054551.17.605e-2342.55SMESG000054551.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006363 ID=SMED30006363|Name=Ubiquitin-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1090bp
CGGTCTTATCGAAATCTATATAAATCTTATATGACCAACTTAACATATGG
AAACAACTGCAGACAGTCTTTTGATGGTGAACTTAAAACTTCTTCTGGTT
AGTGGAAAAAGTTGTACTATTGAATTTGCTTCTTTAACAACTGTATCAGA
AATATGTGAATATATTTTTAATAATTGGCCCAATGATTGGGATGAAAAAC
CTGATGATAATATTTTAAGATTAATTTATCATGGTAGATTTCTAAATTTT
GATATGAAATTAAAAGATCTCAATTTACCTGATGGTCTCGTAGTAATGCA
TTTGATATTCAGGAAAAGCATTCCTCAACCTGGCACTCAAGAAGACGTTA
AGAAGAGCAAGTCTCCCAGTCATTCTTGTTTCAGGTCTTGCTGTTGCATA
TGCTAGATTTTGAAAGACTGCAACAGCTAAGCAACTGTCTGTGATGAACC
CAACTTGATATCCTATTGTATACTGCACAGTGCATTTCATCATGTACATA
CAAATTTTTTTGATGCCGATACACAACTGTCACCATTATTATTATTATTA
CAATCACTACAACTGCCATCGTTTCTGAGTCACTCGCCTCGTACTCGTGT
AAATTGTTTATTTTCTTATTTAATCCTTGAGCAATGCGATTGTTTGGAGC
AATTATTGCGACTCTTGCATCGGATATAGTTTGGAATTCCACTGTTATCA
TTACTGCTATTATTATTATTATTATTANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNGTAGCAGTTCATACATTCATATAT
AAATATATATAAATAGGATGATATGATGACTCCTCCATCCTCCTAGTGTA
ATCTGTGATTGATTAAATATTGAATGACTTTTCTCTAACATTGTTTGAGT
CAATTTTGTTGTCGTGATTTATAATTTATGTCCGTCTAGTCTGGGACGGC
CATTTACGGGAAAATATTCAAGATTTGATTTATGTGCTTT
back to top

protein sequence of SMED30006363-orf-1

>SMED30006363-orf-1 ID=SMED30006363-orf-1|Name=SMED30006363-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MITVEFQTISDARVAIIAPNNRIAQGLNKKINNLHEYEASDSETMAVVVI
VIIIIMVTVVYRHQKNLYVHDEMHCAVYNRISSWVHHRQLLSCCSLSKSS
ICNSKT*
back to top

protein sequence of SMED30006363-orf-2

>SMED30006363-orf-2 ID=SMED30006363-orf-2|Name=SMED30006363-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
METTADSLLMVNLKLLLVSGKSCTIEFASLTTVSEICEYIFNNWPNDWDE
KPDDNILRLIYHGRFLNFDMKLKDLNLPDGLVVMHLIFRKSIPQPGTQED
VKKSKSPSHSCFRSCCCIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR039540UBL3-like_ubiquitin_dom
IPR040015UBL3-like
IPR000626Ubiquitin-like_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005886plasma membrane
GO:0016020membrane
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 1..95
e-value: 9.1E-24
score: 85.3
NoneNo IPR availablePANTHERPTHR13169:SF0UBIQUITIN-LIKE PROTEIN 3coord: 10..118
NoneNo IPR availableCDDcd17048Ubl_UBL3coord: 18..89
e-value: 3.64861E-22
score: 81.2708
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.456
IPR039540UBL3-like, ubiquitin domainPFAMPF13881Rad60-SLD_2coord: 10..111
e-value: 1.4E-18
score: 67.0
IPR040015UBL3-likePANTHERPTHR13169UBIQUITIN-LIKE PROTEIN 3 HCG-1 PROTEINcoord: 10..118
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 11..84
score: 9.417
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 10..101