Double-strand-break repair protein rad21-like protein

Overview
NameDouble-strand-break repair protein rad21-like protein
Smed IDSMED30006361
Length (bp)2822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Double-strand-break repair protein rad21-like protein (SMED30006361) t-SNE clustered cells

Violin plots show distribution of expression levels for Double-strand-break repair protein rad21-like protein (SMED30006361) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Double-strand-break repair protein rad21-like protein (SMED30006361) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Double-strand-break repair protein rad21-like protein (SMED30006361) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006361

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006361SMESG000003065.1 SMESG000003044.1 SmedASXL_017502SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006361SMESG000003065.1 SMESG000003044.1 SmedASXL_017502SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30006361SMESG000003065.1 SMESG000003044.1 dd_Smed_v4_4032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006361SMESG000003065.1 SMESG000003044.1 dd_Smed_v4_4032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006361SMESG000003065.1 SMESG000003044.1 dd_Smed_v4_4032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006361SMESG000003065.1 SMESG000003044.1 Contig45787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006361SMESG000003065.1 SMESG000003044.1 Contig45787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 269.626 bits (688), Expect = 1.817e-78
Identity = 197/485 (40.62%), Postives = 263/485 (54.23%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD------------STFEDGGDRDFVVEPITID-------SMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD            S FED    D +V   T +       S    NE   HL  E   +D+  G           ++S++   +F + PP++      SE G ++          EQ   D + + +N S+ G +S      ++   TM D   L    EE  ++E   P D+T                                  ++E +   KR  KL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDDREIMREGSAFEDD---DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDD-PPAL------SEAGVMLP---------EQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALE---PIDIT----------------------------------VKETKAKRKR--KLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCL-TPLVPEDL--------RKRRKGGEADNLDE 415          

HSP 2 Score: 58.151 bits (139), Expect = 6.417e-8
Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+ A+ + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ QE PYS+II T
Sbjct:  558 KRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIAT 623          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 219.164 bits (557), Expect = 7.594e-65
Identity = 109/170 (64.12%), Postives = 135/170 (79.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENRE--AAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDD 167          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 218.779 bits (556), Expect = 1.097e-64
Identity = 109/170 (64.12%), Postives = 135/170 (79.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENRE--AAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDD 167          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 187.193 bits (474), Expect = 8.262e-55
Identity = 89/126 (70.63%), Postives = 105/126 (83.33%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADI 436
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D+
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDL 124          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 184.496 bits (467), Expect = 6.978e-54
Identity = 87/119 (73.11%), Postives = 101/119 (84.87%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDF 415
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEEN--REAAYNAITLPEEFHDF 117          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Celegans
Match: coh-1 (COHesin family [Source:UniProtKB/TrEMBL;Acc:A0A131MBD0])

HSP 1 Score: 166.007 bits (419), Expect = 6.828e-43
Identity = 82/169 (48.52%), Postives = 119/169 (70.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDF-ESTLADINDIDPYGIAVNQSRPEDITMREEFGEP---NLGRP--DDDFGD 550
            MFYA FVLSKKGPL+++WLAAHW+KKL+++Q+FET++  +V  I++P  KLALRT+GHLLLG+ R++SR+ KYLL+DCNEAF+KIK+ FR GA       + N  L   ++ D   DF ++ L + ++ +     + QSR +DIT++E+  +    N G P  DDDFG+
Sbjct:    1 MFYADFVLSKKGPLSKVWLAAHWEKKLSKAQIFETDVDEAVNEIMQPSQKLALRTTGHLLLGICRVYSRKTKYLLADCNEAFLKIKLVFRSGA-----LDQPNPVLPTFSIQDIYGDFGDNVLPEFDEEELNHAPICQSRLDDITLKEDIPQKFTYNYGEPLEDDDFGE 164          

HSP 2 Score: 53.9138 bits (128), Expect = 4.967e-7
Identity = 36/91 (39.56%), Postives = 49/91 (53.85%), Query Frame = 2
Query: 1124 RRAPKRK-------RKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISV 1375
            R+A KR        RK  +D+ K I  + MK  M D S+I TRLDLAPP+RKLM+ K+  + E +   PG    S+   K F R  ++  V
Sbjct:  311 RQAQKRAMQKEQNMRKRRVDDVKMITGEEMKGNMADFSDILTRLDLAPPSRKLMMGKKRSHAEYMHHNPGMIGFSK--NKQFIRKYQSYLV 399          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Celegans
Match: scc-1 (Sister chromatid cohesion protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19325])

HSP 1 Score: 155.221 bits (391), Expect = 5.280e-39
Identity = 81/169 (47.93%), Postives = 113/169 (66.86%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG---IAVNQSRPEDITMREEFG---EPNLGRPDDDFGD 550
            MFYA FVL+KKGPLA++WLAAHW+KKLT++Q+FET++  ++E ++ PKVK+ALRT GHLLLG+VRI+S++ +YLL+D NEA+ K+K+ FR G     D   +  A      S+ +  +  T+ + +D D Y    I  N SR EDITM+E      E N+    D FGD
Sbjct:    1 MFYAQFVLAKKGPLAKVWLAAHWEKKLTKAQIFETDVPQAIEEVIRPKVKMALRTVGHLLLGIVRIYSKKTRYLLADTNEAYQKMKINFRNGFSFEVDIPEN--AEIEEDFSNFIDKYNITVPEFHDAD-YNEQLIMANVSRREDITMKETVNFNVEFNIDADFDGFGD 166          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Fly
Match: vtd (gene:FBgn0260987 transcript:FBtr0344093)

HSP 1 Score: 225.713 bits (574), Expect = 5.324e-63
Identity = 109/168 (64.88%), Postives = 133/168 (79.17%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFE 562
            MFY H +L+KKGPLARIWLAAHWDKK+T++ VFETNI  SVE IL+PKVKLALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG     + HR+   + AITL +  HDF++ L ++NDID     ++NQSR ++ITMRE++G  +L   DD FGD  FE
Sbjct:    1 MFYEHIILAKKGPLARIWLAAHWDKKITKAHVFETNIEKSVEGILQPKVKLALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGMVDLPEGHRE-ANVNAITLPEVFHDFDTALPELNDIDIEAQFSINQSRADEITMREDYGSLSLSLQDDGFGDIGFE 167          

HSP 2 Score: 103.99 bits (258), Expect = 1.667e-22
Identity = 49/92 (53.26%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            F L P+D S+ +     KRKRKL+IDE K+I  + MK Q+ DTS+I T LDLAPPT++LM WKETG VE LF+ P R+IP+R L   + R +
Sbjct:  313 FALAPLDVSMYKGVTKAKRKRKLIIDEIKNISGEEMKAQLADTSDILTTLDLAPPTKRLMYWKETGGVEKLFSLPSRSIPARALFGNYNRQL 404          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Fly
Match: vtd (gene:FBgn0260987 transcript:FBtr0113746)

HSP 1 Score: 227.254 bits (578), Expect = 6.571e-63
Identity = 109/168 (64.88%), Postives = 133/168 (79.17%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFE 562
            MFY H +L+KKGPLARIWLAAHWDKK+T++ VFETNI  SVE IL+PKVKLALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG     + HR+   + AITL +  HDF++ L ++NDID     ++NQSR ++ITMRE++G  +L   DD FGD  FE
Sbjct:    1 MFYEHIILAKKGPLARIWLAAHWDKKITKAHVFETNIEKSVEGILQPKVKLALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGMVDLPEGHRE-ANVNAITLPEVFHDFDTALPELNDIDIEAQFSINQSRADEITMREDYGSLSLSLQDDGFGDIGFE 167          

HSP 2 Score: 103.605 bits (257), Expect = 2.474e-22
Identity = 49/92 (53.26%), Postives = 64/92 (69.57%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            F L P+D S+ +     KRKRKL+IDE K+I  + MK Q+ DTS+I T LDLAPPT++LM WKETG VE LF+ P R+IP+R L   + R +
Sbjct:  313 FALAPLDVSMYKGVTKAKRKRKLIIDEIKNISGEEMKAQLADTSDILTTLDLAPPTKRLMYWKETGGVEKLFSLPSRSIPARALFGNYNRQL 404          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Match: rad21a (RAD21 cohesin complex component a [Source:NCBI gene;Acc:322275])

HSP 1 Score: 223.787 bits (569), Expect = 4.933e-62
Identity = 112/170 (65.88%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  +L   D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNISLMT-DNDFGDFGMDD 167          

HSP 2 Score: 92.4337 bits (228), Expect = 8.963e-19
Identity = 59/144 (40.97%), Postives = 83/144 (57.64%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEQQE 1471
            QT QT   P      F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG  +  ED +++ E
Sbjct:  291 QTEQTTLVPNED-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNGRLLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEDFLKELE 422          

HSP 3 Score: 55.0694 bits (131), Expect = 3.694e-7
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNII 2470
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +++ Q  PYS+II
Sbjct:  570 KRTQQMLHGLQRVVAKTGAQSISLLELCRNNNKKQAAAKFYSFLVLKKQQAIDLTQTEPYSDII 633          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Match: rad21a (RAD21 cohesin complex component a [Source:NCBI gene;Acc:322275])

HSP 1 Score: 223.787 bits (569), Expect = 4.933e-62
Identity = 112/170 (65.88%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  +L   D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNISLMT-DNDFGDFGMDD 167          

HSP 2 Score: 92.4337 bits (228), Expect = 8.963e-19
Identity = 59/144 (40.97%), Postives = 83/144 (57.64%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEQQE 1471
            QT QT   P      F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG  +  ED +++ E
Sbjct:  291 QTEQTTLVPNED-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNGRLLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEDFLKELE 422          

HSP 3 Score: 55.0694 bits (131), Expect = 3.694e-7
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNII 2470
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +++ Q  PYS+II
Sbjct:  570 KRTQQMLHGLQRVVAKTGAQSISLLELCRNNNKKQAAAKFYSFLVLKKQQAIDLTQTEPYSDII 633          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Match: rad21b (RAD21 cohesin complex component b [Source:ZFIN;Acc:ZDB-GENE-060503-223])

HSP 1 Score: 218.779 bits (556), Expect = 2.677e-60
Identity = 109/170 (64.12%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  +L + ++DF D   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNLSLLQ-ENDFADFGMDD 167          

HSP 2 Score: 91.2781 bits (225), Expect = 2.014e-18
Identity = 58/141 (41.13%), Postives = 84/141 (59.57%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLN-LDEDV--IEQQEVNQLACINE 1498
            F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG  + LDE +  +E  EV +   +N+
Sbjct:  308 FALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRLLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLDEFLKDLENPEVPREEALNQ 437          

HSP 3 Score: 58.5362 bits (140), Expect = 3.341e-8
Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  I + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q+ PYS+II T
Sbjct:  564 KRTQQMLHGLQRVIAKTGAESISLLDLCRNNNKKQAAAKFYSFLVLKKQQAVELRQDEPYSDIIAT 629          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Match: rad21b (RAD21 cohesin complex component b [Source:ZFIN;Acc:ZDB-GENE-060503-223])

HSP 1 Score: 218.779 bits (556), Expect = 2.677e-60
Identity = 109/170 (64.12%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  +L + ++DF D   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNLSLLQ-ENDFADFGMDD 167          

HSP 2 Score: 91.2781 bits (225), Expect = 2.014e-18
Identity = 58/141 (41.13%), Postives = 84/141 (59.57%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLN-LDEDV--IEQQEVNQLACINE 1498
            F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG  + LDE +  +E  EV +   +N+
Sbjct:  308 FALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRLLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLDEFLKDLENPEVPREEALNQ 437          

HSP 3 Score: 58.5362 bits (140), Expect = 3.341e-8
Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  I + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q+ PYS+II T
Sbjct:  564 KRTQQMLHGLQRVIAKTGAESISLLDLCRNNNKKQAAAKFYSFLVLKKQQAVELRQDEPYSDIIAT 629          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Match: rad21l1 (RAD21 cohesin complex component like 1 [Source:ZFIN;Acc:ZDB-GENE-061103-505])

HSP 1 Score: 174.096 bits (440), Expect = 1.241e-45
Identity = 81/151 (53.64%), Postives = 113/151 (74.83%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFG 511
            MFYA    SK+G LA+IWLAAHW+KK+T++ VFE ++ ++++ IL P++K+ LRTSGHLLLGVVRI+SR+ +YLL+DC++A VKIK+AFRPG     D+  + T L  ITL ++  DF+S L D+N ID     ++NQ R EDIT++E FG
Sbjct:    1 MFYAQLFTSKRGTLAKIWLAAHWEKKITKAHVFECDLETTIKEILSPQIKIGLRTSGHLLLGVVRIYSRKTRYLLADCSDALVKIKVAFRPGQTDLPDDAMEAT-LKTITLPEDFTDFDSQLPDLNTIDVVDHFSLNQCRTEDITLKENFG 150          

HSP 2 Score: 51.9878 bits (123), Expect = 2.933e-6
Identity = 31/88 (35.23%), Postives = 54/88 (61.36%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLF 1348
            F L P+  +    ++   RKRKL+ID  K + +  ++ Q+ D S+I + L++APPTR+LM W+E+G V+ L ++    +    L++LF
Sbjct:  257 FALAPVSATPCSAKKRKVRKRKLVIDRSKQLTNSAIRDQLADCSDILSPLEIAPPTRQLMEWRESGGVKQLISSFCLPVLHPDLKQLF 344          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Xenopus
Match: RAD21 (RAD21 cohesin complex component [Source:NCBI gene;Acc:100492023])

HSP 1 Score: 219.935 bits (559), Expect = 3.595e-63
Identity = 110/170 (64.71%), Postives = 134/170 (78.82%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE    N+ + D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENRE--AAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQ-DNDFGDFGMDD 167          

HSP 2 Score: 87.4261 bits (215), Expect = 1.348e-17
Identity = 45/92 (48.91%), Postives = 60/92 (65.22%), Query Frame = 2
Query: 1034 PQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTP 1309
            P  T QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P
Sbjct:  286 PTMTDQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLP 374          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Xenopus
Match: RAD21 (RAD21 cohesin complex component [Source:NCBI gene;Acc:100492023])

HSP 1 Score: 221.861 bits (564), Expect = 7.441e-62
Identity = 110/170 (64.71%), Postives = 134/170 (78.82%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE    N+ + D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQ-DNDFGDFGMDD 167          

HSP 2 Score: 94.7449 bits (234), Expect = 1.959e-19
Identity = 62/140 (44.29%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 1034 PQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            P  T QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:  286 PTMTDQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRLLKLFTRCL-TPLVPEDL--------KKRRKGGEADNLDE 413          

HSP 3 Score: 53.9138 bits (128), Expect = 1.287e-6
Identity = 27/66 (40.91%), Postives = 42/66 (63.64%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  505 KRTQQMLHGLQRVLAKTGAESISLLDLCRNTNRKQAAAKFYSFLVLKKQQAIELTQAEPYSDIIAT 570          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Xenopus
Match: RAD21 (RAD21 cohesin complex component [Source:NCBI gene;Acc:100492023])

HSP 1 Score: 222.246 bits (565), Expect = 1.867e-61
Identity = 110/170 (64.71%), Postives = 134/170 (78.82%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE    N+ + D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQ-DNDFGDFGMDD 167          

HSP 2 Score: 94.7449 bits (234), Expect = 2.642e-19
Identity = 62/140 (44.29%), Postives = 81/140 (57.86%), Query Frame = 2
Query: 1034 PQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            P  T QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:  286 PTMTDQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRLLKLFTRCL-TPLVPEDL--------KKRRKGGEADNLDE 413          

HSP 3 Score: 53.5286 bits (127), Expect = 1.444e-6
Identity = 27/66 (40.91%), Postives = 42/66 (63.64%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  558 KRTQQMLHGLQRVLAKTGAESISLLDLCRNTNRKQAAAKFYSFLVLKKQQAIELTQAEPYSDIIAT 623          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Mouse
Match: Rad21 (RAD21 cohesin complex component [Source:MGI Symbol;Acc:MGI:108016])

HSP 1 Score: 268.47 bits (685), Expect = 3.426e-78
Identity = 196/484 (40.50%), Postives = 262/484 (54.13%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD------------STFED------GGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD            S FED          + ++EP    S    NE   HL  E   +D+  G           ++S++   +F + PP++      SE G ++          EQ   D + + +N S+ G +S      ++   TM D   L    EE  ++E   P D+T                                  ++E +   KR  KL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF  P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDDREIMREGSAFEDDDMLVSTSASNLLLEPEQ--STSNLNEKMNHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDD-PPAL------SEAGVMLP---------EQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALE---PIDIT----------------------------------VKETKAKRKR--KLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFFLPAQPLWNNRLLKLFTRCL-TPLVPEDL--------RKRRKGGEADNLDE 415          

HSP 2 Score: 58.151 bits (139), Expect = 3.989e-8
Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+ A+ + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ QE PYS+II T
Sbjct:  562 KRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIAT 627          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Mouse
Match: Rad21 (RAD21 cohesin complex component [Source:MGI Symbol;Acc:MGI:108016])

HSP 1 Score: 213.386 bits (542), Expect = 6.998e-64
Identity = 105/161 (65.22%), Postives = 129/161 (80.12%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDD 538
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQEND 159          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Mouse
Match: Rad21l (RAD21-like (S. pombe) [Source:MGI Symbol;Acc:MGI:3652039])

HSP 1 Score: 189.504 bits (480), Expect = 6.828e-51
Identity = 94/165 (56.97%), Postives = 125/165 (75.76%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD 550
            MFY H ++SK+GPLA+IWLAAHW+KKLT++ VFE N+  +++ I+ PKVK+ALRTSGHLLLGVVRI++R+AKYLL+DC+EAF+K+KM FRPG  DL ++N     A   ITL +  HDFE  + +IN+ID    +A NQSRPE+IT+REE+    L +    FGD
Sbjct:    1 MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLLLGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFE--AAYNTITLPEEFHDFE--IYNINEIDISEPLAQNQSRPEEITLREEYSNDLLFQA-GSFGD 160          

HSP 2 Score: 53.1434 bits (126), Expect = 1.589e-6
Identity = 37/109 (33.94%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 1028 VPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYR 1354
            +P  + I  +   + +   F L PID  L    R  ++KR+LL+D  K I S  M  Q+    +    LDLAPPT++LM+WK+ G V+ L +T  + + +  L+ LF +
Sbjct:  257 IPEDEEINEITLLSNEDEGFTLDPID-DLDIADRRRRKKRRLLVDPVKEISSKAMHRQLASFMDTLMVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKMLFTK 364          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Mouse
Match: Rad21l (RAD21-like (S. pombe) [Source:MGI Symbol;Acc:MGI:3652039])

HSP 1 Score: 189.504 bits (480), Expect = 6.846e-51
Identity = 94/165 (56.97%), Postives = 125/165 (75.76%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD 550
            MFY H ++SK+GPLA+IWLAAHW+KKLT++ VFE N+  +++ I+ PKVK+ALRTSGHLLLGVVRI++R+AKYLL+DC+EAF+K+KM FRPG  DL ++N     A   ITL +  HDFE  + +IN+ID    +A NQSRPE+IT+REE+    L +    FGD
Sbjct:    1 MFYTHVLMSKRGPLAKIWLAAHWEKKLTKAHVFECNLEITIQKIISPKVKIALRTSGHLLLGVVRIYNRKAKYLLADCSEAFLKMKMTFRPGLVDLPKENFE--AAYNTITLPEEFHDFE--IYNINEIDISEPLAQNQSRPEEITLREEYSNDLLFQA-GSFGD 160          

HSP 2 Score: 53.1434 bits (126), Expect = 1.428e-6
Identity = 37/109 (33.94%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 1028 VPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYR 1354
            +P  + I  +   + +   F L PID  L    R  ++KR+LL+D  K I S  M  Q+    +    LDLAPPT++LM+WK+ G V+ L +T  + + +  L+ LF +
Sbjct:  254 IPEDEEINEITLLSNEDEGFTLDPID-DLDIADRRRRKKRRLLVDPVKEISSKAMHRQLASFMDTLMVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKMLFTK 361          
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Match: sp|Q3SWX9|RAD21_BOVIN (Double-strand-break repair protein rad21 homolog OS=Bos taurus OX=9913 GN=RAD21 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 6.159e-84
Identity = 204/484 (42.15%), Postives = 268/484 (55.37%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD------------STFED------GGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD            S FED       G  + ++EP    S    NE   HL  E   +D+  G           ++S++   +F + PP++      SE G ++          EQ   D + + +N S+ G +S   DS                           DP         E  P  T QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDDREIMREGSAFEDDDMLASTGASNLLLEPEQ--STSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDD-PPAL------SEAGVMLP---------EQPAHDDMDEDDNVSMGGPDSP--DSV--------------------------DP--------VEPMPTMTDQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCL-TPLVPEDL--------RKRRKGGEADNLDE 415          

HSP 2 Score: 58.151 bits (139), Expect = 2.875e-7
Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+ A+ + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ QE PYS+II T
Sbjct:  557 KRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIAT 622          
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Match: sp|O60216|RAD21_HUMAN (Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2)

HSP 1 Score: 269.626 bits (688), Expect = 8.726e-78
Identity = 197/485 (40.62%), Postives = 263/485 (54.23%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD------------STFEDGGDRDFVVEPITID-------SMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD            S FED    D +V   T +       S    NE   HL  E   +D+  G           ++S++   +F + PP++      SE G ++          EQ   D + + +N S+ G +S      ++   TM D   L    EE  ++E   P D+T                                  ++E +   KR  KL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDDREIMREGSAFEDD---DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDD-PPAL------SEAGVMLP---------EQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALE---PIDIT----------------------------------VKETKAKRKR--KLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCL-TPLVPEDL--------RKRRKGGEADNLDE 415          

HSP 2 Score: 58.151 bits (139), Expect = 3.082e-7
Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+ A+ + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ QE PYS+II T
Sbjct:  558 KRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIAT 623          
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Match: sp|Q61550|RAD21_MOUSE (Double-strand-break repair protein rad21 homolog OS=Mus musculus OX=10090 GN=Rad21 PE=1 SV=3)

HSP 1 Score: 268.47 bits (685), Expect = 2.396e-77
Identity = 196/484 (40.50%), Postives = 262/484 (54.13%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGD------------STFED------GGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDE 1450
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE G  ++ + ++DFGD            S FED          + ++EP    S    NE   HL  E   +D+  G           ++S++   +F + PP++      SE G ++          EQ   D + + +N S+ G +S      ++   TM D   L    EE  ++E   P D+T                                  ++E +   KR  KL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF  P + + +  L KLF R + T  VP D           RR GG   NLDE
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQ-ENDFGDFGMDDREIMREGSAFEDDDMLVSTSASNLLLEPEQ--STSNLNEKMNHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDD-PPAL------SEAGVMLP---------EQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALE---PIDIT----------------------------------VKETKAKRKR--KLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFFLPAQPLWNNRLLKLFTRCL-TPLVPEDL--------RKRRKGGEADNLDE 415          

HSP 2 Score: 58.151 bits (139), Expect = 2.791e-7
Identity = 29/66 (43.94%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+ A+ + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ QE PYS+II T
Sbjct:  562 KRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIAT 627          
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Match: sp|Q6TEL1|RA21A_DANRE (Double-strand-break repair protein rad21 homolog A OS=Danio rerio OX=7955 GN=rad21a PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 3.724e-61
Identity = 112/170 (65.88%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  +L   D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNISLMT-DNDFGDFGMDD 167          

HSP 2 Score: 92.4337 bits (228), Expect = 6.766e-18
Identity = 59/144 (40.97%), Postives = 83/144 (57.64%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEQQE 1471
            QT QT   P      F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG  +  ED +++ E
Sbjct:  291 QTEQTTLVPNED-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNGRLLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEDFLKELE 422          

HSP 3 Score: 55.0694 bits (131), Expect = 2.789e-6
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNII 2470
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +++ Q  PYS+II
Sbjct:  570 KRTQQMLHGLQRVVAKTGAQSISLLELCRNNNKKQAAAKFYSFLVLKKQQAIDLTQTEPYSDII 633          
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Match: sp|O93310|RAD21_XENLA (Double-strand-break repair protein rad21 homolog OS=Xenopus laevis OX=8355 GN=rad21 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.549e-60
Identity = 110/170 (64.71%), Postives = 134/170 (78.82%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID     ++NQSR E+ITMREE    N+ + D+DFGD   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIICPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVSNINILQ-DNDFGDFGMDD 167          

HSP 2 Score: 92.0485 bits (227), Expect = 9.411e-18
Identity = 65/171 (38.01%), Postives = 94/171 (54.97%), Query Frame = 2
Query: 1034 PQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFL-NLDEDVIE-------QQEVNQLACINETAIERRAH 1522
            P  T QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L KLF R +  + +     D L      RR GG   NLDE + E       ++E+     I++  +E  +H
Sbjct:  286 PTMTDQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNTRLLKLFTRCLTPLVL-----DDL----RKRRKGGEADNLDEFLKEFENPEVPREELRPQDVIDQPILEEASH 444          

HSP 3 Score: 53.5286 bits (127), Expect = 9.066e-6
Identity = 26/66 (39.39%), Postives = 42/66 (63.64%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  + N+KQAA+KFY+ L+L KQ+ +E+ Q  PYS+I+ T
Sbjct:  556 KRTQQMLHGLQRVLAKTGAESISLLDLCRNTNRKQAAAKFYSFLVLKKQQAIELTQREPYSDIVAT 621          
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Match: B4LQE4 (Uncharacterized protein OS=Drosophila virilis OX=7244 GN=Dvir\GJ13343 PE=4 SV=2)

HSP 1 Score: 304.294 bits (778), Expect = 4.466e-87
Identity = 192/451 (42.57%), Postives = 259/451 (57.43%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFE-----------DGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVP 1378
            MFY H +L+KKGPLARIWLAAHWDKK+T++ VFETNI  SVE IL+PKVKLALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG     + HR+   + AITL +  HDF++ L ++NDID     +VNQSR ++ITMRE++G  +L   DD FGD  FE            G   D + +   + ++   N+ ++ +T+     D   G+       S    +    ++F E P +VG++   +E  +  DY DD G +    F +  S A++ + S A+ +      + N    D      V        L+   D+T+ Q  +                   F L PID +  +     KRKRKL+IDE K+I  + MK Q+ DTS+I T LDLAPPT++LM WKETG VE LF  P R IP+RVL   + R + + S P
Sbjct:    1 MFYEHIILAKKGPLARIWLAAHWDKKITKAHVFETNIEKSVEGILQPKVKLALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGMVDLPEGHRE-ANVNAITLPEVFHDFDTALPELNDIDIEAQFSVNQSRADEITMREDYGSLSLSLQDDGFGDIGFEADTPEMMRGPMSGNINDQLFDDDVLANVVESNDPNITITQSEMPSDRLDGDG---FGDSFGQPTLFEDDLFGEPPQTVGINTEINEANNPPDYSDDDGID---NFNNAPSPASSCANSVADDK------EDNFPAKDHNFNEDVNASGGDAALN---DLTLVQNDD-----------------EGFALAPIDATTYKGATKAKRKRKLIIDEIKNISGEEMKAQLADTSDILTTLDLAPPTKRLMYWKETGGVEKLFALPSRTIPARVLLNNYNRQLLSHSTP 418          
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Match: A0A195EY40 (Double-strand-break repair protein rad21 like protein OS=Trachymyrmex septentrionalis OX=34720 GN=ALC56_12700 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.699e-84
Identity = 198/474 (41.77%), Postives = 259/474 (54.64%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREE------------FGE-------PNLGR------PDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMP------PSVGLDNNESEFGDVM----DYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTIS 1372
            MFYAHFVL+KKGPLARIWLAAHWDKKLT++ VFETNI  SV+ IL+PKVK+ALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG  DL E+ HR+  A+ AITL +  HDF++ + ++ D+D     ++NQSR E+ITMRE+            FG+       P L R      P  D     F DG   +  +E    + + G +     +  +   +D+G G                   +F E P      P V   N + E G V        D+S E++   F    S     S  G+      +  ++    + V      P   +  E H      +  + E PP Q   TL     +   F L PID S  +     KRKRKL++DE K+I  + MK Q+ DTS+I T LDLAPPT++LM WKETG VE LF  PGR IP+RVL K + R++ + S
Sbjct:    1 MFYAHFVLAKKGPLARIWLAAHWDKKLTKAHVFETNIEKSVDGILQPKVKMALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGMVDLPEE-HRE-AAVTAITLPEVFHDFDTAMPELKDVDIEAQFSLNQSRAEEITMREDYGSLSLVTHDQGFGDMSFDAEPPELLRHGSGMEPSLDQSHMLFSDGPGIEAALEQKEKEPVAGTSATTQPMDIDTPIRDDGFGG---HLGQDIISGGLFEGGLFDEAPMGEVPVPEVSSINEQQEMGAVAGTAASVHDESDEDMGDHFGGPASPMGGMSSDGSRPATPAAVGEEIEGRISVASRRFTPAPPVIPEEH-----AIDNIEEPPPMQDQTTLLHDEEE--SFALAPIDASALKGFTKAKRKRKLIVDEVKNISGEEMKAQLSDTSDIITTLDLAPPTKRLMHWKETGGVEKLFALPGRPIPARVLFKNYQRHLTSKS 462          

HSP 2 Score: 62.003 bits (149), Expect = 6.998e-6
Identity = 32/85 (37.65%), Postives = 52/85 (61.18%), Query Frame = 2
Query: 2222 DQQLDKINEEYPVEITQEGLEKRSEIMLSVLKNAINQEGKVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            +QQ+D+  E++   +    L KR+  M  V+K+ ++ + K+    +   NN+KQ A KFYTLL+L K + LE+ QE  Y+ II+T
Sbjct:  687 EQQMDETYEQFEERV----LNKRAAHMYHVIKSKLDTKDKLTLSEMAFKNNRKQVAQKFYTLLVLKKFQVLELNQEYSYAEIIVT 767          
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Match: A0A448X9R8 (Rad21_Rec8_N domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS25241 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 6.757e-84
Identity = 134/176 (76.14%), Postives = 159/176 (90.34%), Query Frame = 2
Query:   56 SVMFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRD 580
             +MFYAHFVLSKKGPLARIWLAAHWDKKLTR+ VFETNI+SSVEAILEPK+K+ALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG  DL ++ +R+  A+AAITL +N+H+FE+T+AD+N+I+   IA+NQSRPEDITMR++FGE NLGR DDDFGDSTF+D   RD
Sbjct:    4 CIMFYAHFVLSKKGPLARIWLAAHWDKKLTRAHVFETNISSSVEAILEPKLKMALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGVVDLPDEANRE-AAIAAITLPENIHEFETTIADLNEINMNTIAINQSRPEDITMRDDFGEINLGRQDDDFGDSTFDDISGRD 178          
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Match: A0A2H1C6R0 (Rad21 / Rec8 like protein (Fragment) OS=Fasciola hepatica OX=6192 GN=D915_10661 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.768e-83
Identity = 134/178 (75.28%), Postives = 159/178 (89.33%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVE 592
            MFYAHFVLSKKGPLARIWLAAHWDKKLTR+ VFETNI+SSVEAILEPK+K+ALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG  DL ++ +R+  A+AAITL +N+HDFE+T+AD+N+I+   IA+NQSRPEDITMRE+FGE NLGR DDDFGDS F++   R+ + E
Sbjct:    1 MFYAHFVLSKKGPLARIWLAAHWDKKLTRAHVFETNISSSVEAILEPKLKMALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGVVDLPDEANRE-AAIAAITLPENIHDFEATIADLNEINMNTIAINQSRPEDITMREDFGEINLGRQDDDFGDSAFDEASSREVLRE 177          
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Match: A0A183L688 (Rad21_Rec8_N domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS22856 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 5.458e-83
Identity = 133/176 (75.57%), Postives = 158/176 (89.77%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFV 586
            MFYAHFVLSKKGPLARIWLAAHWDKKLTR+ VFETNI+SSVEAILEPK+K+ALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG  DL ++ +R+  A+AAITL +N+HDFE+T+AD+N+I+   IA+NQSRPEDITMRE+FGE NLGR DDDFGDS F++   R+ +
Sbjct:    1 MFYAHFVLSKKGPLARIWLAAHWDKKLTRAHVFETNISSSVEAILEPKLKMALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGVVDLPDEANRE-AAIAAITLPENIHDFEATIADLNEINMNTIAINQSRPEDITMREDFGEINLGRQDDDFGDSAFDEVSSREMI 175          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Match: rad21a (double-strand-break repair protein rad21 homolog [Source:NCBI gene;Acc:103039334])

HSP 1 Score: 223.016 bits (567), Expect = 3.000e-62
Identity = 119/203 (58.62%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVE--PITIDSMDGPNEIDLHLTEELG 658
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  ++   D+DFGD   +   DR+ + E     +D + G +  +L L  E G
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNLSI-MADNDFGDFGMD---DREIMREESAFEVDIIHGSSASNLLLEAEPG 197          

HSP 2 Score: 93.2041 bits (230), Expect = 4.492e-19
Identity = 67/192 (34.90%), Postives = 104/192 (54.17%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGG-------FLNLDE--DVIEQQEVNQLA-CINETAIERRAHDLSHINEVSEGGDCLEEHAMP 1585
            QT QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  + K+F R +  +      PD L      RR GG       FL   E  +V  ++++ Q +  I++T +E  +  +  ++ +      L+E  MP
Sbjct:  288 QTEQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRMLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEEFLKELENPEVPREEQITQRSDVIDQTIVEEPS--MLQVSSIEGSRTALDETLMP 465          

HSP 3 Score: 58.151 bits (139), Expect = 3.884e-8
Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  527 KRTQQMLHGLQRVVAKTGAQSISLLELCKNNNKKQAAAKFYSFLVLKKQQAVELSQSEPYSDIIAT 592          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Match: rad21a (double-strand-break repair protein rad21 homolog [Source:NCBI gene;Acc:103039334])

HSP 1 Score: 223.787 bits (569), Expect = 3.429e-62
Identity = 119/203 (58.62%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVE--PITIDSMDGPNEIDLHLTEELG 658
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  ++   D+DFGD   +   DR+ + E     +D + G +  +L L  E G
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNLSI-MADNDFGDFGMD---DREIMREESAFEVDIIHGSSASNLLLEAEPG 197          

HSP 2 Score: 93.2041 bits (230), Expect = 4.936e-19
Identity = 67/192 (34.90%), Postives = 104/192 (54.17%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGG-------FLNLDE--DVIEQQEVNQLA-CINETAIERRAHDLSHINEVSEGGDCLEEHAMP 1585
            QT QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  + K+F R +  +      PD L      RR GG       FL   E  +V  ++++ Q +  I++T +E  +  +  ++ +      L+E  MP
Sbjct:  289 QTEQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRMLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEEFLKELENPEVPREEQITQRSDVIDQTIVEEPS--MLQVSSIEGSRTALDETLMP 466          

HSP 3 Score: 58.151 bits (139), Expect = 3.693e-8
Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  564 KRTQQMLHGLQRVVAKTGAQSISLLELCKNNNKKQAAAKFYSFLVLKKQQAVELSQSEPYSDIIAT 629          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Match: rad21a (double-strand-break repair protein rad21 homolog [Source:NCBI gene;Acc:103039334])

HSP 1 Score: 223.787 bits (569), Expect = 3.429e-62
Identity = 119/203 (58.62%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVE--PITIDSMDGPNEIDLHLTEELG 658
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL EDN     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  ++   D+DFGD   +   DR+ + E     +D + G +  +L L  E G
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEDNR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREEVGNLSI-MADNDFGDFGMD---DREIMREESAFEVDIIHGSSASNLLLEAEPG 197          

HSP 2 Score: 93.2041 bits (230), Expect = 4.936e-19
Identity = 67/192 (34.90%), Postives = 104/192 (54.17%), Query Frame = 2
Query: 1040 QTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGG-------FLNLDE--DVIEQQEVNQLA-CINETAIERRAHDLSHINEVSEGGDCLEEHAMP 1585
            QT QT   P  +   F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  + K+F R +  +      PD L      RR GG       FL   E  +V  ++++ Q +  I++T +E  +  +  ++ +      L+E  MP
Sbjct:  289 QTEQTTLVPNEE-EAFALEPIDITVKETKA--KRKRKLIVDSLKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRMLKMFTRCLTPL-----VPDEL----RKRRKGGEADSLEEFLKELENPEVPREEQITQRSDVIDQTIVEEPS--MLQVSSIEGSRTALDETLMP 466          

HSP 3 Score: 58.151 bits (139), Expect = 3.693e-8
Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  564 KRTQQMLHGLQRVVAKTGAQSISLLELCKNNNKKQAAAKFYSFLVLKKQQAVELSQSEPYSDIIAT 629          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Match: rad21b (RAD21 cohesin complex component [Source:NCBI gene;Acc:103023059])

HSP 1 Score: 221.861 bits (564), Expect = 1.584e-61
Identity = 110/170 (64.71%), Postives = 133/170 (78.24%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFED 565
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID      +NQSR E+ITMREE G  NL + ++DF D   +D
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFCLNQSRVEEITMREEVGNLNLLQ-ENDFADFGMDD 167          

HSP 2 Score: 90.8929 bits (224), Expect = 2.306e-18
Identity = 44/92 (47.83%), Postives = 63/92 (68.48%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +
Sbjct:  308 FALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNSRLLKMFTRCL 397          

HSP 3 Score: 58.5362 bits (140), Expect = 2.805e-8
Identity = 30/66 (45.45%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  I + G   +    L  +NNKKQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  563 KRTQQMLHGLQRVIAKTGAESISLLELCKNNNKKQAAAKFYSFLVLKKQQAVELTQAEPYSDIIAT 628          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Match: rad21l1 (double-strand-break repair protein rad21-like protein 1 [Source:NCBI gene;Acc:103030832])

HSP 1 Score: 172.17 bits (435), Expect = 4.174e-45
Identity = 88/164 (53.66%), Postives = 113/164 (68.90%), Query Frame = 2
Query:   65 FYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFGEPNLGRPDDDFGD 550
            F+ H   SK+G LARIWLAAHW+KK+T++ VFE N+ ++V  I+ P+V + LRTSGHLLLGVVRI+SR+AKYLL+DCN+A VKIK+AFRPG  DL   N        AITL +   DF+  L D+N ID     ++NQ R E+IT++E FG   L    DD GD
Sbjct:    3 FFTHLFTSKRGSLARIWLAAHWEKKITKAHVFECNLENTVNDIISPQVTIGLRTSGHLLLGVVRIYSRKAKYLLADCNDAVVKIKVAFRPGQTDLP--NEGMEAMFKAITLPEEFSDFDLQLPDLNTIDIVDHFSLNQCRTEEITLKENFGNSFLSM--DDMGD 162          

HSP 2 Score: 78.9518 bits (193), Expect = 9.775e-15
Identity = 49/144 (34.03%), Postives = 74/144 (51.39%), Query Frame = 2
Query:  986 LHDPADMTMTQLAEVPPQQTI-QTLQAPARQLP------------------QFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            L+D  D    +L   PP   I  T+Q PA  +P                   F L P+  +    R+   RKRKL++D+ K + ++ ++ Q+ +TS+I T LD+APPTR+LM WKE G V+ LF+     +    LQKL  R++
Sbjct:  207 LNDSEDNLSNELPATPPPTAINSTVQEPAVLIPLTETPTMNETTLLDNTNEGFALEPVAATPTSERKRGSRKRKLVVDQSKELSNEAIRAQLANTSDILTSLDIAPPTRQLMDWKEKGGVDYLFSHFCVPVIHTGLQKLILRDV 350          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Sea Lamprey
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 215.698 bits (548), Expect = 7.457e-60
Identity = 105/152 (69.08%), Postives = 123/152 (80.92%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFG 511
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+SR+AKYLL+DCNEAFVKIKMAFRPG  DL E+N     A  AITL +  HDF+  L D+ DID      +NQSR E+ITMRE+ G
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYSRKAKYLLADCNEAFVKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLGDIDVAQQFTLNQSRLEEITMREDVG 150          

HSP 2 Score: 88.9669 bits (219), Expect = 2.082e-18
Identity = 44/95 (46.32%), Postives = 64/95 (67.37%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTI 1369
            F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKE+G VE LF+ P + + +  L KLF R +  +
Sbjct:  307 FALEPIDITVKEIKA--KRKRKLIVDSLKELDSKTIRSQLSDYSDILTTLDLAPPTKKLMMWKESGGVEKLFSLPAQPLWNSQLLKLFSRCLAPV 399          

HSP 3 Score: 51.2174 bits (121), Expect = 1.149e-6
Identity = 24/66 (36.36%), Postives = 41/66 (62.12%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   V    L   NN+KQA +KFY+ L+L KQ+ +++ Q+ P+ +I+ T
Sbjct:  589 KRTQQMLHALQRVLAKTGADSVSLLDLCRRNNRKQATAKFYSFLVLKKQQAIDLRQDAPFGDIVAT 654          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Sea Lamprey
Match: RAD21 (RAD21 cohesin complex component [Source:HGNC Symbol;Acc:HGNC:9811])

HSP 1 Score: 86.2705 bits (212), Expect = 5.348e-18
Identity = 44/92 (47.83%), Postives = 61/92 (66.30%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            F L PID ++  N    KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLMLWKETG V+ L++ P + + S  L +LF R +
Sbjct:   75 FALEPIDVTV--NVTKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTSLDLAPPTKKLMLWKETGGVDKLYSLPAQPLWSSRLLRLFTRCL 164          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Yeast
Match: MCD1 (Essential alpha-kleisin subunit of the cohesin complex; required for sister chromatid cohesion in mitosis and meiosis; apoptosis induces cleavage and translocation of a C-terminal fragment to mitochondria; expression peaks in S phase [Source:SGD;Acc:S000002161])

HSP 1 Score: 73.1738 bits (178), Expect = 9.593e-14
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 2
Query:   86 SKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPK---------VKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTA 376
            + KGPLA+IWLA++    + R  V +T+I  S + I +             + LRTSG LL G+VR++S+QA +LL+D  +   KI M F+    +T   +R NT 
Sbjct:   16 TNKGPLAQIWLASNM-SNIPRGSVIQTHIAESAKEIAKASGCDDESGDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTV 120          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Nematostella
Match: EDO38394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY1])

HSP 1 Score: 205.682 bits (522), Expect = 7.040e-57
Identity = 102/179 (56.98%), Postives = 135/179 (75.42%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYG-IAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVE 592
            MFY  F+L+KKGP+AR+WLAAHW+KKL++S VFET+I SSVE+I+ PK+K+ALRTSGHLLLGVVRI+SR+AKYLL+DC+EAFVKIKMAFRPG  DL ED      A AAITL +   D + TL ++ND++      +NQSR E+ITM+E+    +    D+ FGD  F+  G+++ + E
Sbjct:    1 MFYHTFILAKKGPMARVWLAAHWEKKLSKSVVFETDIKSSVESIVSPKMKMALRTSGHLLLGVVRIYSRKAKYLLADCSEAFVKIKMAFRPGVVDLPEDGRE--LAFAAITLPEAFTDLDMTLPELNDVEIQAQFTLNQSRIEEITMKEDLVVNHHLLGDEGFGDIPFDQDGEKEILRE 177          

HSP 2 Score: 51.2174 bits (121), Expect = 1.515e-6
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEGKVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT-----HVAC 2488
            KR+  +LS LK   N++  V  + L   N +KQAA KFY+ LLL K   + + Q++ + NI+++      VAC
Sbjct:  488 KRTHQLLSALKKEFNKKNTVCLNSLVQKNTRKQAAYKFYSCLLLYKDNSVSLSQKDLFGNIMVSKGPHFEVAC 560          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Medaka
Match: rad21 (RAD21 cohesin complex component [Source:NCBI gene;Acc:100049255])

HSP 1 Score: 222.631 bits (566), Expect = 8.121e-62
Identity = 119/203 (58.62%), Postives = 147/203 (72.41%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITI--DSMDGPNEIDLHLTEELG 658
            MFYAHFVLSK+GPLA+IWLAAHWDKKLT++ VFE N+ SSVE+I+ PKVK+ALRTSGHLLLGVVRI+ R+AKYLL+DCNEAF+KIKMAFRPG  DL E+N     A  AITL +  HDF+  L D++DID      +NQSR E+ITMRE+ G  +L + D DFGD   +   DR+ + +  T   D + GP   +L L  E G
Sbjct:    1 MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENR--EAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFTLNQSRVEEITMREDVGNLSLLQ-DTDFGDFGMD---DREMMRDASTFEEDIIHGPTASNLLLEAEPG 197          

HSP 2 Score: 91.2781 bits (225), Expect = 1.620e-18
Identity = 51/116 (43.97%), Postives = 71/116 (61.21%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGG 1432
            F L PID +++E +   KRKRKL++D  K + S  ++ Q+ D S+I T LDLAPPT+KLM+WKETG VE LF+ P + + +  L K+F R +  +      PD L      RR GG
Sbjct:  302 FALEPIDITVKETKA--KRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNARLLKMFTRCLTPL-----VPDEL----RKRRKGG 406          

HSP 3 Score: 56.225 bits (134), Expect = 1.270e-7
Identity = 29/66 (43.94%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2285 KRSEIMLSVLKNAINQEG--KVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYSNIIIT 2476
            KR++ ML  L+  + + G   V    L  +NN+KQAA+KFY+ L+L KQ+ +E+ Q  PYS+II T
Sbjct:  563 KRTQQMLHGLQRVMAKTGADSVSLLDLCRNNNRKQAAAKFYSFLVLKKQQAIEVTQSQPYSDIIAT 628          
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Medaka
Match: rad21l1 (double-strand-break repair protein rad21-like protein 1 [Source:NCBI gene;Acc:101173147])

HSP 1 Score: 162.155 bits (409), Expect = 9.955e-42
Identity = 83/160 (51.88%), Postives = 107/160 (66.88%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPG-ADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID-PYGIAVNQSRPEDITMREEFGEPNLGRPD 535
            MFY H   SK+G LA+IWLAAHW+KKLT+  VFE N+ ++V  IL PK+K+ LRTSGHLL+G+VRI+SR+AKYLL+DC  A  KI  AFRPG  DL     R    +  ITL+++   F+  L    DID P   A+NQ R E+IT++E+FG   L   D
Sbjct:    1 MFYTHLFTSKRGSLAKIWLAAHWEKKLTKPHVFECNLETTVREILSPKMKVGLRTSGHLLIGLVRIYSRKAKYLLADCTIALGKISTAFRPGQTDLCLG--RVEATVKEITLTEDFTAFDVELPHPCDIDIPEDFALNQCRSEEITLKEDFGNGFLNLTD 158          

HSP 2 Score: 75.8702 bits (185), Expect = 8.581e-14
Identity = 35/92 (38.04%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1085 FVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNM 1360
            F L P+  +    +R  KRKRKL++D  K + +DV++ Q+ D S++   LD+APPT +LM WKE+G+V  LF+ P        + +L+ +N+
Sbjct:  256 FALEPVAITPNSEKRVGKRKRKLVVDHAKELSNDVIREQLSDFSDLVAALDMAPPTVQLMHWKESGSVSKLFSQPCSTGLGPPISQLYVKNI 347          
BLAST of Double-strand-break repair protein rad21-like protein vs. Planmine SMEST
Match: SMESG000003044.1 (SMESG000003044.1)

HSP 1 Score: 1343.95 bits (3477), Expect = 0.000e+0
Identity = 711/718 (99.03%), Postives = 714/718 (99.44%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEQQEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGXXXXXXXXXXXXXXTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPXXXXXXXXXXXXXXXFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQTAMV 2215
            MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDN HGNAQSSASPSTTVVSHHHHNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDVLELTTVPEEELSMELHDPADMTMTQL EVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIE+QEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGSPRPLSSVLRLSESTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPSLSSAATAAVAGSAAFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQ + +
Sbjct:    1 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNAHGNAQSSASPSTTVVSHHHHNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDVLELTTVPEEELSMELHDPADMTMTQLVEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEEQEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGSPRPLSSVLRLSESTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPSLSSAATAAVAGSAAFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQVSSI 718          
BLAST of Double-strand-break repair protein rad21-like protein vs. Planmine SMEST
Match: SMESG000003065.1 (SMESG000003065.1)

HSP 1 Score: 1337.78 bits (3461), Expect = 0.000e+0
Identity = 709/718 (98.75%), Postives = 713/718 (99.30%), Query Frame = 2
Query:   62 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGKQDNGHGNAQXXXXXXXXXXXXXXXNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDXXXXXXXXXXXXSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEQQEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGXXXXXXXXXXXXXXTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPXXXXXXXXXXXXXXXFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQTAMV 2215
            MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADIND+DPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMD PNEIDLHLTEEL KQDN HGNAQSSASPSTTVVSHHHHNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDVLELTTVPEEELSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIE+QEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGSPRPLSSVLRLSESTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPSLSSAATAAVAGSAAFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQ + +
Sbjct:    1 MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDMDPYGIAVNQSRPEDITMREEFGEPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDEPNEIDLHLTEELRKQDNAHGNAQSSASPSTTVVSHHHHNVFPEMPPSVGLDNNESEFGDVMDYDDDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDVLELTTVPEEELSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRSLRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKLMLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIPGVRRIGGFLNLDEDVIEEQEVNQLACINETAIERRAHDLSHINEVSEGGDCLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARSNIGSPRPLSSVLRLSESTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDSDNVQIKPSLSSAATAAVAGSAAFDQSALPDEINQFSTGQQDISMGTGLSFSSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNELLSNEAETQLNKLQVSSI 718          
BLAST of Double-strand-break repair protein rad21-like protein vs. Planmine SMEST
Match: SMESG000041612.1 (SMESG000041612.1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.220e-6
Identity = 42/173 (24.28%), Postives = 83/173 (47.98%), Query Frame = 2
Query:   59 VMFYAHFVLSKKGPLARIWLAA-HWDKKLTRSQVFETNITSSVEAILE-----PKVKLALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNHRDNTALAAITLSDNMHDFESTLADINDID----------PYGIA-VNQSRPEDITMRE-EFGEPNL 523
            + F +  ++ K+G    IWLAA   +K LT+  +   ++  +   I++      K+KL+L  S  L  G+  I+ ++   LL+D  + + K  + F     + +   RD   L  +++ D+  +   +   + +++             IA +NQ+R EDITM E ++G+ N+
Sbjct:    1 MFFSSDLLIFKRGKFNLIWLAATRGEKYLTKKDLNMVDLHHACSEIMDYVLRHQKIKLSLYLSSQLTFGLCVIYHKKIDKLLNDLQDLYKKSLVTFTCRCSIAKKG-RDKHNLTMVSILDDFGEINDSFGVLKNLENNHEGTDMDLTNQIAYLNQARFEDITMMEYDYGQNNI 172          
The following BLAST results are available for this feature:
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAD211.817e-7840.62RAD21 cohesin complex component [Source:HGNC Symbo... [more]
RAD217.594e-6564.12RAD21 cohesin complex component [Source:HGNC Symbo... [more]
RAD211.097e-6464.12RAD21 cohesin complex component [Source:HGNC Symbo... [more]
RAD218.262e-5570.63RAD21 cohesin complex component [Source:HGNC Symbo... [more]
RAD216.978e-5473.11RAD21 cohesin complex component [Source:HGNC Symbo... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
coh-16.828e-4348.52COHesin family [Source:UniProtKB/TrEMBL;Acc:A0A13... [more]
scc-15.280e-3947.93Sister chromatid cohesion protein 1 [Source:UniPr... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vtd5.324e-6364.88gene:FBgn0260987 transcript:FBtr0344093[more]
vtd6.571e-6364.88gene:FBgn0260987 transcript:FBtr0113746[more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad21a4.933e-6265.88RAD21 cohesin complex component a [Source:NCBI gen... [more]
rad21a4.933e-6265.88RAD21 cohesin complex component a [Source:NCBI gen... [more]
rad21b2.677e-6064.12RAD21 cohesin complex component b [Source:ZFIN;Acc... [more]
rad21b2.677e-6064.12RAD21 cohesin complex component b [Source:ZFIN;Acc... [more]
rad21l11.241e-4553.64RAD21 cohesin complex component like 1 [Source:ZFI... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RAD213.595e-6364.71RAD21 cohesin complex component [Source:NCBI gene;... [more]
RAD217.441e-6264.71RAD21 cohesin complex component [Source:NCBI gene;... [more]
RAD211.867e-6164.71RAD21 cohesin complex component [Source:NCBI gene;... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Rad213.426e-7840.50RAD21 cohesin complex component [Source:MGI Symbol... [more]
Rad216.998e-6465.22RAD21 cohesin complex component [Source:MGI Symbol... [more]
Rad21l6.828e-5156.97RAD21-like (S. pombe) [Source:MGI Symbol;Acc:MGI:3... [more]
Rad21l6.846e-5156.97RAD21-like (S. pombe) [Source:MGI Symbol;Acc:MGI:3... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SWX9|RAD21_BOVIN6.159e-8442.15Double-strand-break repair protein rad21 homolog O... [more]
sp|O60216|RAD21_HUMAN8.726e-7840.62Double-strand-break repair protein rad21 homolog O... [more]
sp|Q61550|RAD21_MOUSE2.396e-7740.50Double-strand-break repair protein rad21 homolog O... [more]
sp|Q6TEL1|RA21A_DANRE3.724e-6165.88Double-strand-break repair protein rad21 homolog A... [more]
sp|O93310|RAD21_XENLA2.549e-6064.71Double-strand-break repair protein rad21 homolog O... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B4LQE44.466e-8742.57Uncharacterized protein OS=Drosophila virilis OX=7... [more]
A0A195EY402.699e-8441.77Double-strand-break repair protein rad21 like prot... [more]
A0A448X9R86.757e-8476.14Rad21_Rec8_N domain-containing protein OS=Protopol... [more]
A0A2H1C6R01.768e-8375.28Rad21 / Rec8 like protein (Fragment) OS=Fasciola h... [more]
A0A183L6885.458e-8375.57Rad21_Rec8_N domain-containing protein OS=Schistos... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rad21a3.000e-6258.62double-strand-break repair protein rad21 homolog [... [more]
rad21a3.429e-6258.62double-strand-break repair protein rad21 homolog [... [more]
rad21a3.429e-6258.62double-strand-break repair protein rad21 homolog [... [more]
rad21b1.584e-6164.71RAD21 cohesin complex component [Source:NCBI gene;... [more]
rad21l14.174e-4553.66double-strand-break repair protein rad21-like prot... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
RAD217.457e-6069.08RAD21 cohesin complex component [Source:HGNC Symbo... [more]
RAD215.348e-1847.83RAD21 cohesin complex component [Source:HGNC Symbo... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MCD19.593e-1436.79Essential alpha-kleisin subunit of the cohesin com... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383947.040e-5756.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rad218.121e-6258.62RAD21 cohesin complex component [Source:NCBI gene;... [more]
rad21l19.955e-4251.88double-strand-break repair protein rad21-like prot... [more]
back to top
BLAST of Double-strand-break repair protein rad21-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000003044.10.000e+099.03SMESG000003044.1[more]
SMESG000003065.10.000e+098.75SMESG000003065.1[more]
SMESG000041612.12.220e-624.28SMESG000041612.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006361 ID=SMED30006361|Name=Double-strand-break repair protein rad21-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2822bp
TTTGAATTTTTGAATTAATTTTATTGTAGAATATTAAAATTTGAAAATTT
GAAAAAGTGTTATGTTCTATGCTCATTTTGTTTTAAGTAAAAAAGGTCCT
CTTGCCAGAATATGGTTAGCTGCACATTGGGATAAAAAATTGACTCGTTC
ACAAGTGTTTGAAACAAATATTACATCTAGCGTTGAAGCTATTTTAGAAC
CAAAGGTAAAATTAGCTTTAAGGACAAGTGGGCATCTTTTGTTGGGGGTT
GTAAGAATTCACTCTCGACAAGCTAAATATTTGCTGTCAGATTGCAATGA
AGCTTTCGTTAAAATTAAAATGGCTTTCCGACCAGGAGCAGATTTGACCG
AAGATAATCATCGAGATAATACTGCATTAGCAGCAATTACTCTGTCAGAC
AATATGCATGATTTTGAAAGCACTCTCGCAGACATTAATGATATAGATCC
CTATGGAATAGCTGTTAATCAGAGTCGGCCTGAGGATATTACCATGCGCG
AAGAATTCGGTGAACCGAACTTAGGCCGACCTGATGATGATTTTGGGGAT
TCAACGTTTGAAGATGGTGGAGATCGGGATTTTGTGGTAGAACCGATAAC
GATTGATTCTATGGATGGACCTAATGAAATCGATCTGCATTTGACTGAAG
AACTCGGAAAGCAAGACAATGGTCATGGAAACGCACAATCATCTGCATCT
CCATCAACAACAGTGGTGAGTCACCATCATCATAATGTGTTTCCGGAAAT
GCCACCAAGTGTGGGATTGGACAATAATGAGTCGGAATTTGGGGATGTCA
TGGATTATGATGATGATTCGGGGGAAAATCTTGAACAAATGTTCCAGGAT
ACGGTGAGTCAGGCCAACAACGAATCAGTGAGTGGGGCCGAGTCCAGGTT
AATTGATAGCACCATCGATCAGAACAACACAATGGTCGATGTGCTAGAAC
TGACCACCGTGCCAGAGGAAGAGTTGAGCATGGAATTACACGATCCAGCC
GATATGACGATGACGCAGCTGGCTGAAGTGCCACCACAGCAAACAATTCA
GACCTTACAGGCCCCGGCTAGACAATTACCACAATTTGTGTTGCCACCAA
TCGATCGATCATTGCGAGAAAATCGACGCGCTCCGAAACGGAAGAGGAAA
CTGCTGATTGATGAACACAAAAGCATCCCGAGTGACGTGATGAAGATGCA
AATGCAAGACACAAGTGAAATCACTACGAGACTCGATTTGGCTCCCCCAA
CACGGAAACTAATGCTTTGGAAGGAAACTGGGAATGTCGAGGCGTTATTT
ACGACTCCTGGGCGCGCCATTCCGTCACGAGTTCTACAGAAACTGTTCTA
TCGCAACATGAGGACGATTTCTGTGCCCAATGATGCACCAGATGGGCTGC
CAGTGATCCCAGGAGTGAGGAGGATTGGAGGATTTCTGAATCTCGATGAA
GATGTCATTGAGCAACAGGAGGTCAACCAGTTGGCTTGCATTAATGAGAC
CGCAATCGAACGGCGGGCTCATGATTTGAGCCACATCAATGAAGTCAGTG
AAGGTGGTGACTGTCTCGAGGAGCATGCAATGCCGGCGGGGGCTTGTAGC
ACGTATTCCGCTAATTATGACTGCTGGAGTGGGGGCCACGCTACTCCTCA
TCGTGATGACGATGAGCTCGATGTCGGATTCAATCCGATGACTCCAGTGC
GAGCCCGATCGAATATTGGATCGCCCAGGCCGTTATCATCCGTGTTGCGA
CTATCAGAATCCACAAGCCTGCCATACGCACCCGCATTACAACTTCAGGC
AAATGGAGCATTCCAACAACATAGTGTGACAGCTGTAGACCAGAACATGT
TCTATGATTCTGATAATGTACAGATCAAACCATCATTATCATCTGCGGCA
ACAGCAGCAGTAGCTGGATCAGCAGCATTTGACCAATCAGCGTTACCAGA
TGAAATCAACCAGTTTTCGACGGGCCAGCAGGATATTTCCATGGGAACCG
GACTGTCTTTCAGCAGCAACATTACAGATGGAACGCAATCAGTTGAACGT
ATTAGAAAAGACATGTCTAATTTGGGCAGTGGTTACTCAGACAGCTTAAG
CGGAGCAGCATTAAACAACAGCCTCGACATAACAATGGGAAGTGAGTTTC
TGCCCAATGAGCTATTGTCCAATGAGGCCGAAACTCAACTGAATAAATTA
CAGACGGCAATGGTGACGCTGGACCAGCAATTGGACAAGATCAATGAGGA
GTACCCAGTTGAGATCACCCAGGAGGGGCTGGAGAAGCGTTCTGAGATCA
TGCTCAGTGTGCTCAAGAATGCTATCAACCAAGAGGGCAAAGTTGATTTC
CACCATCTCACAGTCAGCAATAACAAGAAGCAGGCCGCATCGAAATTCTA
CACGCTGTTGCTACTGGGAAAGCAGAAGAAGCTGGAAATGTTCCAAGAAA
ACCCTTATTCCAATATCATAATCACCCATGTCGCGTGTGACGGATGATTT
ATGATGAAATACCATTTTCACTGTCAATGAGTCAATTGAATGTCTAGATG
TATTATTGTATAACGATGTTGATGATGCTGATGATTATATTTATATTTTA
AGCCATTTGGCCCGATTCGACACATTTCTGTATTAATAAATAACTTTGTG
TTCTATCTTTGATACGTGTATATTTACAATTTATGTGTTATCTCCGTTCC
TGTTGGTTCACGACAATGCCAACGGAGCTTTCGTAGTTATGCAGTGTATT
TGGTAATTTTTATTTATTATTCATTGAGTCTTGAAATGTTTAGTGACTGA
TTTATTTTTTATTTCTTTTTTG
back to top

protein sequence of SMED30006361-orf-1

>SMED30006361-orf-1 ID=SMED30006361-orf-1|Name=SMED30006361-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=812bp
MFYAHFVLSKKGPLARIWLAAHWDKKLTRSQVFETNITSSVEAILEPKVK
LALRTSGHLLLGVVRIHSRQAKYLLSDCNEAFVKIKMAFRPGADLTEDNH
RDNTALAAITLSDNMHDFESTLADINDIDPYGIAVNQSRPEDITMREEFG
EPNLGRPDDDFGDSTFEDGGDRDFVVEPITIDSMDGPNEIDLHLTEELGK
QDNGHGNAQSSASPSTTVVSHHHHNVFPEMPPSVGLDNNESEFGDVMDYD
DDSGENLEQMFQDTVSQANNESVSGAESRLIDSTIDQNNTMVDVLELTTV
PEEELSMELHDPADMTMTQLAEVPPQQTIQTLQAPARQLPQFVLPPIDRS
LRENRRAPKRKRKLLIDEHKSIPSDVMKMQMQDTSEITTRLDLAPPTRKL
MLWKETGNVEALFTTPGRAIPSRVLQKLFYRNMRTISVPNDAPDGLPVIP
GVRRIGGFLNLDEDVIEQQEVNQLACINETAIERRAHDLSHINEVSEGGD
CLEEHAMPAGACSTYSANYDCWSGGHATPHRDDDELDVGFNPMTPVRARS
NIGSPRPLSSVLRLSESTSLPYAPALQLQANGAFQQHSVTAVDQNMFYDS
DNVQIKPSLSSAATAAVAGSAAFDQSALPDEINQFSTGQQDISMGTGLSF
SSNITDGTQSVERIRKDMSNLGSGYSDSLSGAALNNSLDITMGSEFLPNE
LLSNEAETQLNKLQTAMVTLDQQLDKINEEYPVEITQEGLEKRSEIMLSV
LKNAINQEGKVDFHHLTVSNNKKQAASKFYTLLLLGKQKKLEMFQENPYS
NIIITHVACDG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007062sister chromatid cohesion
Vocabulary: cellular component
TermDefinition
GO:0008278cohesin complex
GO:0000228nuclear chromosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006909Rad21/Rec8_C_eu
IPR006910Rad21_Rec8_N
IPR023093Rad21/Rec8_C
IPR011991WHTH_DNA-bd_dom
IPR002861Reeler_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding