dynein heavy chain 5, axonemal

Overview
Namedynein heavy chain 5, axonemal
Smed IDSMED30006343
Uniprot Best hitDynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3 (E=9.56664e-55)
Length (bp)9728
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006343SMESG000049144.1 SmedASXL_018345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006343SMESG000049144.1 dd_Smed_v6_4569_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30006343SMESG000049144.1 dd_Smed_v6_4569_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30006343SMESG000049144.1 dd_Smed_v4_4569_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH5 (dynein axonemal heavy chain 5 [Source:HGNC Symbol;Acc:HGNC:2950])

HSP 1 Score: 4427.08 bits (11481), Expect = 0.000e+0
Identity = 2181/3042 (71.70%), Postives = 2547/3042 (83.73%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSED--IVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS +S+DKIF +IG GHYC +RGF++EVR  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSR+WQGM+NT  +VI     LL LWKHEC RVI+DRF    D++WF K L   + E+  E+  ++    +   D +F+DF+RDA EA GE  ++ D + PK+YEPI SF  LK+RL MF  LYNESIRGAGMDMVFF DAM HL+KISR+IRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +L  +MKKE+PR  PTN+NL +YF+SR +QNLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+L+S++I C+  +KKE++  MG   DGVAE CVDYFQRFRR THVTPKSYLSF+ GYK IY EK      LA RM++GL+KL EA ESVA L + L  KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKD+AQ+IV+ I +DK IAE KLEAA+PAL EAE AL TI+P+DIATVR LGRPPHLIMRIMDCVL+ FQR++  +  D E++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLE+NFIK GSTFKVKVGDKEVDV+ GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  LMEDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TE++INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++  ++K EEF T IKGGASLD+    PKP  WI D+TWLNLVELS L QFS VLDQ+SRNEK W+ WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GEK+AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL LD+M+ELMD +IETE++HD FRLW+TTE H +FPI+ LQMSIKF N+PPQG++AG+KRTY+  +QD LD+S+  QW+PM+YAVA+LH+ VQERRKFG LGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW TI YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD S GG ETRE+VV R+ DDML KLP DYV FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLAIDGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTELIERNSQF++W+F GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E    RD     Y CP+YKKP RTDL +IA+V LR   T   +HW LR VALLCD+K
Sbjct: 1598 NRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGI---DTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRD--PRFYSCPIYKKPVRTDLNYIAAVDLRTAQT--PEHWVLRGVALLCDVK 4624          

HSP 2 Score: 218.009 bits (554), Expect = 1.992e-55
Identity = 102/152 (67.11%), Postives = 119/152 (78.29%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD
Sbjct: 1425 TVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGD 1576          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4214.45 bits (10929), Expect = 0.000e+0
Identity = 2076/3052 (68.02%), Postives = 2503/3052 (82.01%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1453 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4490          

HSP 2 Score: 224.557 bits (571), Expect = 2.241e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1291 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1441          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 4214.07 bits (10928), Expect = 0.000e+0
Identity = 2076/3052 (68.02%), Postives = 2503/3052 (82.01%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1670 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4707          

HSP 2 Score: 224.172 bits (570), Expect = 2.621e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1508 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1658          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH8 (dynein axonemal heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:2952])

HSP 1 Score: 3469.86 bits (8996), Expect = 0.000e+0
Identity = 1726/2506 (68.87%), Postives = 2071/2506 (82.64%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLM 7942
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+
Sbjct: 1670 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLI 4169          

HSP 2 Score: 224.942 bits (572), Expect = 1.554e-57
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1508 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1658          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1868.2 bits (4838), Expect = 0.000e+0
Identity = 1113/3082 (36.11%), Postives = 1754/3082 (56.91%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQY--ETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFT-NSFPDIYRYSIQYLIYKMETL-EAFVVRQACDLLEGLIPRKDEKDSSQISRIH-------------YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIK-LDLPKIEKDSED------TMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQ--RMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNF-IKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLH--QFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--MSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQ-DEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9565
            PF + +      LS   E+IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F NIDK + +IM    ++  + +CC     LS L        + CQKSL  YL+ KR  FPRFFF+SD  LL ILG +SDP  +Q H++ ++DNI +++F++     + + A  S EGE +E  K ++AE  VE W+  +LN  +R+   + + A     +    V +++ +Y   V L   Q+ WT +  +    A K +++ M+    +    ++ L+ + T  L K +R K+ T++ I VH +DI D  ++  +    +FDW  Q RFY+  + D   +      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MD+R +G+IF GL+Q G+WGCFDEFNRID  VLSV + QI  + +    +   F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF++   LA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +    E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP+   A+ + ++E      P  V K++Q+FET   RH  M +GP+  GK+  I+ L +A T  G   +   +NPKA++  +++G LD +T DWTDG+ S ++R   K   K E  +++ DG VDA+W+EN+NSV+DDN+ LTLANG+RI +   C ++FEV ++  ASPATVSR GMVY+    L + P  K W+     N+ P  +E +  NS  +      +Y+ Y M+ + E  V  +  + L+ ++P+ D    +Q++++               E  ++ ++  S+GA L  + R K + YI+   ++  +D   +  +  +      T++D+   ++  +WV W+  V EYI+  +   ++ +ILV  VD  RT +++  +   ++ V+ +GE GT+KT     +L + + E ++   +NFSS T     QR +E+ V+KR   TYGPP G+++ VF+DD+NMP ++E+G Q    +++ LLE    Y+  K  +  +I D+ F+AAM   GGGRN++  R    F +FN   PS  S+  I+S I  GH      F++ +  +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G++ T  +       ++ +W++EC RV  DR +   D     + +   + E   +D+     V      F DF     E  GE         P++YE I  ++  K   +     YNES     M++V F DA+ HL ++ RIIR  RG+ALLVGVGGSGKQ+L++LA++ A  ++F+I L+R Y+ ++  EDLK LY   G + K + FLFTD  + +EGFLE +NN+L+SG+V  LF+ +E + I  ++     K+     P  +++ +YF++++  NLH+VL  SP+G+  R     FPG+++   +DWF  WP  AL AVA  +L    ++ A  ++  ++  + +VH  V      + Q+ RR  +VTPK+YL F+  Y  +  EK     N+AQ  R+D GL KL EA   + EL + LAE++  LA  +   E +L+ + V    A E K   +    + +   + I  +K  AE+ L    P L  A+  L  +  +D+  +R   +PP  +  + +C+LI        M G  E N     W  +  +MS+  FL +L+    D+I +  V+ I   L+  + T +    V     G+L +  A+M + ++ +E+ P ++ + + +  +  +  +L   Q+ L   QKEL  + A Y+ A+ +KQ L ++AE   R++ AA +LI GL  E +RW N   E   +  +L+GD L   AFLSY G F  EFR+ ++N  WQ ++  R+IP S    +  +LTD   +  W  QGLP DELSVQNGI+ T+ASR+PL IDPQ Q   WIK +E +  L+V S N   F + LE S+  G P L  D+ E +DP +DNVLEKN  + QG  F + +GDKEVD    F LY+ TKL NP Y+P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR  L+++   NK  +K+LED+LL  L ++ G+++D+ DL+  L+ TK  + EVS+KL +A  T + I+  R+ YRP A RG+IL+F++ EM+LVN MYQ SL  FL +F LS+ +S    +  KR++NI++ +T+ ++ +   GL+E  K+ F+  M +K++   G++  EE   F+KG  SL+ +  + KP AW++D  W +++ LS +    F  + D V  N+  W++W+D ++ E+  +P GY+ N+  F++LL++RC+  DR       Y+  ++GEK+ +  ++  + +FE+S P +P+V +LS GSDP   +  LA++        + ++MGQGQE  + +L+   +  G W++LQNCHL + ++++L   +      H DFRLW+TT+    FPI  LQ S+K   EPP G+K  ++ TY   + + LD      ++P+VY +A+ H  VQERRKFG +GWN+ Y++N +D    ++ +  +L     ++   + W ++ Y++GE+ YGGR  D +D+R+L  +   +  D   D F P F FF+    D+ IP   +  ++++ I  LP  ++PE+FGLH NA+I Y ++ A+ +   +L +QP+   +  G +R+  + ++  ++  K+P  +   +V +RL     L P ++ L QE++R  K++ ++  +L +L+ A+ G + M+ +L D   S++   IP+           +LG W    + R SQ+  W+ +  P+  W++G    + +LTA+ Q   R + GW LD   L+  VTK    DE+N+   +G +V GLYLEGA WD     LI+SK KVL   LP++ I  I      E  R  L+N ++ PVY    R +     L F A ++     T+   HW L+ V L
Sbjct: 1573 PFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEK-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISAEGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRV-DWMLLYQGMVVLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNTVLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQF-EGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKTLAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMFETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWV-----NQIPNKVEQYNLNSLFE------KYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFDNKRNQWVPWSKLVPEYIHAPER--KFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNEVDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTST---FHESIVAVSGKLTFCTLALYKNIVQDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDV---EVVMRDPILFGDFQMALHE--GE---------PRIYEDIQDYEAAKALFQEILEEYNES--NTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQ--GMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIEN-VVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQ--CNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILI--------MKGYKELN-----WKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQF-IILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKS-KRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQP-FHFFRNKEVDYKIPVGDEKEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRLGTG--LSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEPSVMWLSGLHIPESYLTALVQATCRKN-GWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPI------EAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLF----TTRHISHWVLQGVCL 4584          

HSP 2 Score: 58.9214 bits (141), Expect = 2.675e-7
Identity = 33/123 (26.83%), Postives = 63/123 (51.22%), Query Frame = 3
Query:   27 LWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEW 395
            LW +++++ +   +  F    RKLP+ ++       L   +  F   +PLL  + N A++ RHW+ + + TS  F++ ++ F L N+    L K  + + +I  +A+KE  IE  +K +   W
Sbjct: 1403 LWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYYLEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEM-TETFTLENMFAMELHKHTDVLNEIVTAAIKEVAIEKAVKEILDTW 1524          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1125.54 bits (2910), Expect = 0.000e+0
Identity = 873/3107 (28.10%), Postives = 1513/3107 (48.70%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXX----XXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWF-NDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9220
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++ L  K     ++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct:  539 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 3540          

HSP 2 Score: 56.225 bits (134), Expect = 6.134e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct:  386 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 522          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1125.54 bits (2910), Expect = 0.000e+0
Identity = 872/3107 (28.07%), Postives = 1513/3107 (48.70%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXX----XXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWF-NDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9220
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++       E +++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 4472          

HSP 2 Score: 56.225 bits (134), Expect = 6.165e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct: 1318 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 1454          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 1125.54 bits (2910), Expect = 0.000e+0
Identity = 872/3107 (28.07%), Postives = 1513/3107 (48.70%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVG-GDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAES-NVEIWLMGLLNMAQRSLHGVIRAANNSIND------TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYF----VEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKR---------ANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISH-------PPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC----GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGE---HIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWL--------------------------------LKRNSNERPIMLELFTNSFPD-IYRYSIQYLIYKMETL---------------EAFVVRQACDLLEGLIPRKDEKDSSQISRIH--YERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRM---GSTYGP-PAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVIT-----NAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKM-FEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRP----PTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFE------------------IVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXX----XXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGN-KKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVT--QKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGK-------------------IKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEE--VIPDGYNTNLD----TFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFE-------ESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIH-SRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKG--------MSWKTICYMLGEIQYGGRVTDDYDKRLL-----NTFCRRWF-NDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSF---EVME-RLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPN----CFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVL 9220
            ++A +   Y   F++  Q    KL+  + + + W+ VQ  WVYLE +F G  +I+  LP E+ RF+ I    + +M +   +  +L   V  +   +LL  L + L   QK+L  YLE++R  FPRF+FV D  LLEI+G + D   IQ HL  +F  I  +  +E+   +I A +S EGE ++L K V  +   +  WL  L    + +L   + A+    +       T  + +E+L+ +PAQV  L  ++ W  +  + L + K    +     +  +  L LL      +   + R K E LIT  VH++D   +LV  K+++ +DF WL+  RFYF    V+ V  C+V + +  F Y  E+LG  ERLV TPLTDRCY+T+ QAL   +GG+P GPAGTGKTE+VK +G  LG++V+VFNC +  DF+ +GRI  GL Q G+WGCFDEFNR++  +LS  +QQI  +    +      V   G  +++N   GIF+TMNPGY+GR  LP+NLK  FR++AM  PDRQ+I +V L S GF     LA K   L+ LC+EQL+ Q HYDFGLR +  VL + G  KR         A     EQ  +++ + +  + KLV++D  L  SL++D+FPGI        EL   ++   DE L+I           W+ K++QL++   + HG+M +G SG+GKT    VL+KAL       G  H    ++ KA++   ++G +D +T +WTDG+F+++ R+ +   +GE     W++ DG VD  W+ENLNSVLDDNK LTL NG+R+ + P+ +IIFEV ++  A+ ATVSR GMV+ S   +    L + +L                                 +    +R   L L T+  PD I   S++Y + ++E +                ++ +R+     EGLI      DS +I +I     R  + +++W+     + + R  +  +IR    I L       + +  + DY V  +G+W  W SKV   +  +        ++VP +D VR + L+    ++ K ++L G  G+ KT+ +   L S+  E  +  ++NFSS+T P +  RT + + + R    G    P    + + +F D+IN+P  +++G Q     +RQL+E+ GFY       + ++  +QF+ A   P   GR+ +  R  R   I     P  +S+ +I+                   QL   ++ +      L   +      + HYV++ R+L+R  +G+     + IT     +A+ L+ LW HE  R+  DR V  E+  W  K +             + ++ +  +A  +D      EA  + P      + + Y P+   ++L+D +    +G Y E +    + +V F   + H+L+I RI R  +G+ LL+G  G+GK TL++  +++ G  +FQ+ +   Y  ++  ED++ + R AG + + + F+  +  + D GFLE +N +L++G V  LF  DE   +  ++     KE  +R      ++D L ++F  +  +NLHVV   +P G   R RA   P L + C ++WF  W ++AL  V      + +                  +   P  +  ++ ++ +VH  V +      ++  R    TP+ +L F+  + S++ EK          ++ GL K+ E +E V EL++       E +++   AN + +E+L     Q+ A  E K   Q+ K+ A+ + +  E+ K   E+ L   EPA+ EA+ A+  IK + +  V+ +  PP  +   ++ + I     + T             W    ++M  + F+  ++ F  + +  E ++ +  Y++  D+  D   R       ++ W RA + +  +  +V PL++ L + +    K  ++       + E ++ +GK +  Y + + + + +  D  + + K+  + EL+  L  E+ RW++ S+ F  Q+D LVGD L ++AFL+Y G ++Q  R+ +   W   +    + F   L  I+ L+      +W L  LP D+L  +N I++ + +RYPL+IDP GQ   +I  + A K +Q TS   + FR++LE +L  G  LL++D+ E  DP L+ VL +   + G    + +GD+++D+   F++++ T+     ++P+I +R + ++FTVT   L  Q L  V+++E+ +++ +R  L++ +QG    +++ LE  LL  L  +KG ++DD  +I+ L+  K  +AEV+QK         ++++   +Y+ ++T  S +Y  + +++ ++ +Y  SL   + +F   +   + S  T   KR++ I   +   V++   RG+  +DK+   LL+ +++ +R+                      K +E  + I GG  LD   V+ K           ++ +   +  F  V   +  N      W   + PE    V+ D  +  L         L++V    PDR ++ A + +  +  + F     +  DKV +       E  P  P++   + G D +  IE LA +   +  +I++G  +  + +   +     +G WVLL+N HL+  ++ +L ++ + +   H  FRL++T EIHPK P S L+ S     EP  G+KA + R+ +S     L  +   + R +   V +LH  VQER ++ PLGW+  YE++ ADL  +   +   +D   + +G        + W T+  +L +  YGG++ + +D+ LL     N F  + F  D +  PK+        P +SK ++ I  + EL N   P   GL +NA+    +K  +S+L  +L +   D      E  +  V       LG+L   ++     E+++ R  +  I  P+  F  +EV+   +++  +R  L ++          N + R    S+    +P+           T+  W T+L ER  Q       G  N     FW+ G F+ + ++TA RQ+V +A+  W+L+ + L
Sbjct: 1471 LSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDV-VNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEED-RSITAFHSREGEKVDLVKIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENV----EQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHV---IDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYLSIIRRVPLDSDSAISFSSSSAPVNLIGEDAKPTRSIEIQRTAALALQTHFSPDGIVPGSLKYAVSELEHIMPPTPQRLLSSFFSMMSYSIRKIVSHDEGLI-----DDSVEIDQIQSFVLRSMLTNLVWAFSGDGKWKSREMMSDFIRQATTISL-----PPNQQACLIDYEVQLSGDWQPWLSKVPT-MEIESHRVAAADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTLLAALRSQQ-EMEVV-NVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHS-WVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQLTNAMVDV-----YLASQEHFTQDDQPHYVYSPRELTRWVRGI----SEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVD------------TTAERYFGNACRLD------EAL-KRPLLYSCWLSRNYVPVTR-EELQDYVSARLKGFYEEEL---DVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQI-----KEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGD---QQKAEEEKKFSEQLQKELAEQLKQMAEK-KTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGT------------DWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLK-LQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL-MRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGG--LDFLTVENKK----------SIAKARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHF-----MQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQL-EKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSR-LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVD--AVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV--TDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIR--IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANT-WSLEQLNL 4472          

HSP 2 Score: 56.225 bits (134), Expect = 6.165e-7
Identity = 33/139 (23.74%), Postives = 71/139 (51.08%), Query Frame = 3
Query:   30 WGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELL 446
            W  V   KI   L E  N+ ++LP   + + ++E +++ +  +  M  L+  + + A+K RHW +M      ++++ SD   L  + +A +L+ +  I+ I + A  E  +E  L+ ++  W  +E+    ++N+  L+
Sbjct: 1318 WLSVQPRKIRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMKEMRVNWNL-SD-LTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNKTRLI 1454          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 835/3102 (26.92%), Postives = 1432/3102 (46.16%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVR-TDFLMNTVASQEKAVLLI-GEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKR--MGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFY--NLEKPGDFTNIVDMQFMAAMIHPG-GGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGT--GHYCKERG-FNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEE-PDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLK-----ISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVH-DGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTID--VARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRY---EKSMEDLNAAQSVLDEKQKELG-KVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKN--------REAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIK-INSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRN-----EKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKF--RFFKDHSIPAVSKLNEYIDIINE-LPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRE------SVVYRMC--DDMLGK-LPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTI--IMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESK-SKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALL 9568
            +S  ++ + +S  Y   F        ++L++    + Q   +Q  W+YLE +F  G     LP EA RFS +D  +  I++   ++  ++  C   ++L + L  +++QL  CQK+L  +LE+KR  FPRF+F+ D  LLEILGQ+++P  IQ+H+  +F  I  V+F     ETI++  S EGE + L K V+    VE WL  L +  +R+L  +   A   + D + +    L  YP+QV  L  ++ ++  S E  +N  SD       + +  LL  L          KV   K ++LI   +H  D+ DQL+ ++ KS + + W +Q RFY V      ++     +F Y  E+ G   +LV TPLTD+CY+TL QA+ M +GG P GPAGTGKTE+VK +   +G+ V+VFNC + +D   +GRIF G+ + G+WGCFDEFNR+D  VLS  + QI  +    K R     F  G  V +NP   IF+T+NP   GY GRQ++P+NLK  FR V M  PD ++I    L S GF+D   LARK  ++++L  + L+KQ HYD+GLR +  VL   G  +R      E   V++ L    LSKL   D   F SLI+D+F  +  +   + EL   +     E  I      + K+ QL+E  R R G++ +G +G+GK+    +L ++L    +P +  + NPKA+   ++ G +D+ T +W+DGI +   R   K     H W+V DG +D  W+E LNSVLDDN+ LT+ +G+RI    +   +FE  ++  ASPATVSR GM+Y+S   +    ++  WL+K   +    M       F   +R       +K+  + +F +     L  GL   K  K  +Q           F V+   G L  +    + E + +      + +P  +    D   D ++S   + V  N   EE +  +D  P      V   D  R +D + + + S  +   LI G  G  K  ++ K+    +PE  +      + ++   + Q   ++ V      G  + P     M +F+  IN+P  +++G      +++QLL  +GF+  NLE    + +I ++QF+ +M   G G    I  RL   F +  C   + +   ++ SI  T      +E G  N E+  +   ++ I  ++    +    PT +   ++F+ RDL+     ++  + D       L  +   E  R+ +DR     D   F         E++  +++  SQ  ET    + F       TG   P +++  +P    PI   D        F  L  +SI     ++  F   +T  L      I R++  P G+  L G  G G++   +L +++   ++F   +T +++      +LK     A    + +  +  D +++   FL+ +N++L+SG V  LF + E+D +       +  E   +      LQ++   R +  +HVVL        F+    + P ++  C + +  R+ +++L+ +             P ++ E   S G+   D +     D          + P  Y  F+  +  +   K    S   +R+  G+ KL EA++ VA++++   +K K LA    EA+E LK +T   + A + K  ++ +K   +     IE  K   + +L+  +P + EA  A+ +IK   ++ +R L  PP  +  I+  VL+F    LDT            SW    K +S +   ++++NF  + I  E  + ++  ++ +  + +   A+R     A L +W +A + + +I +++ PL+    K        EK ME+L+     +DE   EL  K + +  EA + K  L  + +T R   T    L         RW  Q   F  +  ++    L  +AF++Y G  +++ R  L  S  K       P    L+   + T+      W  +GLP D+LS++NG I+  +   PL+ID  GQ  +++          + AQ +L             +E ++  G+ ++I+DI E  D AL  +L K+   QG    +  G K +D    F++Y  T+       P  + + +I++FT T+  L  QLL + I  EK ELE +   L+ D +  K +++ LE  LL +L S++G+L+++  L+  L  +K  SAE+  K I+ S+   K + + ++ Y P++   S L+F    +   N MY  S+   + LF  ++   +    T  R++ +   M   V+ +  RG++  D++ F +        +  + K  E  T +    S D++ ++         + W++   L +L +    L  +  N     +  W + F K    E   P      +  F+++L ++   P+R  +    ++  +L          +   +F+ES    P++ +L+ G+DP+  +   A    V   +ISMGQGQEI +   +      G W+ L N HL L  +  +   +  T   H++FRLW+TTE   +FP   LQ S+K T EPP G++  + RTYT  ++   ++         ++ +A+LH  +QERR F P GW   YE+  +D+  +  FV+     +   K   W+ +  +L  + YGGR+ +D+D ++L+++    F D+  N +   +  K   + A + + EYI  I++ +P+ D P +FGL  N   ++Q   A   +  I  +   D      +  +      S+  ++C  DD+  + LP+   S + +  +  +  +  +++   +++ R    +AK   T      A+  TI  ++ +   D  DSM+      +         T G    +L E +   S       P  F  +  F    FL A+RQ  +R  K   LD ++L +  T         P  + V V GL L+GA +D   S L E+  S   +   P++      ++   E S  +     Q PVY    R+DL  I SV + C   + AD W + AVAL 
Sbjct: 1265 DSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRG----ALPSEASRFSRVDSEYRAILNDVSKDARLVSLC-SRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTG-ETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQA---VADAQPS----LAKYPSQVLCLAEEVKFSA-SIENNLNGSSD-----LNSFKSQLLEKLKAYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNG--GIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTF-GGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTNKNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTSVHH-WIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHF---WRCLKWVRSHKISGITSFAI-----LKNGLTHLKASKTKTQ-----------FLVLLFNGFLPTVTPENRQE-FAKGVVFQGMSVPDPKNICYDERIDGIMSYTDD-VSQNVTKEE-VEREDLRP-----FVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLL-KHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDHNLE----WVSIENIQFVGSMNPIGDGAAVSISNRL---FSLLRCVSLNTTDSSQLTSIYRTYLTPILEEVGERNSEI--IANRMVDIYNKV----QSNFRPTDSVV-FLFSPRDLTNWVVSLLRHELD----QGKLEAVICFEARRIFADRLPTENDKLKF---------EEILRNVIPISQANET----VIFKEKVYVTTGTVVPGESNTGLP--LTPINMSD--------FNQLLAKSINRFAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVA-----LVSEAANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEI-------------PKIQME---SQGITTTDAILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGI-LDT------------SWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFE----RWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCKMFNMP--PTFKPLSFASLETEQL---NWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKSETFKAAQPDLMT----------QIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSK-ESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSST--RVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALR---------VQWISPDRLQSLARIRTHLPSLFNNFQIQDDATWNE-FSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLT-TPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVITCQS----IFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQ----LTANKA-DWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLI--KQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRG--TLQLFESSKSSSL---LSSPIDF--SDLFYPNIFLNALRQTTSRQIK-IPLDQLILSSAWTPS-----QLPAKQCVQVQGLLLQGATFD---SFLRETTVSSAAYSQAPIVF-----LAWTSESSSTITGEQIQVPVYSSSERSDL--ICSVNMPC---RGADQWNIAAVALF 4169          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 68.9366 bits (167), Expect = 8.281e-11
Identity = 76/282 (26.95%), Postives = 140/282 (49.65%), Query Frame = 2
Query: 5432 AANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELI-SPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQ----SSEFKAQIDRLVGDVLSATAF 6262
            AANE  NK      KAQS+  E       +E++L +A PAL  A +AL T+  +D+++++ +  PP+ +   M+ V I    +   +  +         W    KL+S+  FL  + +F +DT++++TV+LI   YL  E++  +  ++      GL  W  A+  + +I+K V P ++ L K +V  ++ ++ L   +  L +  ++L  +   + +  +KKQ L     +C  +M  A  L++ L+GEK +W N+    + E    +   VG  L+   F
Sbjct: 2182 AANE--NKANEAATKAQSLKAE-------SEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEI-GEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVF 2453          

HSP 2 Score: 67.0106 bits (162), Expect = 3.444e-10
Identity = 84/350 (24.00%), Postives = 150/350 (42.86%), Query Frame = 2
Query:  491 IQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVK---AESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVG--LLGIQLLWTRDST---EALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKF-ETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLG 1513
            I+  +  L N +  +  +      W  +E VF   DIA Q+P E + F  I   W+ I ++  E   +L+     + L+  L  L       +     YL KKR +FPR F +SD  +L ++  + +P   +S++  +F ++ T  F +     I++  S + E + L KPV    ++ +VE W+  L +  + +L   IR     +N     V   LN  P QV    L I   W  +++    +L    S+ KI  +  +  +L              K +R +F   L  I+     + ++L+ ++V    D+ W  Q R+Y+   ++   + +  V   Y  E  G
Sbjct:  811 IRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTT--FDQNTKMEIISV-STKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSPVETILN-EPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAVL-------------HKHDRWEFLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYW--HLENVFIRVGTVSTRYDYEVQG 1141          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309028)

HSP 1 Score: 3891.27 bits (10090), Expect = 0.000e+0
Identity = 1946/3075 (63.28%), Postives = 2397/3075 (77.95%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1632 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4692          

HSP 2 Score: 239.58 bits (610), Expect = 2.660e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1471 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1621          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309029)

HSP 1 Score: 3890.5 bits (10088), Expect = 0.000e+0
Identity = 1946/3075 (63.28%), Postives = 2397/3075 (77.95%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIP--RKDEKDSSQISRI----------------------HYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP  ++DE+  S  S+                       H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1640 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4700          

HSP 2 Score: 239.58 bits (610), Expect = 2.706e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1479 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1629          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0344344)

HSP 1 Score: 3883.18 bits (10069), Expect = 0.000e+0
Identity = 1947/3099 (62.83%), Postives = 2396/3099 (77.32%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1640 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4724          

HSP 2 Score: 239.58 bits (610), Expect = 2.780e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1479 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1629          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: CG9492 (gene:FBgn0037726 transcript:FBtr0309027)

HSP 1 Score: 3882.41 bits (10067), Expect = 0.000e+0
Identity = 1947/3099 (62.83%), Postives = 2396/3099 (77.32%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKD-------------------------------SSQI-----------------SRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PF+K IQ  V  LSNS+EI+E+W+ VQN+WVYLEAVFVGGDIAKQLPKEAKRFS IDKSW KIM RAHE   V+ CCVGD+ L QLLPHL EQLEICQKSL+GYLE+KR++FPRFFFVSDPALLEILGQASD HTIQ+HLL++FDN K+VKFH+ +Y  ++A  S EGE ++L++ ++AE +VE WL  LL  AQ SLH +IR A  +IND  F +L FL   PAQ+GLLGIQ++WTRD+  AL+  + +RK+M +TN +FL +LN LI QTT +L K ERT FETLITIHVHQ+DIFD L +  +KS +DF+WLKQ RFYF ED+D+  +S+TDV F YQNE+LGCT+RLVITPLTDRCYITLAQAL +SMGGAP GPAGTGKTETVKDMG+ L KYVVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQ+AVVL+ KKE++K F+FTDGD ++MNPEFGIF+TMNPGYAGR+ELPENLKI FR VAMMVPDRQIIIRVKLASCGF++NI LARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR N  DTE T VMRVLRDMNLSKL+D DEPLF+SL++DLFP   L+K  YPELEAAI +Q DEA ++ HPPWVLKLIQL+ETQ VRHG+MTLGPSGAGKT CIH LMKA+T  G+ HREMRMNPKAITA QMFGRLDV+TNDWTDGIFS LWR+TLK K GEH+WLVLDGPVD+IWIENLNSVLDDNKTLTLANGDR+ M+P+ KIIFE HNIDNASPATVSRNGMVYMSSS LD  P+++ WL  R   E+    +LF  +F ++Y + +Q +  +M  L+  +V+Q   +LEGLIP K E +                                SQI                 +  H  RLYIF++ W +G  L   DR ++  +++ +   +LD PK     E+T+FD+ VS  G W  W + V  Y+YP+ STP+Y SILVP VDNVR D+L+ T+A+QE+AV++IGEQGT KTV++  ++   N E +M +S NFSSAT P+ FQRTIES+V+KR+G T+GPP GRK+ VFIDDIN+P INEWGDQI NEIVRQ +++KGFY+LEKPGDFT IVD+Q++AAM  PGGGRNDIP RLKRQFC+FNC +P N SIDKIF +IG GHY  +RGF  E+R LV+ LI +TR LW  T+ K+LPTPAKFHYVF+LRDLSRIWQGM+ T   VIT+   L+ LWKHEC RV +DRF   +D  WF   L   + E+L +   S SQ+   +  F+DFMRDA E TGEE +DTD ++PKVYEP+ S + L++RL MF   +NE +RG+GMD+VFF DAM HL+KISRIIR PRG+ +LVGVGGSGKQ+LTKLAS+IAGYK FQI LTRSYN++N LEDLK LYRT G QGKG TFLFTD +IK+EGFLEY+NN+LSSGV+SNLF+RDE  EI QEL P+MK+E  R+  T +++ ++FL+RT  NLHV  CFSP+GE FR+R  +FP L+SGCT+DW   WPKDAL++VA H+LS FEI C P VK+EL+ ++G + D VAE   +YFQRFRR THVTPKSYL+F+ GYK+IY+ K     +  ++MD+GL+KL EA  SV  LK+ L   E+EL  A++ AE VL  VT +   A  VKN+V +VKDKA+++V  I  +K +AE KLEAA+PAL EAE+ALNTIKPA IATVRKLGRPPHLIMRIMDCVLI F+R+L     D     PKPSW ES+K+M++  FL  L N+PKDTIN+E ++L+ PY  MEDY +D+ARRVCG+VAGLLSWT+AM  F  +NKEVLPLK NLT Q+ R + +M+DL  A+  L E+++ L  V+  YD+A+ +KQ L D A  C RKMTAA  LI GL+ EK RWTNQS EFK Q+ +LVGDVL AT FLSYCGP+NQEFR  L  +W   L+ + IPF+T LNII+ML D + + EW+LQGLPNDELSVQN +I TK+S YPLL+DPQ QGKIWIK +E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+G +LDP +DNVLEKNFIK GS  KV VGDKE DVM GF LYITTKLPNP+++PE+ A+TSIIDFTVTM+GLEDQLLG VI  EK +LEA+R+ L E V  N++ MKELE NLL RL+S++GSLVDDE LI+VL+ TK T+ EV+QKL I+  TE KI  AREE+R VA RGSILYFLIVEMS VN MYQ SL+QFL +F+ S+++S KS VT++RI  I+  +TYEV+K+  R LYE  K  FTL++A+K+D   G I  EEF TFIKGGASLD+N V PKP  WI D+TWLNLVE+S L  FS VL  +  NEK WR W++ E PE E IP GYN  LD FR+LLL+R WCPDRT+SQAKKYI++SLG +++E  ILD ++++ ES PRTP V LLS+GSDPT  I  LAK+  +  +++SMGQGQE H+R+++   +  GGWVLLQN HLSL +  E++D ++E+E I D FR+WVTTE H +FPI  LQM++KFTNEPPQGI+A +KR+Y SF QDFLD ++  QW P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QF+QNHLD+MD KKG+SW+T+ YM+GE+QYGGRVTDD+DKRLL TF   WF + + +  F F+K + +P    L  +ID IN LP YD+PE+FGLHSNADITYQ  +A+ ILD IL++QPK+   GGGETRES+VY++ DDML KLP+ Y ++EV E L  MGIL PMNIFLRQE+DRMQ+VI +V T L DLKLAIDGTI+M+  L+++LD+MYDARIP +W K+SWES+TLGFW+TEL+ERN QF TW+   RP  FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL N +T++ +++I + P+EGVYV+GL+LEGA  DRR+ KLIESK KVL+E +PVI I AI+ +   +        +Y+CP+Y+KP+RTDL ++ S+        +  HWTLR VALLCDIK
Sbjct: 1632 DSLMVLGSLLSNRYNAPFRKQIQQWVYDLSNSNEILERWLLVQNMWVYLEAVFVGGDIAKQLPKEAKRFSKIDKSWQKIMQRAHETPGVVACCVGDDLLKQLLPHLQEQLEICQKSLSGYLERKRMMFPRFFFVSDPALLEILGQASDSHTIQNHLLNIFDNTKSVKFHDVEYNKMMAIISSEGEMIQLDRAIRAEGSVETWLTQLLVTAQASLHSIIRTAYATINDPNFTLLSFLEKAPAQIGLLGIQMVWTRDAEMALMRGR-ERKVMMETNNKFLEMLNTLIDQTTRNLTKRERTNFETLITIHVHQRDIFDILCRMNIKSANDFEWLKQCRFYFKEDLDKTWISVTDVTFTYQNEYLGCTDRLVITPLTDRCYITLAQALTLSMGGAPCGPAGTGKTETVKDMGKTLAKYVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQVAVVLTAKKEKRKTFLFTDGDTIEMNPEFGIFITMNPGYAGRKELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFLENITLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAAKRRNSKDTESTIVMRVLRDMNLSKLIDDDEPLFMSLVSDLFPNQTLEKTNYPELEAAILQQTDEASLVYHPPWVLKLIQLYETQHVRHGIMTLGPSGAGKTTCIHTLMKAMTQMGDNHREMRMNPKAITAAQMFGRLDVATNDWTDGIFSALWRKTLKLKAGEHVWLVLDGPVDSIWIENLNSVLDDNKTLTLANGDRLTMAPTVKIIFEPHNIDNASPATVSRNGMVYMSSSGLDSRPIVQAWLKNRAPGEKSTFSDLFDQTFVEVYNWGVQMVKLQMPVLQCNIVQQMLFILEGLIPVKKEDEQAVSMSSKESHDANKRLEHQKHVEEARRQSIGSQIVEDLPPETSIEEKEDTCTPEHLHRLYIFALAWGLGGYLSTSDRQRMNLFVKESFP-QLDYPK-GSAHENTIFDFFVSPAGVWQSWKTLVTPYMYPELSTPDYLSILVPIVDNVRIDYLIGTIANQERAVMVIGEQGTGKTVIMKNFMKKMNVESYMGRSFNFSSATSPYQFQRTIESYVEKRVGVTFGPPGGRKLIVFIDDINLPEINEWGDQITNEIVRQSMDMKGFYSLEKPGDFTTIVDVQYVAAMGLPGGGRNDIPSRLKRQFCVFNCNIPDNDSIDKIFRVIGEGHYNAKRGFVPEIRSLVKKLIVVTRHLWQRTREKLLPTPAKFHYVFSLRDLSRIWQGMVGTLSTVITSESVLMALWKHECTRVFADRFTTFQDKEWFGSELACLVREELGD---SHSQMILPNPVFVDFMRDAPEPTGEEGEDTDMELPKVYEPVHSHEVLRERLVMFLAQFNEMVRGSGMDLVFFPDAMLHLVKISRIIRHPRGSVMLVGVGGSGKQSLTKLASFIAGYKTFQIALTRSYNVANFLEDLKLLYRTCGVQGKGTTFLFTDMDIKEEGFLEYLNNILSSGVISNLFSRDEQAEIVQELTPVMKRENQRKTATPESVMDFFLARTCTNLHVAFCFSPVGETFRSRVQRFPALVSGCTIDWLHPWPKDALVSVARHFLSHFEIECTPAVKEELVNALGSIQDIVAETSQEYFQRFRRATHVTPKSYLNFIAGYKNIYQMKQQELRDGVEKMDTGLEKLKEASASVEILKKDLVVMEEELVEASKNAESVLVEVTERAMQAEIVKNQVLIVKDKAEALVACIAHEKALAEEKLEAAKPALEEAENALNTIKPAHIATVRKLGRPPHLIMRIMDCVLILFKRKLHPCIPDAGTPCPKPSWQESLKMMASATFLLQLQNYPKDTINDEMIDLLQPYFRMEDYNMDMARRVCGDVAGLLSWTKAMSFFHSVNKEVLPLKANLTMQEARLKLAMDDLAGAEEQLREREEALQAVKDQYDKAVGEKQRLTDAANVCLRKMTAATALINGLSDEKHRWTNQSKEFKIQLGKLVGDVLLATGFLSYCGPYNQEFRANLIKTWMGILKQKNIPFTTGLNIINMLVDSSTVSEWTLQGLPNDELSVQNALIATKSSSYPLLVDPQTQGKIWIKCKEDRNELQITSLNHKYFRTHLEDSLSLGRPLLIEDVGIDLDPVIDNVLEKNFIKSGSIEKVLVGDKECDVMPGFMLYITTKLPNPAFSPEVSAKTSIIDFTVTMRGLEDQLLGRVILMEKSDLEAERVALFETVMQNQRNMKELEANLLLRLSSSQGSLVDDEALIEVLRVTKTTAEEVNQKLKISEVTERKIMKAREEFRAVAKRGSILYFLIVEMSNVNAMYQNSLKQFLVIFNHSITKSTKSSVTEERINIILRYLTYEVYKFTNRSLYERHKQLFTLMLAIKIDYHNGNISHEEFLTFIKGGASLDLNAVTPKPFRWILDITWLNLVEISKLETFSTVLQVIELNEKDWRCWYECEKPENEEIPCGYNAILDGFRKLLLIRSWCPDRTISQAKKYIEESLGPEYSEMQILDLEEMWLESEPRTPFVCLLSIGSDPTTQIGALAKQKSIVLKSVSMGQGQEYHARKMIIESMAIGGWVLLQNVHLSLPFCSEIIDMLVESEHIDDSFRMWVTTEPHNEFPIGLLQMALKFTNEPPQGIRASLKRSYQSFTQDFLDYTSATQWPPLLYTVAFLHTIVQERRKFGPLGWNIPYEFNQADFAASVQFIQNHLDEMDPKKGVSWQTLVYMIGEVQYGGRVTDDFDKRLLTTFTSVWFCEPLLSNSFEFYKGYKVPGTKSLQGFIDYINSLPAYDTPEVFGLHSNADITYQINSAKGILDTILSVQPKEGGGGGGETRESIVYQLADDMLRKLPAQYNAYEVRENLTRMGILLPMNIFLRQEIDRMQRVIKRVHTCLCDLKLAIDGTIVMSPALKESLDAMYDARIPETWMKISWESTTLGFWYTELLERNGQFRTWISTDRPKVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNQITRYNKEDITEYPTEGVYVHGLFLEGASLDRRSGKLIESKMKVLYEQMPVIYIYAINTTAGKD------PKLYECPIYRKPQRTDLKYVGSIDFETEFNPK--HWTLRGVALLCDIK 4716          

HSP 2 Score: 239.58 bits (610), Expect = 2.533e-62
Identity = 112/151 (74.17%), Postives = 129/151 (85.43%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            V+ YYDI W +VDIE+I+NEL EFQNRCRKLPKGLK+WPAF  L+KTIDDFN M PLLELM N AMKPRHWQR+ D+T + F+ +S+GF+L+NILEAPLLK KE+IEDICISA+KEKDIEAKLK V  EWS HEL F +F NRGELLLRGD
Sbjct: 1471 VSSYYDIPWNEVDIEEINNELMEFQNRCRKLPKGLKEWPAFHALKKTIDDFNDMCPLLELMANKAMKPRHWQRIMDVTRYIFEFDSEGFSLKNILEAPLLKHKEDIEDICISAMKEKDIEAKLKQVTNEWSVHELQFMSFNNRGELLLRGD 1621          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Match: kl-3 (gene:FBgn0267432 transcript:FBtr0346771)

HSP 1 Score: 3573.87 bits (9266), Expect = 0.000e+0
Identity = 1799/3061 (58.77%), Postives = 2320/3061 (75.79%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI---PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVF-ETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETE------VIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFKKDIQ  +SKL N+ +I+E+W+ VQNLW+YLEAVFVGGDI+KQLP EAKRF+NIDKS++KIM RA E  N + CC GDE+L+  L  LL+QLE CQKSLTGYLE KRL+FPRFFFVSDP LLEILGQASDP +IQ HLLS+FD I TV F EK  + I +  SM  E ++ E  V+   +VE+WL  LL   Q ++  ++   + S+ND EFN  E    +  Q G++G+QLLWT+DS  AL   ++D+ IM++TN +FL+LLN  I  T  DL  ++R +FET++TIHVHQ+DIFD L   ++KS  DF+W KQ RFY+ ED D  IV ITDV+F+YQNE+LG TERL ITPLTDRCYITLAQA+GM MGGAPAGPAGTGKTET KDMGR LGK VVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KE++  F+F DGD+V +NPEFGIF+TMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVK+ASCGF +N+VL+RK YTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG QKR+NP DTE+T VMRVLRDMN+SKL+D+DE LF+SL++D+FPGI+L    Y +L+ AI +  DE   +++P W LK++QL+ET  VRHG+M +GP+G+GKT+C   +++  T+ G  H+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRR+LK  + ++ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRI M+ + K++FE  N+DNASPATVSR GMV+ SSS L W   ++ WLLK+  +   +    +   + D + +    L+ KM  LEA  +RQ  D+++GL+   P + EK          ER+++FS+MWS+GA+LE+ +R KLE ++  + + KL  PK  +   +T+F+Y V +NG W HW+++VEE+ YP+D  PE+ SILVPNVDNVRT FL++ +A Q K VLLIGEQGTAKTVMI  Y+   +PE H+FKS NFSSAT P M+QR IES+V+KR G+TYGPP  R MT+FIDDINMPVINEWGDQI NEIVRQ++E +GFY+LE+PGDF+ I+D+Q ++AMIHPGGGRNDIP RLKR  CIFNCTLPSN+S+D+IF  IG G++  +R   DEV +++  L+P+TR  W   K KMLPTPA FHYVFNLRDLSRIW+G++  + +   +   +L LW HEC RVISDRF   +D  WF   +      D   +I    + + E   +++DF+RDA E   EE ++  F+ PK+YE I SFD ++ ++ +F   +NE IRG  MD+VFF DA+ HL+ +SRII  PRGNALLVGVGGSGKQ+LT+L+S+IAGYK FQ+TLTRSYN  NL EDLKFLYRTAG  G G+TF+FT  EIK+E FLE++NN+LSSG ++NLFA+DE+DE+  ELIP+MKK  PRRP T DNL ++F+SR + NLH+ LCFSP+GEKFR R+LKFPGLISGC +DWFQ+WP+DA IAV+ HYL+ ++IVC+  VK ++I  M  +H+ V E C+ Y+ RFRR T VTPKS +SFL  YK +YK+K DH   +++RM SGL KL EA  SVA LK+ L E  K +A+A+ EAE+VL TV   K AA  VK +V   K +A+ +V+ I   K +AE+KLE A PAL EAE AL TIK ADIATVRKLG+PP+LI  IMDCV I F+R++  +  D E+   + SW ES+K+MS+  FL  ++ +P D IN E V+++ PY +   YT + A+  CGNVAGLLSWT AM  +FE+NKEVLPLK NL  Q+ +Y+K+  DL  A+ +L +K+ EL +VQ   ++A+ KK  +LD+A+ C+ KM AA  LI GLAGEK+RWT Q + FK++ DRLVGDV+  TAFLSY GPFNQEFR+ L + W K++  + IP S ++NII+ LTD + +GEW++QGLP DELS+QNGII TKA R+PLLIDPQ QGK+WIKN+E Q ++ VT+LNHKYFR HLEDS+S+G P++IED+ EELDP LDN+L++N +K G+ +K+K+GDKEVD    F  YITTKLPNP+YTPEIFARTSIIDFTVTM+GLEDQLLG VI  E++ELE +R+QL+E V GN KKMKELE NLL +L++TKGSL+DD  +I+VL T+K T+ EV +K+ IA  TE KIN+AREEYR VATRGS+LYFL+  M+ VN MYQTSL QFL  FD SM  S K+ +TQKRI+ II  +T+E+++Y  RGLYE DK  F LLMAL +D +   I  +EF  FIKGGA+L++N   P P  W TD TWLNLV+L+NL  F  +L +VS NE+ W  W+ K+APE E+IPDGYN+ LD FR++LLVR WC DRT+SQ +KYI +SLG++FAE  +L+ +++  ES    PM+  LS+GSDP+  IE+LAKK++++C  ISMGQGQEIH+R+L+ + L  GGWVLLQNCHL L+YM EL  Q++E E       ++ +FR+W+TTE HPKFPI+ LQM +K+TNEPP GI+AG+KRTYT+ +QDFLD S    + P+VY++++LHT VQERRKFGPLGWNIPYE+N++D  AS  FVQNHLDD++  KG+SW T+ YMLGE+QYGGRVTDDYDKRLLNTF R WF+D +F   F+FFK + + +  +   Y+  I+++ N D P+++G HSNA+ITYQ+ T ++ILD I++IQPK++SAG GE+RE  V R   +ML K P  +  F+V + L  MG    MNIFLRQE+DRMQ++I  VR+   DL LA++GTIIM+E+LRDALD++++AR+P+ + + SW SS+LGFWFTEL+ER++QF  W F  RP  FWM+GFFN QGFLTAMRQEV RAH+GWALD V + NDV K   +E  +PP EGV+VYGL+++GAGWD+R S+L+E+ +KVLF  +PVI I AI  S   + S+     +Y CPVYKK  RTDL +I +++L+    K  DHWTLR VALLCD+K
Sbjct: 1559 DSLMIMNSLASNRYNAPFKKDIQLWLSKLVNTGDILEKWLMVQNLWIYLEAVFVGGDISKQLPMEAKRFTNIDKSYVKIMMRAREIPNAVDCCTGDESLATNLTWLLDQLETCQKSLTGYLESKRLVFPRFFFVSDPVLLEILGQASDPTSIQPHLLSIFDAIATVDFQEKSIDIIESMNSMNREKVKFENTVQCLGSVELWLGRLLKEMQDTIRTILAQMSVSLNDPEFNFAEEFPSFCGQAGVVGVQLLWTKDSEYALRKCRTDKTIMKRTNNKFLVLLNFFIDLTVKDLTSLDRIRFETMVTIHVHQRDIFDDLCTLRIKSAGDFEWQKQARFYYNEDNDDVIVGITDVNFVYQNEYLGVTERLAITPLTDRCYITLAQAVGMCMGGAPAGPAGTGKTETTKDMGRALGKLVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKEKRSTFIFLDGDIVSLNPEFGIFITMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKMASCGFKENVVLSRKMYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGSQKRSNPNDTEETIVMRVLRDMNVSKLIDEDEGLFVSLVDDMFPGIKLTTNVYKDLQKAIIKVCDELGYVNNPEWNLKVVQLYETSLVRHGLMLMGPTGSGKTSCTVCMLRCFTEMGRTHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRSLKVPQHQNCWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIKMADNSKLVFEPDNVDNASPATVSRVGMVFTSSSVLSWKIYMEAWLLKQGEDSE-VFRRCYDVLYDDAHVFLQSRLLAKMRILEAIYIRQMLDIMDGLLLDLPLRTEK--------ALERIFLFSLMWSLGAVLELSEREKLEEFLLKHVS-KLRWPK--RGVNETIFEYYVDDNGNWQHWSTRVEEFRYPEDEIPEFSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFNFSSATTPNMYQRIIESYVEKRQGTTYGPPNQRAMTIFIDDINMPVINEWGDQITNEIVRQMIEQRGFYSLERPGDFSTIMDIQMLSAMIHPGGGRNDIPNRLKRHLCIFNCTLPSNNSMDQIFKSIGAGYFSPDR-LGDEVVEVIPLLVPLTRIFWQNVKAKMLPTPANFHYVFNLRDLSRIWEGILKVKHEECKSVDQILKLWCHECTRVISDRFTAEKDKIWFSSKM----ISDAELNIKEFMEFYPEEPTYWVDFLRDAPEGQEEEDEEMSFEPPKIYEEIPSFDFVRSKVLVFMSQFNEYIRGYNMDLVFFMDALKHLMIVSRIISNPRGNALLVGVGGSGKQSLTRLSSFIAGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILSSGEIANLFAKDELDEMYSELIPVMKKHQPRRPATQDNLYDFFISRARYNLHIALCFSPVGEKFRMRSLKFPGLISGCVIDWFQKWPEDARIAVSRHYLTDYQIVCSEKVKDQVIDIMSWIHESVQETCLSYYDRFRRVTFVTPKSLISFLESYKLLYKDKQDHIVIMSERMSSGLDKLDEAGASVAILKKDLIEMNKVIALASEEAEDVLATVEQSKAAAEIVKVEVAEKKGQAEVLVKNISAVKHVAEAKLEKALPALEEAEAALKTIKAADIATVRKLGKPPYLITLIMDCVCILFRRKVKPIRPDTEKAFIQSSWDESLKVMSDTSFLRKIVEYPTDLINAEMVDMMVPYFQYPQYTFEAAKVACGNVAGLLSWTMAMSKYFEVNKEVLPLKANLAVQEAKYQKASSDLQEAEELLQQKENELAEVQQTLEDAVSKKDAVLDEAKKCQDKMDAATALIGGLAGEKIRWTEQIASFKSETDRLVGDVILLTAFLSYTGPFNQEFRSDLQSIWTKQIIEKMIPISANVNIIESLTDRSQIGEWNIQGLPTDELSIQNGIISTKAMRFPLLIDPQSQGKVWIKNKEKQNKVIVTTLNHKYFRNHLEDSVSMGIPIIIEDVAEELDPCLDNLLDRNLLKVGTQYKIKIGDKEVDWNPAFRCYITTKLPNPAYTPEIFARTSIIDFTVTMRGLEDQLLGRVILAERKELEDERVQLVETVTGNMKKMKELEANLLQKLSTTKGSLLDDVTVIEVLNTSKNTAIEVKEKIEIAKVTEAKINAAREEYRVVATRGSVLYFLVCSMARVNNMYQTSLVQFLERFDASMYNSSKTHITQKRIKRIINYLTFEIYRYKSRGLYEKDKFLFVLLMALSIDRQLELITFDEFQVFIKGGAALNLNDCPPVPFRWTTDETWLNLVQLTNLTPFVNILSKVSGNERAWFTWYKKDAPENEIIPDGYNS-LDPFRKMLLVRSWCMDRTISQCRKYIANSLGDRFAEPVVLNFEELLLESRELMPMICFLSLGSDPSSNIELLAKKNELKCHPISMGQGQEIHARKLILSCLEDGGWVLLQNCHLGLEYMVELTVQILELERQGKDAAVNPNFRIWITTEPHPKFPITLLQMCLKYTNEPPAGIRAGLKRTYTNLSQDFLDYSQSPFYLPLVYSISFLHTVVQERRKFGPLGWNIPYEFNSSDWYASCLFVQNHLDDIEQGKGISWVTVRYMLGEVQYGGRVTDDYDKRLLNTFTRVWFHDTLFEDCFQFFKGYKVYSFKEQEAYLAAIDDMANVDPPQVYGFHSNAEITYQTNTMRNILDEIMSIQPKESSAGTGESREDRVARQVKEMLSKTPLAFDLFDVKQHLIAMGATSSMNIFLRQEIDRMQRIIILVRSIFKDLLLAVEGTIIMSENLRDALDNIFNARVPTVFKRGSWVSSSLGFWFTELLERHTQFYNWCFGARPVVFWMSGFFNPQGFLTAMRQEVARAHQGWALDQVTMHNDVLKVGPEECKKPPKEGVFVYGLFVDGAGWDKRTSRLVEATNKVLFTLMPVIHIYAI-FSTAAKNSK-----LYTCPVYKKINRTDLNYICALWLQS--NKHPDHWTLRGVALLCDVK 4593          

HSP 2 Score: 189.504 bits (480), Expect = 3.748e-47
Identity = 87/151 (57.62%), Postives = 113/151 (74.83%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            ++  YY++ W DV+IEKIS EL++FQ RCRKLPKG++ WPAF DL+  IDDFN   PLLELMTN AMK RHW R++ L +  FD  +  F L  +LEAP+LK+KE++EDIC+ A KE DIEAKLK + ++WS   L  G FKNRG+L+L+G
Sbjct: 1397 TITDYYEMPWADVNIEKISAELSDFQLRCRKLPKGMQSWPAFIDLKTKIDDFNETCPLLELMTNKAMKERHWIRLNALFNTDFDPTNPKFTLGKLLEAPILKYKEDVEDICVGASKELDIEAKLKQIVSDWSLVSLQLGQFKNRGDLVLKG 1547          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4483.32 bits (11627), Expect = 0.000e+0
Identity = 2203/3056 (72.09%), Postives = 2583/3056 (84.52%), Query Frame = 2
Query:  419 NV*ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDIK 9580
            N+ +S  V+ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL++FDNIK V+FHEK Y+ ILA  S EGE +EL+KPV AE NVE+WL  LL  +QRSLH VIR A  +I D+ F ++EFL+ +PAQVGLLGIQ++WT+DS +AL NA+ DRKIM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF ED D+ +++ITDV F+YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+K F+FTDGD V+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNI LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYP+LE+AI++Q+ EA +I+HPPW LK+IQL+ETQRVRHGMM LGPSGAGKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNI+NASPATVSRNGMV+MSSS L+W P+L+GWL  R++ E  ++ +LF++SFP++YR+SIQ L YKME LEAF++ Q  ++L+GLI  K++    ++SR H ERLY+F++MWS+GALLE++DR KLE ++R++++I LDLP I   SEDTMFD+ V+ +G WVHWN++VEEYIYP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  Y+S  +PE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E  GF+NLEKPG+FTNIVD+QF+AAMIHPGGGRND+PQRLKRQF IFNCTLPSN+SIDKIF +IGTGHYC  RGF++EVR  V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+    +VI+  + LL LWKHEC RVI+DRF   ED++WF  TL + + E L E+      +   D++F+DF+RDA EATG+EP++TDFDMPKVYEPI SFD L +RL MF   +NESIRGA MDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGYK FQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP+GE+FRNRALKFP LISGCTMDWF RWPKDALIAV+ H+LS+++I C   VK E++  MG   DGVAE C DYFQR+RR THVTPKSYLSF+  YK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++T+  DPE+N   PSW ES+KLM+   FL +L  FPKDTINEE VE +SPY +M DY I+ A+RVCGNVAGL SWT+AM +FF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT  S EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L T WQ+E++ R+IPF T+LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK G T+KVK+GDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLVDDE LI VL  TK T+ EV+QKL IA++TEI+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS+++S KSP+T KRI NIIE MT+EV KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+    PK   WI D+TWLNLVELS L QFS +LDQ+ R+EKQWR WFD+EAPEEE IP+ Y+  LD FRRLLL+R WCPDRT++QA+KYI  S+GE++AEG ILD +K +EES PRTP++  LSMGSDPT +I  L K+ ++E R +SMGQGQE+H+R+L+ + +  GGW LLQNCHL LD+M+ELMD + ET+ +HD FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   +QD LD+SNM+QWRPM+Y VA+LH+ VQERRK+GPLGWNIPYE+N AD NA++QFVQNHLDD+DIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF+P F F+K +SIP  S +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE++V R+ DDML KLP D+V FEV ERL  MG LQPMNIFLRQE+DRMQ+VI  VR TL DLKLAIDGTIIM+E+LRDALD MYDARIP+ W K SW S+TLGFWFTEL+ERN QF +W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP+EGVYVYGLYLEGAGWDRRN KLI+SK KVLFE +PVI + A     E    +D    +Y  P+YKKP RTDL +IA+V LR   PP    ++W LR VALLCD+K
Sbjct: 1484 NMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLEQLEMCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNIFDNIKCVRFHEKMYDKILAISSREGETIELDKPVIAEGNVEVWLNALLKESQRSLHLVIRQAALAIQDSGFELIEFLDSFPAQVGLLGIQMIWTKDSEDALSNARYDRKIMSKTNQFFLELLNNLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIKSPTDFEWLKQCRFYFNEDSDKMMINITDVGFVYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRKNFIFTDGDNVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPNDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPDLESAIDKQVTEAGLINHPPWRLKVIQLYETQRVRHGMMALGPSGAGKTTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIENASPATVSRNGMVFMSSSVLNWSPILEGWLKNRSAQEGMVLKDLFSSSFPELYRFSIQSLQYKMEMLEAFIIMQCINMLQGLIQPKEQ--GGELSREHMERLYVFALMWSVGALLELDDRMKLERWLRNHDSIHLDLPNIPPHSEDTMFDFYVTNDGHWVHWNTRVEEYIYPPDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYMSKYDPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQNGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDVPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSHRGFSEEVRNTVGRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLGVTAEVISTPQLLLQLWKHECKRVIADRFTAPEDVAWFDSTLAKLVEEQLGEEEREVVDL-GVDSYFVDFLRDAPEATGDEPEETDFDMPKVYEPIESFDSLMERLNMFLSHFNESIRGASMDMVFFRDAMIHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNTANLMEDLKGLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEIISDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSPVGERFRNRALKFPALISGCTMDWFSRWPKDALIAVSEHFLSTYDIDCTLEVKSEVVQCMGSFQDGVAEKCADYFQRYRRSTHVTPKSYLSFIHDYKTIYKEKHSEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANAKADMVLKEVTVKAQAAEKVKVEVQKVKDKAQAIVDSISADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNTVKTDPEKNCTMPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVEFLSPYFDMVDYNIETAKRVCGNVAGLCSWTKAMAAFFSINKEVLPLKANLAVQENRLTIANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDAERCRHKMQTASSLISGLAGEKERWTQLSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLTDWQREMKFRQIPFRTNLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIKNKESKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGFTYKVKIGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKERTDLLEDVTANKRKMKELEDNLLFRLTSTQGSLVDDESLITVLGNTKRTAEEVTQKLQIAAETEIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLTKSSKSPITSKRIANIIEYMTFEVHKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPPKAAKWILDITWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDREAPEEEPIPNAYDQALDCFRRLLLIRSWCPDRTIAQARKYITQSMGERYAEGVILDLEKTWEESEPRTPLICFLSMGSDPTDSIIALGKRQRIETRYVSMGQGQEVHARKLLQHSMANGGWALLQNCHLGLDFMDELMDTITETDSVHDTFRLWMTTEVHKHFPITLLQMSIKFTNEPPQGLKAGLKRTYGGISQDLLDVSNMVQWRPMLYGVAFLHSTVQERRKYGPLGWNIPYEFNQADFNATIQFVQNHLDDIDIKKGVSWNTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFSPDFHFYKGYSIPKCSNVDQYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSTGGGETREAIVGRLADDMLEKLPPDFVPFEVRERLMSMGPLQPMNIFLRQEIDRMQRVIVLVRNTLNDLKLAIDGTIIMSENLRDALDCMYDARIPARWKKASWASTTLGFWFTELLERNRQFHSWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPAEGVYVYGLYLEGAGWDRRNCKLIDSKPKVLFEMMPVIRMYA-----ENNGVKD--ARLYSSPIYKKPVRTDLNYIAAVDLRTSHPP----EYWILRGVALLCDVK 4525          

HSP 2 Score: 220.705 bits (561), Expect = 1.641e-56
Identity = 101/152 (66.45%), Postives = 123/152 (80.92%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDI W D+ I++I+NEL +FQ RCRKLP+GLK+W AF DL+KTID+F+   PLL+LMTN AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1325 TVNGYYDISWADIHIDRINNELLDFQARCRKLPRGLKEWQAFMDLKKTIDEFSECCPLLDLMTNKAMMTRHWKRITEVTGHTFEVETDNFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGD 1476          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 4188.65 bits (10862), Expect = 0.000e+0
Identity = 2055/3056 (67.24%), Postives = 2489/3056 (81.45%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFK  IQ  V KLSNSSE+IE+W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW +IM RAHE   V+QCCVGDETL QLLPHLLEQLE+CQKSL+GYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL++FDN+  V FHEK Y+ IL+  S EGE + + +P+ A+ NVE WL  LL+  +++LH +IR A   I D  F ++EF +M+PAQVGLLGIQ +WTRD+ EAL  +K+D+KIMQ TN++FL LLN LI  TT DL K+ERTK+ETLITIHVHQKDIFD LV+  ++SP DF+W KQ+RFYF++D DRCI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQL+   GFY+LE+PG+FT +VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF +EV  L   L+P TR++W   K KMLP+PAKFHY+FNLRDLSRIWQG++    +V    + L  L++HEC RVI+DRF+  +D   F   L+R  ++D    ++ Q        +F+DF+RDA E TGEEP+D + + PKVYEPI +F  L +RL MF+  YNE++RGA MD+VFF DAM HL+KISRIIRT RGNALLVGVGGSGKQ+LT+LAS+IAGY+ FQITLTR+YN+SNL+EDLK LYR AG +GKG+TF+FTD +IKDE FLEYMNNVL+SG VSNLFARDE+DEI Q LIP MKK+ PR PPT DNL  YFLSR + NLHV LCFSP+GEK R+RALKFPGLISGCT+DWFQRWP+DAL+AVA H+LS++ + C+  VK+ ++ +MG   D VAE C +YFQRFRRQT+VTPKSYL+F+ GY+ IY EK ++   LA+RM++GL++L+EA+ SV EL+  L EKEK L +A ++A EVL  VT +  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  +E AL TIKPADIATVRKLG+PPHLIMRIMDCVL+ FQRR+D +  DPER   KPSWGE++KLM+N+ FL+ L+NF KDTI EE VEL+SPYL MEDY ++ A+R CGNVAGL SWT AM+ FF INKEVLPLK NL  Q+ R   + ++L+ AQ  LD KQKEL   QA+YD A+++KQ LLDDAE C++KM+ A  LI+GL GEK+RWT  S++F+ QI  +VGDVL AT FLSY GPFNQE+R +L   W+KE+ +R IP+S +LN+I+ML D   +GEW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQGQGKIWIKNRE   +LQVTSLNHKYFR HLED LS G+PLL+ED+GEELDP LDN+LEKNFIK G T KVKVGDKEVDVM+ F LYITTKL NP+Y+PEI A+T ++DFTVTMKGLEDQLLG VI  EK+E+EA+R++L+E+V  NK+KM+ELE NLL+RLTS +GSLV+DE LI+VLK TK T+ EVSQKL +A++TEI IN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM +S KS VT KR++NI+E +T+EV++Y  RGLYE  K  FTLL+ALK+D++   I   E  TFIKGGASLD+N V+ KPK WI D TWLNLV+LS+LH F+ +L QV RN++ W+ WFD+  PEE  +PDGY + LD FR+LLL+R WCPDRT++QA+KYI +S+G K+AEG ILD + +  E+  R P+V  LSMGSDPT  I+ LAK   + CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL LD+++E ++ +  TE IHD+FRLWVTT++HPKFPI+FLQ SIKFTNEPPQG+KAG+KRTY S  Q+ L+I+NM QWRP+ YAVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHLDD+DIK+G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF++ MF  KF F+K ++IP    L +Y   I+ LP  D+PE+FGLH NADITYQ+  A   L  ILNIQPKD+S+G GETRES V +M ++ML KLP+DYV  EV   LQ MG  QPM IFLRQE+DRMQ+VI +VR+TL DLKLAIDGTIIM+EDLRDALDSMYDAR+P SW K+SWE+++LGFWFTEL+ERN QF +W F GRP  FW+TGFFN QGFLTAMRQE TR +  KGWALDTV+L NDVT+ M++++  PP     GVY+YGLYL+GAGWD+RN KL ES  KVLF  LPV+ + A+  + E   S+    N+Y CPVYKKPRRTDLT+I S++LR   ++  DHWTLR VALLCD K
Sbjct: 1401 DSLMVLGSLMSNRYNAPFKPTIQQWVQKLSNSSEVIEKWLTVQNLWLYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQRIMQRAHEIPGVVQCCVGDETLQQLLPHLLEQLEVCQKSLSGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNLFDNVNRVVFHEKNYDQILSFQSQEGETVNMSEPINAQGNVEAWLGMLLDGVKKTLHSIIRQAAMVIGDQGFKLVEFQSMFPAQVGLLGIQFIWTRDAEEALQQSKADKKIMQTTNQKFLDLLNELIDMTTHDLTKMERTKYETLITIHVHQKDIFDDLVQMNIRSPLDFEWQKQSRFYFIDDTDRCIIQITDVEFDYCNEYLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQG---PWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTE---SKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRS--SQNPDHWTLRGVALLCDCK 4442          

HSP 2 Score: 224.942 bits (572), Expect = 8.883e-58
Identity = 102/151 (67.55%), Postives = 124/151 (82.12%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            SV+GYYDILW D++IEKI+NEL +FQNR RKLP  LK+W AF DL+KTIDDFN   PLL +M N AM  RHW+R++DLT H F+VE+  F+LRN++EAPLLK KE+IED+CISAVKE+DIEAKLK V  EWS H+  F TF+NRGELLL+G
Sbjct: 1239 SVSGYYDILWADLNIEKINNELLDFQNRIRKLPAALKEWQAFNDLKKTIDDFNETCPLLYMMANKAMMARHWERITDLTKHKFEVEAPNFSLRNVMEAPLLKCKEDIEDVCISAVKERDIEAKLKDVVTEWSGHQFTFATFRNRGELLLKG 1389          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: dnah5l (dynein, axonemal, heavy chain 5 like [Source:ZFIN;Acc:ZDB-GENE-091204-287])

HSP 1 Score: 3711 bits (9622), Expect = 0.000e+0
Identity = 1803/2681 (67.25%), Postives = 2183/2681 (81.42%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF +N VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPT+ E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+HPPW+LKL+QL+ETQRVRHGMMTLGPSG GKT CIH LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+ WL K    +  ++L  F + + D+  +    +  KM+ LE   ++Q  DLL+GL+P  +EK+   ++  H  RL+IF+VMWS GAL+E+EDR K+E +++  +N +LDLP  +   E T+F+++VS  GEW  W ++V EYIYPKDS P+Y SILVPNVDN+RTDFLM T+  Q KAVLLIGEQGTAKTVMI  Y S  +PE ++ KSLNFSSAT P MFQ+TIES++DKRMG+TYGPP G+KMTVF+DDINMPVINEWGDQI NEIVRQL+   GFY+LE+PG+FT +VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF +EV  L   L+P TR++W   K KMLP+PAKFHY+FNLRDLSRIWQG++    +V    + L  L++HEC RVI+DRF+  +D   F   L+R  ++D    ++ Q        +F+DF+RDA E TGEEP+D + + PKVYEPI +F  L +RL MF+  YNE++RGA MD+VFF DAM HL+KISRIIRT RGNALLVGVGGSGKQ+LT+LAS+IAGY+ FQITLTR+YN+SNL+EDLK LYR AG +GKG+TF+FTD +IKDE FLEYMNNVL+SG VSNLFARDE+DEI Q LIP MKK+ PR PPT DNL  YFLSR + NLHV LCFSP+GEK R+RALKFPGLISGCT+DWFQRWP+DAL+AVA H+LS++ + C+  VK+ ++ +MG   D VAE C +YFQRFRRQT+VTPKSYL+F+ GY+ IY EK ++   LA+RM++GL++L+EA+ SV EL+  L EKEK L +A ++A EVL  VT +  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  +E AL TIKPADIATVRKLG+PPHLIMRIMDCVL+ FQRR+D +  DPER   KPSWGE++KLM+N+ FL+ L+NF KDTI EE VEL+SPYL MEDY ++ A+R CGNVAGL SWT AM+ FF INKEVLPLK NL  Q+ R   + ++L+ AQ  LD KQKEL   QA+YD A+++KQ LLDDAE C++KM+ A  LI+GL GEK+RWT  S++F+ QI  +VGDVL AT FLSY GPFNQE+R +L   W+KE+ +R IP+S +LN+I+ML D   +GEW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQGQGKIWIKNRE   +LQVTSLNHKYFR HLED LS G+PLL+ED+GEELDP LDN+LEKNFIK G T KVKVGDKEVDVM+ F LYITTKL NP+Y+PEI A+T ++DFTVTMKGLEDQLLG VI  EK+E+EA+R++L+E+V  NK+KM+ELE NLL+RLTS +GSLV+DE LI+VLK TK T+ EVSQKL +A++TEI IN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM +S KS VT KR++NI+E +T+EV++Y  RGLYE  K  FTLL+ALK+D++   I   E  TFIKGGASLD+N V+ KPK WI D TWLNLV+LS+LH F+ +L QV RN++ W+ WFD+  PEE  +PDGY + LD FR+LLL+R WCPDRT++QA+KYI +S+G K+AEG ILD + +  E+  R P+V  LSMGSDPT  I+ LAK   + CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL LD+++E ++ +  TE IHD+FRLWVTT++HPKFPI+FLQ SIKFTNEPPQG+KAG+KRTY S  Q+ L+I+NM QWRP+ YAVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHLDD+DIK+G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF++ MF  KF F+K ++IP    L +Y   I+ LP  D+PE+FGLH NADITYQ+  A   L  ILNIQPKD+S+G GETRES V +M ++ML KLP+DYV  EV   LQ MG  QPM IFLRQE+DRMQ+VI +VR+TL DLKLAIDGTIIM+EDLRDALDSMYDAR+P SW K+SWE+++LGFWFTEL+ERN QF +W F GRP  FW+TGFFN QGFLTAMRQE TR +  KGWALDTV+L NDVT+ M++++  PP     GVY+YGLYL+GAGWD+RN KL ES  KVLF  LPV+ + A+  + E   S+    N+Y CPVYKKPRRTDLT+I S++LR   ++  DHWTLR VALLCD K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKSQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRENQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPTEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGIMLDKAGYPDLEAAITKQAEEAGLIAHPPWILKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLMKAMTDCGNPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKSKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWQPILQAWLKKIPPMQADVLLAAFNSIYQDLMNFVFTAVSPKMQLLECMYIKQTIDLLQGLLPAVEEKN---LNAAHINRLFIFAVMWSAGALMELEDRAKMEVFLK-KHNARLDLPSTQ--GEQTIFEFLVSSTGEWDLWATRVPEYIYPKDSVPDYASILVPNVDNIRTDFLMQTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPETNLSKSLNFSSATQPGMFQQTIESYIDKRMGTTYGPPGGKKMTVFVDDINMPVINEWGDQITNEIVRQLMVQGGFYSLERPGEFTTVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCVERGFPEEVCSLAAALVPTTRKVWQAVKAKMLPSPAKFHYIFNLRDLSRIWQGILTVGSEVCQTPQLLASLFRHECSRVIADRFIDEKDRETFDGILERITAQDHGPSLLEQG---PWQGYFVDFLRDAPEMTGEEPEDAEEETPKVYEPIPTFKALSERLSMFQEQYNEAVRGAAMDLVFFEDAMIHLMKISRIIRTARGNALLVGVGGSGKQSLTRLASFIAGYQSFQITLTRTYNVSNLIEDLKALYRIAGLEGKGVTFIFTDNDIKDEAFLEYMNNVLASGEVSNLFARDEVDEITQSLIPAMKKDLPRCPPTIDNLYNYFLSRVRSNLHVALCFSPVGEKLRSRALKFPGLISGCTVDWFQRWPRDALVAVAQHFLSNYSLRCSDEVKRSVVQTMGTFQDMVAEICTEYFQRFRRQTYVTPKSYLTFIKGYQMIYTEKIENVGVLAERMNTGLERLMEAELSVNELRVELREKEKVLEVAKQKAGEVLLEVTAKAQAAEKVKAQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALEASEAALKTIKPADIATVRKLGKPPHLIMRIMDCVLLLFQRRVDGVTMDPERPCVKPSWGEALKLMNNSGFLSMLLNFNKDTITEEVVELLSPYLAMEDYNLETAKRTCGNVAGLCSWTEAMVEFFGINKEVLPLKANLKLQEARLTVAQDELSRAQEQLDAKQKELDDAQAMYDAAMKEKQDLLDDAEACKKKMSNAVALIDGLGGEKIRWTESSAQFERQIKDMVGDVLLATGFLSYSGPFNQEYRTLLMQQWKKEMDSRHIPYSENLNLINMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQGQGKIWIKNREQSNDLQVTSLNHKYFRTHLEDCLSQGKPLLLEDVGEELDPVLDNILEKNFIKTGKTSKVKVGDKEVDVMETFTLYITTKLANPAYSPEINAKTGVVDFTVTMKGLEDQLLGRVILIEKKEMEAERVKLLEEVTSNKRKMQELESNLLYRLTSIQGSLVEDESLIEVLKVTKTTAQEVSQKLTVAAETEININHAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDMSMEKSPKSQVTAKRLENIMEFLTFEVFRYTARGLYEDHKFLFTLLLALKIDLQTKNISHNELQTFIKGGASLDLNSVEAKPKRWILDTTWLNLVQLSSLHTFATLLTQVGRNDRAWKSWFDEATPEESPLPDGYESQLDAFRKLLLIRSWCPDRTIAQARKYIAESMGVKYAEGVILDMEAMCSEAEKRIPLVCFLSMGSDPTENIDRLAKSKGIPCRPISMGQGQEVHARRLLAQSMSDGGWLLLQNCHLGLDFLDEGLETVTTTENIHDNFRLWVTTDVHPKFPINFLQSSIKFTNEPPQGVKAGLKRTYNSVTQEQLEITNMPQWRPLFYAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLDDIDIKRGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFARIWFSESMFADKFCFYKGYTIPKARMLQDYHAHIDALPLVDTPEVFGLHPNADITYQTNLANDTLSTILNIQPKDSSSGEGETRESSVQKMANEMLEKLPADYVPHEVKSSLQKMGAFQPMTIFLRQELDRMQRVIGRVRSTLTDLKLAIDGTIIMSEDLRDALDSMYDARVPKSWQKISWEAASLGFWFTELLERNQQFYSWTFNGRPLQFWLTGFFNPQGFLTAMRQETTRMNLSKGWALDTVILLNDVTRMMKEDVTSPPPADIGGVYIYGLYLDGAGWDKRNVKLTESSPKVLFNLLPVVHVYAVSSTTE---SKKPAMNLYSCPVYKKPRRTDLTYIFSLFLRS--SQNPDHWTLRGVALLCDCK 2685          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 1125/3075 (36.59%), Postives = 1747/3075 (56.81%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILA--CYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFVVRQACDLLEGLIPRKDEK-DSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR--SNNNIKLDLPKIEKDSE-----DTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPE--YGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTAD-------LNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKH-MQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9565
            PF   +Q     LS  SE IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F NIDK++ KIM+   ++  + +CC+    L+ L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI  ++F       ++A    S EGE +EL++PV AE  VE W+  +L   +R+   + + A    +  +  V   L+ Y   V L   Q+ WT +  +      + +++ ++Q  ++    +N L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+V++ D   V      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+I  GL+Q G+WGCFDEFNRID  VLSV + QI  + +      ++F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E   I  P  V K++Q++ET   RH  M +GP+G GK+  I+ L ++ T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   K   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P      +  ++   + E L+  +++   +++  L    D   ++        E  ++ ++  S+GA L  + R K +A+I+  S+ N   D   +    E      T++D+       +WV W+S V +YI+     PE  +  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT  I  +LS+ N +  +  ++NFSS T     QRT+E+ V+KR   T+GPP G+++ VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  ++  I D+ F+AAM   GGGRN++  R    F +FN   P   S+  I+S I  GH    + F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D       +K  + E    D+ S          F D+    K              P+VYE I  +D  K   +     YNE+     M++V F DA+ HL  I RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AGY++F+I L+R Y+ +N  +DLK LY   G + K + FLFTD  + +EGFLE +NN+L+SG+V  LFA DE + +  +L     K      P+ +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++  ++DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V +    + Q  RR  +VTPK+YL F+  Y ++ ++K  +     +R++ GL KL EA   +AEL   L E++  LA      E +L+ +      A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+              R   + +W  +  +MS   FL +L+    D+IN   V+ +  YL   + +++  + +    +G+L +  A+M + E+ +++ P ++ + + +  + +S  +L   Q+ L   QKEL  +   Y+ A+ +KQ L ++AE   R++ AA +LI GLA E  RW     E K +  RL+GD L   AFLSY G F+ +FRN ++   WQ ++  R IP S    I ++LTD   +  W  +GLP DELSVQNGI+ T++SR+PL IDPQ Q   W+K +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         V +GDKEVD    F+LY+ TKL NP + P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+ +   NK+ +K+LED+LL  L ++ G+++D+ +LI+ L  TK  + EV +KL +A  T + I++ R+ YRP A RG++L+F++ EM+LV+ MYQ SL  FL +FDLS+S+S  +P+   R++NII+ +T  V+ Y   GL+E  K+ F+  M +K++   G+   +E   F KG  SL+ +  + K   W+ D  W +++ L  L  ++F  + D + +N ++W+ W+D +APE+   P  Y  NL  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +F++S P +P+V +LS GS+P   +  LAK         + ++MGQGQE  + +L+   +  G W++LQNCHL + ++ +L   +      H DFRLW+TTE    FPI  LQ S+K   EPP G+K  ++ TY   + D L       +R +VY +A+ H  VQERRK+G +GWN+PY++N +D       L+  L   QN  D++     + W ++ Y++GE+ YGGRV D +D+R+L  +   +  D   D F P F FF     D+ IPA+     Y+D I  LP  ++ E+FGLH NA+I Y ++ A+ +   ++ +QP+   +GGG +R+  + ++  D+  KLP  +    + ++L +   + P ++ L QE++R  K+  ++  +L +L+ A+ G + M+ +L +   ++++ +IP            +LG W      R+ Q+S+W+ +G P   W++G    + +LTA+ Q   R + GW LD   L+  VT++  +D++ + P +G +V GLYLEGA WD  N  L+ SK +VL   LP++ I  I      E  R  L+N  + PVY    R +     L F A +Y     TK   HW L  V L
Sbjct: 1612 PFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLD-YQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHF-EGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIH----NPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH---TKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDS---AMRDPILFGDYRTALKSE------------PRVYEDILDYDASKALFQEILEEYNEN--KTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGC--GPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMI--PKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVI-------------RGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKS-KRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEI-----IPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQP-FHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLE--ISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRKN-GWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPI------EARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLY----TTKHISHWVLEGVCL 4621          

HSP 2 Score: 72.4034 bits (176), Expect = 1.274e-11
Identity = 40/125 (32.00%), Postives = 65/125 (52.00%), Query Frame = 3
Query:   27 LWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSA 401
            LW ++DI+ +   +  F    RKLPK  +  P    L   + +F   +PLL  + N A++ RHW+ + + T  +F++  + F L N+    L K+   I +I  SAVKE  IE  +K V+  W +
Sbjct: 1441 LWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDS 1565          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1903.26 bits (4929), Expect = 0.000e+0
Identity = 1125/3075 (36.59%), Postives = 1747/3075 (56.81%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILA--CYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFVVRQACDLLEGLIPRKDEK-DSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR--SNNNIKLDLPKIEKDSE-----DTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPE--YGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTAD-------LNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKH-MQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9565
            PF   +Q     LS  SE IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F NIDK++ KIM+   ++  + +CC+    L+ L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI  ++F       ++A    S EGE +EL++PV AE  VE W+  +L   +R+   + + A    +  +  V   L+ Y   V L   Q+ WT +  +      + +++ ++Q  ++    +N L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+V++ D   V      F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+I  GL+Q G+WGCFDEFNRID  VLSV + QI  + +      ++F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E   I  P  V K++Q++ET   RH  M +GP+G GK+  I+ L ++ T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   K   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P      +  ++   + E L+  +++   +++  L    D   ++        E  ++ ++  S+GA L  + R K +A+I+  S+ N   D   +    E      T++D+       +WV W+S V +YI+     PE  +  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT  I  +LS+ N +  +  ++NFSS T     QRT+E+ V+KR   T+GPP G+++ VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  ++  I D+ F+AAM   GGGRN++  R    F +FN   P   S+  I+S I  GH    + F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D       +K  + E    D+ S          F D+    K              P+VYE I  +D  K   +     YNE+     M++V F DA+ HL  I RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AGY++F+I L+R Y+ +N  +DLK LY   G + K + FLFTD  + +EGFLE +NN+L+SG+V  LFA DE + +  +L     K      P+ +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++  ++DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V +    + Q  RR  +VTPK+YL F+  Y ++ ++K  +     +R++ GL KL EA   +AEL   L E++  LA      E +L+ +      A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+              R   + +W  +  +MS   FL +L+    D+IN   V+ +  YL   + +++  + +    +G+L +  A+M + E+ +++ P ++ + + +  + +S  +L   Q+ L   QKEL  +   Y+ A+ +KQ L ++AE   R++ AA +LI GLA E  RW     E K +  RL+GD L   AFLSY G F+ +FRN ++   WQ ++  R IP S    I ++LTD   +  W  +GLP DELSVQNGI+ T++SR+PL IDPQ Q   W+K +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         V +GDKEVD    F+LY+ TKL NP + P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+ +   NK+ +K+LED+LL  L ++ G+++D+ +LI+ L  TK  + EV +KL +A  T + I++ R+ YRP A RG++L+F++ EM+LV+ MYQ SL  FL +FDLS+S+S  +P+   R++NII+ +T  V+ Y   GL+E  K+ F+  M +K++   G+   +E   F KG  SL+ +  + K   W+ D  W +++ L  L  ++F  + D + +N ++W+ W+D +APE+   P  Y  NL  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +F++S P +P+V +LS GS+P   +  LAK         + ++MGQGQE  + +L+   +  G W++LQNCHL + ++ +L   +      H DFRLW+TTE    FPI  LQ S+K   EPP G+K  ++ TY   + D L       +R +VY +A+ H  VQERRK+G +GWN+PY++N +D       L+  L   QN  D++     + W ++ Y++GE+ YGGRV D +D+R+L  +   +  D   D F P F FF     D+ IPA+     Y+D I  LP  ++ E+FGLH NA+I Y ++ A+ +   ++ +QP+   +GGG +R+  + ++  D+  KLP  +    + ++L +   + P ++ L QE++R  K+  ++  +L +L+ A+ G + M+ +L +   ++++ +IP            +LG W      R+ Q+S+W+ +G P   W++G    + +LTA+ Q   R + GW LD   L+  VT++  +D++ + P +G +V GLYLEGA WD  N  L+ SK +VL   LP++ I  I      E  R  L+N  + PVY    R +     L F A +Y     TK   HW L  V L
Sbjct: 1612 PFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIYFYSHQKSRVDWMLD-YQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALKQYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHF-EGQEISLDNRIGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPNLSEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTEKLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIH----NPEMKFIDILVPTVDTTRANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEANVEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMGKAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGH---TKPFEECIRNICDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDS---AMRDPILFGDYRTALKSE------------PRVYEDILDYDASKALFQEILEEYNEN--KTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGC--GPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMI--PKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVI-------------RGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKS-KRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEI-----IPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQP-FHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLE--ISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYVMWLSGLHIPESYLTALVQATCRKN-GWPLDHSTLYTQVTQYSSEDQVKERPGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPI------EARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLY----TTKHISHWVLEGVCL 4621          

HSP 2 Score: 72.4034 bits (176), Expect = 1.274e-11
Identity = 40/125 (32.00%), Postives = 65/125 (52.00%), Query Frame = 3
Query:   27 LWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSA 401
            LW ++DI+ +   +  F    RKLPK  +  P    L   + +F   +PLL  + N A++ RHW+ + + T  +F++  + F L N+    L K+   I +I  SAVKE  IE  +K V+  W +
Sbjct: 1441 LWVNLDIQLLQEGIDGFIKSLRKLPKDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMFAMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDS 1565          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021690.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4514.14 bits (11707), Expect = 0.000e+0
Identity = 2210/3051 (72.44%), Postives = 2579/3051 (84.53%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +   L+ LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATGEEP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   +QD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1581 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGEEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGGVSQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4617          

HSP 2 Score: 228.794 bits (582), Expect = 9.511e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1420 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1570          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021565.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4494.11 bits (11655), Expect = 0.000e+0
Identity = 2208/3053 (72.32%), Postives = 2574/3053 (84.31%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +      LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S +           Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1203 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTT----LWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTSTKD-------NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4236          

HSP 2 Score: 228.794 bits (582), Expect = 9.650e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1042 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1192          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000021598.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4487.56 bits (11638), Expect = 0.000e+0
Identity = 2208/3053 (72.32%), Postives = 2572/3053 (84.25%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+    D       L  LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S     ++D     Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1088 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMVPQPFD-------LFSLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTS-----TKD--NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4118          

HSP 2 Score: 228.409 bits (581), Expect = 1.229e-58
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct:  927 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1077          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: ENSXETT00000035049.1 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:100492041])

HSP 1 Score: 4480.24 bits (11619), Expect = 0.000e+0
Identity = 2203/3054 (72.13%), Postives = 2572/3054 (84.22%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATG--EEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQ-IDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ IL+  S EGE +ELEK V AE NVE+WL  LL  +Q SLH VIR A   I D+ F ++EFL+ +PAQVGLLGIQ++WTRD+ +AL NAK D+KIMQ+TN+ FL LLN LI  TT DL  +ER K+ETLITIHVHQ+DIFD L +  +K+P+DF+WLKQ RFYF ED D+  ++ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKERKK F+FTDGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDNIVLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP IQLDK GYPELEAAI +Q++ A +I HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ K+GEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL KR+  +  I+ +L++ SF ++YR+S+Q L YKME +EAF++ Q+ ++L+GLIP KD+    +IS  H ERLY+FS+MWSIGA+LE++DR K+E ++RS +++ LDLPKI   S+DTMFDY V+  G+W+HWN+ VEEY+YP DSTPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  NPE ++ K LNFSSAT P MFQRTIES+VDKRMG+TYGPP G+KM+VFIDDINMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FTNI+D+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF +IG GH+C +RGF  ++++ V+ LIP+TR+LW +TK KMLPTPAKFHY+FNLRDLSRIWQGM+N+  +VI +   L+ LWKHEC RVI+DRF   ED+ WF KT  + + +D  +    +S  F  D +F+DF+RDA EATG   EP+D DFDMPK+YEPI SF+QLKDRL MF  ++NESIRGAGMDMVFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLASYIAGYK FQITL+RSYN SNL+EDLK LYRTAGQQGKGI+F+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +LIP MKKEYPRRPPTN+NL EYF+SR +QNLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P +KKE++  MG   DGVAE CV+YFQR+RR THVTPKSYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN++A+ VLK VTV+  AA +VK +VQ VKDKAQ+IV+ I  DK +AE KLEAA+PAL EAE AL TIKP DIATVR LGRPPHLIMRIMDCVL+ FQR+++ +  D E+    PSW ES+KLM  N FL NL  FPKDTINEE VEL+ PY EM+DY I+ A+RVCGNVAGL SWT+AM SF+ INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT Q+   K +    L GDVL ATAFLSY GPFNQEFRN + T W++E++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+RYPLLIDPQ QGKIWIKN+E + ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVM GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  L+EDV  NK+KMKELEDNLLFRLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TEI+INSAREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+DM++ ++K EEF T IKGGASLD+     KP  WI DMTWLNLVELS L QFS +L+Q++RNEK W+ WFDKE PEEEV+P GY+  LD FRRLLL+R WCPDRT++QA+KYI DS+G K+ EG +LD +K +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQEIH+R+L+   +  GGW LLQNCHL LD+++ELMD ++ET+ IH+ FRLW+TTE+H +FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD++N+ QW+PM+YAV +LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMDIKKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MF  +F F+K ++IP  + ++ Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S GGGETRE+VV R+ DDMLGKLP+DY+ FEV ERLQ MG  QPMNIFLRQE+DRMQ++I+ VRTTL DLKLAIDGTIIM+E+LRDALD MYDARIP  W K SWESSTLGFWFTEL+ERN QFS+W+F+ RPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD+V++ N+VTK M+D+I  P SEGVYVYGLYL+GAGWDRRN KL+ESK KVLFE +PVI I A + S +           Y CP+YKKP RTDL +IA+V L+    +  DHW LR VALLCD+K
Sbjct: 1174 DSLMILGSLMSNRYNTPFKAQIQKWVHYLSNTTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQCCVGDETMGQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVRFHEKVYDRILSISSREGETIELEKHVMAEGNVEVWLNSLLKESQSSLHLVIRQAAIGIQDSGFQLIEFLSSFPAQVGLLGIQMIWTRDAEDALTNAKYDKKIMQKTNQSFLDLLNTLIDMTTKDLSSIERVKYETLITIHVHQRDIFDDLCRMHIKTPTDFEWLKQCRFYFNEDSDKMFINITDVTFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNIVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPSIQLDKAGYPELEAAIIKQVEGAGLICHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKRGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLTWSPILEGWLKKRSPQDANILRKLYSASFAELYRFSVQSLEYKMEMVEAFIIMQSINMLQGLIPSKDQ--GGEISAEHLERLYVFSLMWSIGAMLELDDRIKMEQWLRSLDSVHLDLPKIPPGSDDTMFDYYVTTEGKWMHWNTSVEEYVYPSDSTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYNPERYVTKCLNFSSATTPLMFQRTIESYVDKRMGTTYGPPTGKKMSVFIDDINMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTNIIDVQFLAAMIHPGGGRNDIPQRLKRQFSVFNCTLPSNTSIDKIFGVIGVGHFCSQRGFLVDIKEAVKKLIPMTRKLWQMTKSKMLPTPAKFHYIFNLRDLSRIWQGMLNSTSEVIKDTTVLIKLWKHECKRVIADRFTTAEDVDWFDKTQLKLVEDDFYQG--QKSGDFAVDYYFVDFLRDAPEATGIDTEPEDADFDMPKIYEPIESFNQLKDRLNMFLQIFNESIRGAGMDMVFFKDAMVHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASYIAGYKTFQITLSRSYNTSNLMEDLKVLYRTAGQQGKGISFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEITSDLIPFMKKEYPRRPPTNENLYEYFMSRVRQNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVAVSQHFLSSYDIDCTPEIKKEVVECMGSFQDGVAEKCVEYFQRYRRSTHVTPKSYLSFIQGYKAIYKEKHAEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANQKADMVLKEVTVKAQAAEKVKAEVQKVKDKAQAIVDNISADKAVAEEKLEAAKPALEEAEAALQTIKPTDIATVRTLGRPPHLIMRIMDCVLLLFQRKVNPVKLDQEKGCTIPSWQESLKLMIGN-FLQNLQQFPKDTINEEVVELLQPYFEMQDYNIETAKRVCGNVAGLCSWTKAMASFYSINKEVLPLKANLAIQESRLATANLDLQKAQAELDAKQAELDVVQAEYEKAMIEKQTLLEDADRCRHKMQTASSLISGLAGEKERWTEQNKLEKYRYFLCLSGDVLLATAFLSYSGPFNQEFRNFVLTDWRREMKARKIPFGVNLNLNEMLIDTPTISEWNLQGLPNDDLSIQNGIIVTKAARYPLLIDPQTQGKIWIKNKEIRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMNGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTDLIEDVTANKRKMKELEDNLLFRLTSTQGSLVEDESLITVLSNTKKTAEEVTQKLQISAETEIQINSAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSAKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDMQSNRVKHEEFLTLIKGGASLDLKACPAKPSKWILDMTWLNLVELSKLRQFSDILEQIARNEKLWKLWFDKEYPEEEVVPSGYDQALDCFRRLLLIRSWCPDRTIAQARKYIMDSMGSKYVEGVVLDLEKTWEESNPRTPLICFLSMGSDPTDSIIALGKKQKIETRYVSMGQGQEIHARKLLQQTMANGGWALLQNCHLGLDFLDELMDTIVETDNIHESFRLWMTTEVHRQFPITLLQMSIKFTNEPPQGLKAGLKRTYGG-NQDLLDVNNLTQWKPMLYAVGFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDIKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFTQEFCFYKGYNIPKCNTVDHYLQYIQGLPTYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSGGGGETREAVVARLADDMLGKLPADYIPFEVKERLQKMGPFQPMNIFLRQEIDRMQRIISLVRTTLTDLKLAIDGTIIMSENLRDALDCMYDARIPERWKKASWESSTLGFWFTELLERNKQFSSWIFESRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDSVIICNEVTKWMKDDITAPASEGVYVYGLYLDGAGWDRRNLKLMESKPKVLFEIMPVIRIYADNTSTKD-------NRFYSCPIYKKPVRTDLNYIAAVDLKT--VQSPDHWILRGVALLCDVK 4212          

HSP 2 Score: 228.794 bits (582), Expect = 9.236e-59
Identity = 108/151 (71.52%), Postives = 123/151 (81.46%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            VNGYYDILW DV+IEKI++EL EFQNRCRKLP+ LK+W AF DL+KTIDDF+   PLLELM+N AM  RHW+R++D+T H FDVE++ F LRNI+EAPLLK KEEIEDICISAVKEKDIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1013 VNGYYDILWSDVNIEKINSELLEFQNRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMSNKAMMARHWKRITDVTGHSFDVENETFKLRNIMEAPLLKCKEEIEDICISAVKEKDIEQKLKQVIAEWDNKTFTFANFKTRGELLLRGD 1163          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Match: nifk (nucleolar protein interacting with the FHA domain of MKI67 [Source:Xenbase;Acc:XB-GENE-940532])

HSP 1 Score: 4296.5 bits (11142), Expect = 0.000e+0
Identity = 2110/3056 (69.04%), Postives = 2527/3056 (82.69%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPSE---GVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++ +  S+ YN PFK  IQ  V KLSN++EIIE W+TVQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  N++QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLS+FDN+  V FHEK Y+ IL   S EGE + L +PV A+ NVE+WL  LLN  +++LH +IR A+ +I+D+ F + +F  MYPAQ+GLLGIQ++WTRD+ EAL  AK+DRK+MQ TN++FL LLN LI  TT DL ++ERTK+ETLITIHVHQKDIFD LV+  +KS SDF+W KQ+RFYF+ED+D+CI+ ITDV+F Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLK+ FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I HPPW+LKLIQL+ETQRVRHGMMTLGPSGAGKT CI++LMKA+TDCG PH+EMRMNPKAITA QMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+LK WL                 + P      +  L  KM+ LE   ++QA DLL+        K + Q S+ H  RL+IF+VMWSIGALLE++DR K+E +++ +++  L+LP +  D   T+F++++ ENG+W HW+ KV EY+YPKDS PEY SILVPNVDNVRTDFLM+T+  Q KAVLLIGEQGTAKTVMI  Y S  +PEYH  KSLNFSSAT+P MFQR+IES++DKRMG+TYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQL+E KGFYNLEKPG+FT++VD+QF+AAMIHPGGGRNDIPQRLKRQF +FNCTLPSNSSIDKIF  +  G++C++RGF+  V +L   L+P TR++W  TK KMLPTPAKFHY+FNLRDLSRIWQG++    +V  +   L+ L+KHEC RVISDRF+  +D  WF  T+     ED  ++I++ +     +++F+DF+RDA EATG+EP+D D + PKVYEPI SF+QL DRL ++   YNE++RG+ MD+VFF DAM HL+KISRIIRTP+GNALLVGVGGSGKQ+LT+LASYIAGY+ FQITLTR+Y  +NL++DLK LYRTAGQ+G GITF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DEI Q+LIP+MKKE+PRR PT +NL +YFLSR ++NLHVVLCFSP+GEKFR RALKFPGLISGCTMDWFQRWP+DAL+AVA H+LSS++I C   VK+ ++ +MG   D VAE CV+YF+R+RRQT+VTPKSYLSF+ GYK+IY EK ++  NL+ RM +GL KL+EA+ SV +L + LA KEK+LA+A+++A+EVL+ VT + +AA +VK +VQ VKDKAQ+IV+EI  DK  AE KLE A PAL+EAE AL TIKPADIATVRKLGRPPHLIMRIMDC L+ FQR++D +  DPER   KPSWGE++KLM+N+ FLN+L+ FPKD+I EE VEL+ PYL+MEDY ++ A++VCGNVAGL SWT+AM  FF INKEVLPLK NL  Q  +   + ++LN AQS LD KQ+EL  VQA+YD A+R+KQ LLDDAE CRRKM  A  LIEGL GEK+RWT  S  F+ QI RLVGDVL AT FLSY GPFNQE+RN+L   W+KE+ +RKIP S  LN+I ML D   +GEW+LQGLPND+LS+QNGIIVTKASR+PLLIDPQGQGKIWIKNRE   ELQVTSLNHKYFR HLED LSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF LYITTKL NP+YTPEI A+T++IDFTVTMKGLEDQLLG VI TEKQELEA+R++LME+V  NK+KM+ELEDNLLFRLTST+GSLVDDE LI+VL+ TK T+ EVS+KL +A++TE+KIN+AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD+SM RS KS +T KRI NIIE +T+EV+KY  RGLYE  K  FTLLMALK+D++A KI   EF T IKGGA+LD+N V+PKPK WI DMTWLNLV+LSNL  F+ +L QV+RNEK W+ WFD EAPEE  +PDGY+  LDTFRRLLL+R WCPDRT++QA+ YI +SLG K+AEGFILD + ++ ES  RTP+V  LSMGSDPT  IE L+K     CRAISMGQGQE+H+RRL+   +  GGW+LLQNCHL LD+M+EL+D +  TE +HD FR W+TTE+HPKFPI+ LQ S+KFTNEPPQG+KAG+KRTY+  +Q+ LD++N+ QW+P++Y VA+LHT VQERRKFGPLGWNIPYE+N AD  AS+QFVQNHLD+MD K+G++W  + YMLGE+QYGGRVTDD DK LLNTF R WF ++MF+ KF F+K + IP    ++EY+  I++LP  D+PE+FGLH NADITYQ+  A   L  I+NIQPKD+  G GETRESVV R+ ++ML KLP DY+  EV  RLQ MG +QPMNIFLRQE+DRMQ+VIA+VR+TLIDLKLAIDGTIIM+EDLRDALD+MYDARIP  W K+SWESSTLGFWFTEL+ERN QF +WLF GRPN FWMTGFFN QGFLTAMRQE TR +  KGWALD+V+L NDVT+ M++++N PP     GVY+YGL+L+GAGWDRRN KL+ES  KVLF  LPV+ + A+      ++ +     ++ CPVYKKPRRTDLT+I S++LR    +  DHWTLR +ALLCD K
Sbjct:  990 DSLMILGSIMSNRYNAPFKPTIQQWVQKLSNTTEIIENWLTVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHETPNIVQCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLSLFDNVNRVGFHEKNYDQILYFESQEGEKVNLIEPVNAQGNVEVWLGLLLNGVKKTLHTIIRQASIAISDSGFKLYDFQTMYPAQIGLLGIQMIWTRDAEEALNMAKTDRKVMQTTNQKFLDLLNDLIDMTTRDLTRMERTKYETLITIHVHQKDIFDDLVRMNIKSASDFEWQKQSRFYFIEDIDKCIIQITDVEFSYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKSKKSQFIFTDGDVVDMDREFGIFLTMNPGYAGRQELPENLKVQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPDEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPDLEAAIQKQTEEAGLIHHPPWILKLIQLYETQRVRHGMMTLGPSGAGKTKCINILMKAMTDCGAPHKEMRMNPKAITASQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPMLKAWL----------------QTLPAFQHEILWNLSPKMQILECMYIKQAIDLLQ------KSKQNKQPSQEHVARLFIFAVMWSIGALLELDDRMKMETFLQ-DHSAPLELPTVSGDQ--TIFEFVIDENGQWQHWSKKVPEYVYPKDSVPEYASILVPNVDNVRTDFLMHTIMKQGKAVLLIGEQGTAKTVMIKGYTSKYDPEYHATKSLNFSSATLPNMFQRSIESYIDKRMGTTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQKGFYNLEKPGEFTSVVDIQFVAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNSSIDKIFRTVAEGYFCEQRGFSTGVCKLASALVPTTRKIWQATKIKMLPTPAKFHYIFNLRDLSRIWQGILIIMSEVCQSTDILVALFKHECSRVISDRFIDQKDKDWFENTIA---VEDHGQEIMNNAL---KESYFVDFLRDAPEATGDEPEDADLEAPKVYEPIPSFEQLADRLDLYMQQYNEAVRGSRMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASYIAGYQSFQITLTRTYGTNNLMDDLKILYRTAGQKGCGITFIFTDNEIKDESFLEYMNNVLASGEVSNLFARDEIDEITQDLIPVMKKEHPRRAPTAENLYDYFLSRVRRNLHVVLCFSPVGEKFRTRALKFPGLISGCTMDWFQRWPRDALVAVAQHFLSSYKIECTEEVKQSVVNTMGTFQDIVAEKCVEYFERYRRQTYVTPKSYLSFIGGYKTIYGEKIEYVGNLSNRMKTGLAKLMEAEVSVNQLSKELAVKEKDLAVASKKADEVLQEVTFKAHAAEKVKMQVQKVKDKAQAIVDEIAIDKAAAEEKLEVARPALQEAEAALETIKPADIATVRKLGRPPHLIMRIMDCALLLFQRKIDPVTADPERPCVKPSWGEALKLMNNSGFLNSLLTFPKDSITEEIVELLQPYLDMEDYNLESAKKVCGNVAGLCSWTQAMAYFFGINKEVLPLKANLALQGAKLAVAQQELNNAQSQLDAKQRELDDVQAMYDAAMREKQALLDDAEACRRKMINATALIEGLGGEKIRWTESSKNFQNQITRLVGDVLLATGFLSYSGPFNQEYRNLLLQLWKKEMNSRKIPHSEDLNLISMLVDNATIGEWNLQGLPNDDLSIQNGIIVTKASRFPLLIDPQGQGKIWIKNREKNNELQVTSLNHKYFRTHLEDCLSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFALYITTKLANPAYTPEISAKTAVIDFTVTMKGLEDQLLGRVILTEKQELEAERVKLMEEVTTNKRKMQELEDNLLFRLTSTQGSLVDDESLIEVLRITKSTAEEVSEKLTVAAETEVKINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDISMDRSTKSQITSKRITNIIEYLTFEVFKYTARGLYEDHKFLFTLLMALKIDLQAKKISHNEFQTLIKGGATLDLNSVEPKPKKWILDMTWLNLVQLSNLTPFNNLLGQVARNEKNWKAWFDVEAPEEAPLPDGYDNVLDTFRRLLLIRSWCPDRTIAQARHYIAESLGVKYAEGFILDMEAMWAESDCRTPLVCFLSMGSDPTENIERLSKSKNAPCRAISMGQGQEVHARRLLNQSMQDGGWLLLQNCHLGLDFMDELLDTVTVTETVHDGFRTWITTEVHPKFPINLLQSSVKFTNEPPQGVKAGLKRTYSGISQELLDVTNLPQWKPLLYGVAFLHTTVQERRKFGPLGWNIPYEFNQADFAASIQFVQNHLDEMDTKRGVNWSCLRYMLGEVQYGGRVTDDMDKTLLNTFARVWFGENMFSDKFCFYKGYGIPKGKTIDEYLQYIDQLPLVDTPEVFGLHGNADITYQTNMANETLSTIVNIQPKDSGGGAGETRESVVQRLANEMLEKLPEDYIPHEVKARLQKMGPIQPMNIFLRQEIDRMQRVIARVRSTLIDLKLAIDGTIIMSEDLRDALDNMYDARIPKLWYKISWESSTLGFWFTELLERNQQFRSWLFDGRPNQFWMTGFFNPQGFLTAMRQETTRMNLSKGWALDSVILHNDVTRMMKEDVNAPPPADIGGVYIYGLFLDGAGWDRRNMKLVESSPKVLFTNLPVVHVYAVSTMNPADLKKQ-QGYLHACPVYKKPRRTDLTYIFSLFLRS--IEVPDHWTLRGIALLCDSK 4011          

HSP 2 Score: 220.32 bits (560), Expect = 3.200e-56
Identity = 103/151 (68.21%), Postives = 125/151 (82.78%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            ++NGYY+ILW D+DIEKI+ EL +FQNR RKLPK LK+W AF DL+K IDDF+   PLLE+M N AM  RHW+R+S LT H FDVES+ F+L+NI+EA LLK+KE+IEDICISAVKEKDIEAKLK+V +EWSAH   F  FK+RGELLL+G
Sbjct:  828 NINGYYEILWTDLDIEKINTELMDFQNRIRKLPKALKEWQAFNDLKKKIDDFSESCPLLEMMANKAMMNRHWERISQLTGHKFDVESESFSLKNIMEASLLKYKEDIEDICISAVKEKDIEAKLKSVISEWSAHCFTFTQFKSRGELLLKG 978          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah5 (dynein, axonemal, heavy chain 5 [Source:MGI Symbol;Acc:MGI:107718])

HSP 1 Score: 4426.7 bits (11480), Expect = 0.000e+0
Identity = 2180/3043 (71.64%), Postives = 2556/3043 (84.00%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQA-DHWTLRAVALLCDIK 9580
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF++EV+  +  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++ D +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L PIMKKE+PRRPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  D ++    PSW ES+KLM+   FL NL  FPKDTINEE +E ++PY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF   LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E+Q ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVM GF+LYITTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLG VI TEKQELE +R  L+EDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+ +TEI+INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++   +K EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+SRNEK WR WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GE +AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGWVLLQNCHL LD+++ELMD + ETE +HD FRLW+TTE+H +FPI+ LQMSIKF NEPPQG++AG++RTY   +QD LD+S   QW+PM+YAVA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD+S GG ETRE+VV R+ DDML KLP DY  FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLA+DGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTEL+ERN QF++W+  GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E   +RD    +Y CP+YKKP RTDL +IA+V L+   T QA +HW LR VALLCD+K
Sbjct: 1595 NRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARD--PRLYCCPIYKKPVRTDLNYIAAVDLK---TAQAPEHWVLRGVALLCDVK 4621          

HSP 2 Score: 213.386 bits (542), Expect = 2.994e-54
Identity = 102/152 (67.11%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGD 1573          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4200.2 bits (10892), Expect = 0.000e+0
Identity = 2071/3052 (67.86%), Postives = 2506/3052 (82.11%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.249e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4200.2 bits (10892), Expect = 0.000e+0
Identity = 2071/3052 (67.86%), Postives = 2506/3052 (82.11%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.249e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 4200.2 bits (10892), Expect = 0.000e+0
Identity = 2071/3052 (67.86%), Postives = 2506/3052 (82.11%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 2.249e-56
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1890.16 bits (4895), Expect = 0.000e+0
Identity = 1127/3082 (36.57%), Postives = 1731/3082 (56.16%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTD---CGEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE-RPI--MLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY--ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGE-WVHWNSKV-EEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKN-------KVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLN-HKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIE---TEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQ-DFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND-DMFNPKFRF--FKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPK-DASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNC-FWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDE-INQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLT----FIASVYLRCPPTKQADHWTLRAVALLCDI 9577
            F+KD+      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F  ++ +W  IM R +++ N L+       L  L+       +I QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK +K  +      ++E +   +S +GE ++   PV  E  VE WL  +    + +L  ++R    ++        +++  +  QV +   Q+ WT D T+ L+ AK  SD+KI++ +                    K+ R K   L+TI +H +D+ ++L K  +   S FDWL Q RFY+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +D++ +GR++ GL+QSG+WGCFDEFNRI++ VLSV AQQI  +LS       +F F +G  +++    GIF+TMNPGYAGR ELPENLK  FR +AM+VPD  +I  + L   GF +  +LA+K YTLY L  +QL++Q HYDFGLR + S+LR  G+++R  P  +++  ++  +RDMN++KL   D PLF +++ DLFP I+L    Y +L   I ++I E  +   P  + K++QL+ET+  RH  M +G +G+ KT    +L  +LT     GEP+    RE  +NPKA++  +++G  D++TN+WTDGI S++ R     +K +  W++ DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV N+  ASPATVSR GMVY     L W P ++ WL KR   E  P+  M E F N      + +   L+      E   +   C L   L   ++  + +      +  E  ++FS++WS+ A ++ + R K+++Y+R    I+   P     ++DT+++Y V+     W  +  K+ + + YP ++ P Y  I+VP VD VR ++L++T+ + +  VLL+G  GT KT +    L S          +N S+ T     Q  IES V+KR    Y P  G+ M  F+DD+NMP  + +G Q   E++R  ++  GF+         +I DM  MAAM  PGGGR  I  RL+ +F I N T P+ S I +IF   GT    K + F +EV+ +   +   T  ++     + LPTPAK HY+FNLRD+S+++QGM+    D      ++  LW HEC RV SDR V   D+  F+  L   L    DL+   +  ++       F DF+++                PKVYE +     LK  ++     YN S     M +V F +A+ H+ +I R+I  PRGN LLVG+GGSG+Q+L +LAS I  Y  FQI +T+ Y      +D+K LYR AG + +  +FLF D +I DE FLE +NN+LSSG V NL+  DE +EI   +I   + E  + P ++D+L  Y + R + NLH+VLC SP+G+ FRN   ++P L++  T++WF  WP++AL+ VA  Y+   ++     + +++      +H  VA+         RR  +VTP +YL  ++GYK +  EK     + A ++ +GL K+ E +E V  +   L + +K++A   ++ EE L  +  QK  A+E +        K+ + + K Q++ +  ++D + A        PAL EA  AL ++   DI  ++  GRPP  +  +M  V+I                  +P+W E+ + +    F+ +LINF KD I+++ ++ I  Y    D+  D+  RV      L  W RAM  +  + + V P +  +     + ++    L  AQ  L E  ++L  ++  YDE L +K+ L   +E    K+  A  L+ GLAGEK RW       +  +  LVGD L A AFLSY GPF   +R+ I+N  W +++R  ++P S    I + LT+PT + +W++QGLP+D  S +NGIIVT+ +R+ L+IDPQGQ   WIKN E  + L++  L  H Y R  LE ++  G P+L++++ E LDP L+ VL K+  + G    +++GDKEV+    F  Y+TTKL NP Y PE  A+T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   K+K+KELED +L  L    GSL+DD  L+  L+T+K+T+ EV+++L  +  TEI I+ ARE YRP A R S+L+F++ +M  ++ MYQ SL  ++GLF LS+ +S +S   + RI+ + +  TY V++Y  R L+E  K+ F+  M  K+   +GK+ ++E++ F++GG  LD       P  +W+ D  W N+ EL  L  F  +++   +  + W  W+   +PE+ ++P  +    +  +R+L+VR    DR       +I  +LG +F E  +L+   V E+S PR+P+V +LS G DPT  +  LA+   +  R  A+S+GQGQ   + RL+   +  G WV L NCHLSL +M  L D+++E    E  H  FRLW+++  HP FPIS LQ SIK T EPP+G+KA + R Y    +  F   S   +++ +++A+ + H+ + ER+KF  LGWNI Y +N +D   S   +  +LD+ +      W  + Y++  + YGG VTDD+D+RLL T+   +F D  +  P +R      + IP    L  Y + I+ LP+ D PE FG H NAD+  Q   A+++ + +L++QP+   +  GG++RE  V  +  D+  K+P + + +E   +L  +    P+N+ L QE+ R  K++  +  +L DL+  I G I+M+  L +  + ++DA +P  W KV      L  W  +L  R  QF TW  + RP   FW++GF    GFLTA+ Q   R     ++D++  W  +   + D  +  PP +GV+V GLYLEGAGWDR+NS L+E+      EP+ ++ +      +  E  +   K MY CP Y  P R   T    F+  + LR   +  +DHW  R  ALL  +
Sbjct: 1457 FEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDI-QKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAV-GMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVKDWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEAIRGNLT------KIMRLKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYF-EGFEINLVWSCGIFITMNPGYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGKKRRLQPDLSDEEVLLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNELV---PVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLRE---IEGSFP-----NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNA-PFY-KIMVPTVDTVRYNYLVSTLVANQNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESRVEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDY-GFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIF---GTMINQKLQDFEEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNK---RPPIFGDFLKE----------------PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAE--QIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEA-------LPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMIL--------------RGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRV-LEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNL-DKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYE---ETPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQITPTRVGGQSREEKVLELAADVKQKIP-EMIDYEGTRKLLALDP-SPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFWLSGFTFPTGFLTAVLQSAAR-QNNISVDSLS-WEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEA------EPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRS-GSMTSDHWIKRGTALLMSL 4454          

HSP 2 Score: 77.0258 bits (188), Expect = 5.096e-13
Identity = 42/126 (33.33%), Postives = 66/126 (52.38%), Query Frame = 3
Query:   84 RCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            R  +L K  KD  W   E  R  I+ F   +PL+  + NPA++ RHW ++ +     FD ES+ F L  I++  + +  E+I +I  SA KE  IE  L+ +   W + +L    +K++G   LRG
Sbjct: 1305 RLTRLAKEYKDRNWEIIETTRSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMDQHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRG 1430          
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q8TE73|DYH5_HUMAN (Dynein heavy chain 5, axonemal OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3)

HSP 1 Score: 4427.08 bits (11481), Expect = 0.000e+0
Identity = 2181/3042 (71.70%), Postives = 2547/3042 (83.73%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSED--IVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  +V+QCCVGDETL QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +T F + EFL+ +PAQVGLLGIQ++WTRDS EAL NAK D+KIMQ+TN+ FL LLN LI  TT DL   ER K+ETLITIHVHQ+DIFD L    +KSP DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP DTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELEAAI+RQ++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSGAGKT CIH LM+A+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L KR+  E  I+ +L+T SFPD+YR+ IQ L YKME LEAFV+ Q+ ++L+GLIP K++    ++S+ H  RL++F+++WS GA LE++ R +LE ++RS     L+LP       DT FDY V+ +G W HWN++ +EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM KSLNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMTVFIDD+NMP+INEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS +S+DKIF +IG GHYC +RGF++EVR  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSR+WQGM+NT  +VI     LL LWKHEC RVI+DRF    D++WF K L   + E+  E+  ++    +   D +F+DF+RDA EA GE  ++ D + PK+YEPI SF  LK+RL MF  LYNESIRGAGMDMVFF DAM HL+KISR+IRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIKDE FLEYMNNVLSSG VSNLFARDE+DEI  +L  +MKKE+PR  PTN+NL +YF+SR +QNLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+L+S++I C+  +KKE++  MG   DGVAE CVDYFQRFRR THVTPKSYLSF+ GYK IY EK      LA RM++GL+KL EA ESVA L + L  KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKD+AQ+IV+ I +DK IAE KLEAA+PAL EAE AL TI+P+DIATVR LGRPPHLIMRIMDCVL+ FQR++  +  D E++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQTLL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E++ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLE+NFIK GSTFKVKVGDKEVDV+ GF LYITTKLPNP+YTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELE +R  LMEDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+++TE++INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++  ++K EEF T IKGGASLD+    PKP  WI D+TWLNLVELS L QFS VLDQ+SRNEK W+ WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GEK+AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL LD+M+ELMD +IETE++HD FRLW+TTE H +FPI+ LQMSIKF N+PPQG++AG+KRTY+  +QD LD+S+  QW+PM+YAVA+LH+ VQERRKFG LGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW TI YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD S GG ETRE+VV R+ DDML KLP DYV FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLAIDGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTELIERNSQF++W+F GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E    RD     Y CP+YKKP RTDL +IA+V LR   T   +HW LR VALLCD+K
Sbjct: 1598 NRYNMPFKAQIQKWVQYLSNSTDIIESWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEVPSVVQCCVGDETLGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKIYDRILSISSQEGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQETGFQLTEFLSSFPAQVGLLGIQMIWTRDSEEALRNAKFDKKIMQKTNQAFLELLNTLIDVTTRDLSSTERVKYETLITIHVHQRDIFDDLCHMHIKSPMDFEWLKQCRFYFNEDSDKMMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPMDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELEAAISRQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSILDWSPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQGLIPLKEQ--GGEVSQAHLGRLFVFALLWSAGAALELDGRRRLELWLRSRPTGTLELPP-PAGPGDTAFDYYVAPDGTWTHWNTRTQEYLYPSDTTPEYGSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGFMSKYDPECHMIKSLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMTVFIDDVNMPIINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSEASVDKIFGVIGVGHYCTQRGFSEEVRDSVTKLVPLTRRLWQMTKIKMLPTPAKFHYVFNLRDLSRVWQGMLNTTSEVIKEPNDLLKLWKHECKRVIADRFTVSSDVTWFDKALVSLVEEEFGEEKKLLVDCGI---DTYFVDFLRDAPEAAGETSEEADAETPKIYEPIESFSHLKERLNMFLQLYNESIRGAGMDMVFFADAMVHLVKISRVIRTPQGNALLVGVGGSGKQSLTRLASFIAGYVSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKDESFLEYMNNVLSSGEVSNLFARDEIDEINSDLASVMKKEFPRCLPTNENLHDYFMSRVRQNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLTSYDIDCSLEIKKEVVQCMGSFQDGVAEKCVDYFQRFRRSTHVTPKSYLSFIQGYKFIYGEKHVEVRTLANRMNTGLEKLKEASESVAALSKELEAKEKELQVANDKADMVLKEVTMKAQAAEKVKAEVQKVKDRAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIRPSDIATVRTLGRPPHLIMRIMDCVLLLFQRKVSAVKIDLEKSCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMPDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLVVQENRHLLAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQTLLEDAERCRHKMQTASTLISGLAGEKERWTEQSQEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLNDWRKEMKARKIPFGKNLNLSEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESRNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLERNFIKTGSTFKVKVGDKEVDVLDGFRLYITTKLPNPAYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEKERTHLMEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIVVLSNTKRTAEEVTQKLEISAETEVQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVYKYAARGLYEEHKFLFTLLLTLKIDIQRNRVKHEEFLTLIKGGASLDLKACPPKPSKWILDITWLNLVELSKLRQFSDVLDQISRNEKMWKIWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIVDSMGEKYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLDFMDELMDIIIETELVHDAFRLWMTTEAHKQFPITLLQMSIKFANDPPQGLRAGLKRTYSGVSQDLLDVSSGSQWKPMLYAVAFLHSTVQERRKFGALGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTIRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFSFYQGYNIPKCSTVDNYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDTSGGGDETREAVVARLADDMLEKLPPDYVPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAIDGTIIMSENLRDALDCMFDARIPAWWKKASWISSTLGFWFTELIERNSQFTSWVFNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKWMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIYA-----ENNTLRD--PRFYSCPIYKKPVRTDLNYIAAVDLRTAQT--PEHWVLRGVALLCDVK 4624          

HSP 2 Score: 218.009 bits (554), Expect = 9.567e-55
Identity = 102/152 (67.11%), Postives = 119/152 (78.29%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDILW +V+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE M + AM  RHW+R++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V  EW      FG+FK RGELLLRGD
Sbjct: 1425 TVNSYYDILWSEVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKIIDDFSECCPLLEYMASKAMMERHWERITTLTGHSLDVGNESFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTFTFGSFKTRGELLLRGD 1576          
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q8VHE6|DYH5_MOUSE (Dynein heavy chain 5, axonemal OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2)

HSP 1 Score: 4426.7 bits (11480), Expect = 0.000e+0
Identity = 2180/3043 (71.64%), Postives = 2556/3043 (84.00%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQA-DHWTLRAVALLCDIK 9580
            + YN+PFK  IQ  V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I +  F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+PTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  + ++   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D+ DTMFDY V+ NG W HW+    EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE HM K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF++EV+  +  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++ D +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L PIMKKE+PRRPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  D ++    PSW ES+KLM+   FL NL  FPKDTINEE +E ++PY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD KQ EL  VQA Y++A+ +KQTLL+DA+ CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   W+KE++ RKIPF   LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKASRYPLLIDPQ QGKIWIKN+E+Q ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GSTFKVKVGDKEVDVM GF+LYITTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLG VI TEKQELE +R  L+EDV  NK++MKELEDNLL+RLTST+GSLV+DE LI VL  TK T+ EV+QKL I+ +TEI+INSAREEYRPVATRGSILYFLI EM LVN MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV+KYA RGLYE  K  FTLL+ LK+D++   +K EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+SRNEK WR WFDKE PEEE +P+ Y+ +LD FRRLLL+R WCPDRT++QA+KYI DS+GE +AEG ILD +K +EES PRTP++ LLSMGSDPT +I  L K+ K+E R +SMGQGQE+H+R+L+   +  GGWVLLQNCHL LD+++ELMD + ETE +HD FRLW+TTE+H +FPI+ LQMSIKF NEPPQG++AG++RTY   +QD LD+S   QW+PM+YAVA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD+KKG+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF+++MF P F F++ ++IP  S ++ Y+  I  LP YDSPE+FGLH NADITYQSK A+ +LD IL IQPKD+S GG ETRE+VV R+ DDML KLP DY  FEV ERLQ MG  QPMNIFLRQE+DRMQ+V++ VR+TL +LKLA+DGTIIM+E+LRDALD M+DARIP+ W K SW SSTLGFWFTEL+ERN QF++W+  GRP+CFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VTK M+D+I+ PP+EGVYVYGLYLEGAGWD+RN KLIESK KVLFE +PVI I A     E   +RD    +Y CP+YKKP RTDL +IA+V L+   T QA +HW LR VALLCD+K
Sbjct: 1595 NRYNMPFKAQIQKWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQEPGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALRNAKFDKKIMQKTNQAFLELLNMLIEITTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTTCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEVLEAFVITQSTHMLQGLIPPKEQ--AGEVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDAGDTMFDYYVAPNGTWRHWSLCTPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHMVKNLNFSSATTPVMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQSGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGAGYYCAQRGFSEEVQDALIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KAPVVDCGVDAYFVDFLRDAPEATGETPEEADAEMPKLYEPIASLNHLRERLSVFLQLYNESIRGTGMDMVFFIDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTPIMKKEHPRRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYTIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHMEVQSLANRMNTGLEKLKEASESVAALSKELAGKEKELQVANEKADTVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNAVKIDVDKGCTMPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLNPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHILAMQDLQKAQAELDAKQAELDVVQAEYEQAMAEKQTLLEDADRCRHKMQTASTLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRDLLLHDWKKEMKARKIPFGNGLNLNEMLIDAPTISEWNLQGLPNDDLSIQNGIIVTKASRYPLLIDPQTQGKIWIKNKESQNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTFKVKVGDKEVDVMDGFKLYITTKLPNPAYTPEISARTSIIDFTVTVKGLEDQLLGRVILTEKQELEKERTHLLEDVTANKRRMKELEDNLLYRLTSTQGSLVEDESLIIVLSNTKKTAEEVTQKLEISGETEIQINSAREEYRPVATRGSILYFLITEMRLVNEMYQTSLRQFLGLFDLSLARSVKSPITSKRIANIIEHMTYEVFKYAARGLYEEHKFLFTLLLTLKIDIQRNLVKHEEFLTLIKGGASLDLKACPPKPSKWILDMTWLNLVELSKLKQFSDILDQISRNEKMWRVWFDKENPEEEPLPNAYDKSLDCFRRLLLIRSWCPDRTIAQARKYIMDSMGENYAEGVILDLEKTWEESDPRTPLICLLSMGSDPTDSIIALGKRLKIETRYVSMGQGQEVHARKLLHQTMANGGWVLLQNCHLGLDFLDELMDVVTETETVHDTFRLWITTEVHKQFPITLLQMSIKFANEPPQGLRAGLRRTYGGVSQDLLDVSVGAQWKPMLYAVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDVKKGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSENMFGPDFTFYQGYNIPKCSTVDGYLQYIQSLPAYDSPEVFGLHPNADITYQSKLAKDVLDTILGIQPKDSSGGGDETREAVVARLADDMLEKLPEDYSPFEVKERLQKMGPFQPMNIFLRQEIDRMQRVLSLVRSTLTELKLAVDGTIIMSENLRDALDCMFDARIPARWKKASWVSSTLGFWFTELLERNCQFTSWVSNGRPHCFWMTGFFNPQGFLTAMRQEITRANKGWALDNMVLCNEVTKFMKDDISAPPTEGVYVYGLYLEGAGWDKRNMKLIESKPKVLFELMPVIRIFA-----ENNTARD--PRLYCCPIYKKPVRTDLNYIAAVDLK---TAQAPEHWVLRGVALLCDVK 4621          

HSP 2 Score: 213.386 bits (542), Expect = 2.094e-53
Identity = 102/152 (67.11%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW DV+IEKI+NEL EFQNRCRKLP+ LKDW AF DL+KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KL+ V  EW    L F  FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSDVNIEKINNELLEFQNRCRKLPRALKDWQAFLDLKKTIDDFSECCPLLEYMASNAMVERHWQRITALTGHSLDVGNETFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLRQVINEWDNKTLTFSGFKTRGELLLRGD 1573          
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q96JB1|DYH8_HUMAN (Dynein heavy chain 8, axonemal OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2)

HSP 1 Score: 4214.45 bits (10929), Expect = 0.000e+0
Identity = 2076/3052 (68.02%), Postives = 2503/3052 (82.01%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ I+A  S EGE + L+  V A+  VEIWL+ LL M   SLH +IR+A   I+D+ F +L FL+ +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KSP+DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E + VMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL+ A+  Q+    +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMKA T+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+PSCK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR + E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S +  +H  +L++F +MWS+GALLE+E R KLEA++R + + KLDLP+I K S  TM+++ V++ G+W HWN K++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKR+GSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  ++ +++ NL+ + R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +   +  TLL L+KHEC RVI+DRF+  ED  WF   L R + E++  D  S       + +F+DF+R+  E TG+EP+D+ F++PK+YE + SFD L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L++LAS+IAGY+IFQITLTRSYN++NL +DLK LY+ AG  GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF+SR+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWP++ALIAVA ++LS + IVC+  +K++++ +MG+ HD V+E+C  YFQR+RR+ HVTPKSYLSF+ GYK+IY EK    +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ ++KN+VQ VKDKAQ IV+EI+ +K  AESKLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE++  KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM  F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+ +K  LL+DA+TCR+KM AA+ LI+GL+GEK+RWT QS EFKAQI+RLVGD+L  T FLSY GPFNQ FRN +L   W+ ELR RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+TFKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELEA+R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+TTK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K  EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT  +LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES  RTP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ +I TE   D FR+W+TTE H +FPI+ LQ S+KFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA ++L+ I NIQPK++  G GETRE++VYR+ +DML KLP DY+  EV  RL  MG L  MNIFLRQE+DRMQ+VI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP EGVY+YGLY++GA WDRRN KL+ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1453 DSLMVLGSLLSNRYNAPFKKNIQNWVYKLSTSSDIIEEWLVVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVINCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRIMAVISREGEKIVLDNSVMAKGPVEIWLLDLLKMQMSSLHNIIRSAFYQISDSGFQLLPFLSHFPAQVGLLGIQMLWTHDSEEALRNAKDDRKIMQVTNQKFLDILNTLISQTTHDLSKFDRVKFETLITIHVHQRDIFDDLVKMHIKSPTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSIVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSNTYAELQNAVAHQVQIEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPSCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLEGLIPSKEEGGVSCVEHLH--KLFVFGLMWSLGALLELESREKLEAFLRQHES-KLDLPEIPKGSNQTMYEFYVTDYGDWEHWNKKLQPYYYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRIGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNASIDKIFGIIGCGYFDPCRSFKPQICEMIVNLVSVGRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTIKAEECASIPTLLSLFKHECSRVIADRFITPEDEQWFNAHLTRAVEENIGSDAAS---CILPEPYFVDFLREMPEPTGDEPEDSVFEVPKIYELMPSFDFLAEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLIKISRIIRTSCGNALLVGVGGSGKQSLSRLASFIAGYQIFQITLTRSYNVTNLTDDLKALYKVAGADGKGITFIFTDSEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFISRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPREALIAVASYFLSDYNIVCSSEIKRQVVETMGLFHDMVSESCESYFQRYRRRAHVTPKSYLSFINGYKNIYAEKVKFINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKIKNEVQEVKDKAQKIVDEIDSEKVKAESKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKSCCKPSWGESLKLMSATGFLWSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMAIFYGINREVLPLKANLAKQEGRLAVANAELGKAQALLDEKQAELDKVQAKFDAAMNEKMDLLNDADTCRKKMQAASTLIDGLSGEKIRWTQQSKEFKAQINRLVGDILLCTGFLSYLGPFNQIFRNYLLKDQWEMELRARKIPFTENLNLISMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIHEELDPALDNVLEKNFIKSGTTFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELEAERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRTTKQTAAEVSEKLHVAAETEIKINAAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHREFQALIKGGAALDLKACPPKPYRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKSWFDKDAPEEEIIPDGYNDSLDTCHKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTRTPLICFLSMGSDPTNQIDALAKKLKLECRTISMGQGQEVHARKLIQMSMQQGGWVLLQNCHLGLEFMEELLETLITTEASDDSFRVWITTEPHDRFPITLLQTSLKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWNTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPLCKTLDQYFEYIQSLPSLDNPEVFGLHPNADITYQSNTASAVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPDYIPHEVKSRLIKMGHLNSMNIFLRQEIDRMQRVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEITSPPGEGVYIYGLYMDGAAWDRRNGKLMESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4490          

HSP 2 Score: 224.557 bits (571), Expect = 1.076e-56
Identity = 106/151 (70.20%), Postives = 122/151 (80.79%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLPKGLKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1291 SISGYYEILWGDVDIEKINAELLEFQNRCRKLPKGLKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDSFCLRNIMEAPLLKHKDDIEDICISAIKEKDIEAKLTQVIENWTNQNLSFAAFKGKGELLLKG 1441          
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Match: sp|Q91XQ0|DYH8_MOUSE (Dynein heavy chain 8, axonemal OS=Mus musculus OX=10090 GN=Dnah8 PE=1 SV=2)

HSP 1 Score: 4200.2 bits (10892), Expect = 0.000e+0
Identity = 2071/3052 (67.86%), Postives = 2506/3052 (82.11%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ+ V KLS SS+IIE+W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRF NIDKSWIKIM RAHEN NV+ CCVGDET+ QLLPHL EQLE+CQKSLTGYLEKKRLLFPRFFFVSDP LLEILGQASD HTIQ HL +V DNI  V FH K Y+ + A  S EGE + L+ PV A+  VEIWL+ LL +   SLH +IR+A   I+D+ F +L FLN +PAQVGLLGIQ+LWT DS EAL NAK DRKIMQ TN++FL +LN LI QTT DL K +R KFETLITIHVHQ+DIFD LVK  +KS +DF+WLKQ+RFYF ED+D+ +VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITLAQALGM+MGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ +KERKKQF+F+DGD VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGF++N++LA+KFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG QKRA P D+E +TVMR LRDMNLSKLVD+DEPLF+SLINDLFPG+QLD   Y EL++A++ Q++   +I+HPPW LKL+QL+ET  VRHG+MTLGPSG+GKT  I +LMK+LT+CG PHREMRMNPKAITAPQMFGRLD +TNDWTDGIFSTLWR+TLK KKGE+I+L+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FEVHNI+NASPATVSR GMVY+SSSAL W P+L+ WL KR+  E  + L L+   F D Y Y    L  KM+ LE   + Q+ +LLEGLIP K+E   S  S  H  +L++F +MWS+GALLE++ R KLE ++R + + KL+LP+I K S+ TM+++ V++ G+W HWN +++ Y YP DS PEY SILVPNVDN+RT+FL++T+A Q KAVLL GEQGTAKTVM+  YL   +PE  + KSLNFSSAT P MFQRTIES+VDKRMGSTYGPP GRKMTVFIDDINMPVINEWGDQI NEIVRQ++E++G Y+L+KPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF +FNCTLPSN+SIDKIF IIG G++   R F  E+  +V NL+ ++R LW  TK KMLPTP+KFHY+FNLRDLSRIWQGM+  + +  ++   LL L+KHEC RVI+DRF+  +D  WF   L R + E++S ++ +       + +F+DF+RD  E TG+EP+DT F++PK+YE + SF+ L ++L+ ++  +NE IRG  +D+VFF DAMTHL+KISRIIRT  GNALLVGVGGSGKQ+L+KLAS+IAGY+IFQITLTRSYN+SNL+EDLK LY+ AG +GKGITF+FTD EIKDE FLEY+NN+LSSG +SNLFARDEMDEI Q LI +MK+E PR PPT DNL EYF++R+++NLHVVLCFSP+GEKFR R+LKFPGLISGCTMDWF RWPK+ALIAVA ++L  + IVC+   K+ ++ +MG+ HD V+E+C +YFQR+RR+ HVTPKSYLSF+ GYKSIY +K  + +  A+RM+ GL KL+EA ESVA+L + LA KEKELA+A+ +A+EVL  VTV   A+ +VKN+VQ VKDKAQ IV+EI+ +K  AE+KLEAA+PAL EAE ALNTIKP DIATVRKL +PPHLIMRIMDCVL+ FQ+++D +  DPE+   KPSWGES+KLMS   FL +L  FPKDTINEETVEL+ PY  M+DYT + A++VCGNVAGLLSWT AM+ F+ IN+EVLPLK NL KQ+ R   +  +L  AQ++LDEKQ EL KVQA +D A+++K  LL+DA+ CR+KM AA+ LI+GL+GEK+RWT QS EFK QI+RLVGDVL  T FLSY GPFNQ FRN +L   W+ EL+ RKIPF+ +LN+I ML DP  +GEW LQGLP D+LS+QNGIIVTKA+RYPLLIDPQ QGK WIK++E + +LQVTSLNHKYFR HLEDSLSLGRPLLIEDI EELDPALDNVLEKNFIK G+ FKVKVGDKE D+M  F+LYITTKLPNP++TPEI A+TS+IDFTVTMKGLE+QLL  VI TEKQELE++R++L+EDV  NK+KMKELEDNLL++L++TKGSLVDDE LI VL+ TK T+AEVS+KL +A++TEIKIN+A+EE+RP ATRGSILYFLI EMS+VNIMYQTSL QFL LFD SM+RS+KSP+ QKRI NIIE +TYEV+ Y+VRGLYE+ K  F LLM LK+D++ G +K +EF   IKGGA+LD+    PKP  WI DMTWLNLVELS L QF+ +++Q+SRNEK W+ WFDK+APEEE+IPDGYN +LDT R+LLL+R WCPDRT+ QA+KYI DSL EK+ E  IL+ +K +EES   TP++  LSMGSDPT  I+ LAKK K+ECR ISMGQGQE+H+R+L+   +  GGWVLLQNCHL L++MEEL++ ++ TE   D FR+W+TTE H +FPI+ LQ SIKFTNEPPQG++AG+KRT+   NQD LDISN+  W+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N+AD +AS+QF+QNHLD+ DIKKG+SW T+ YM+GE+QYGGRVTDD+DKRLLN F R WF++ MF P F F+  + IP    L++Y + I  LP+ D+PE+FGLH NADITYQS TA  +L+ I NIQPK++  G GETRE++VYR+ +DML KLP +YV  EV  RL  MG L  MNIFLRQE+DRMQKVI+ +R++L DLKLAI+GTIIM+E+LRDALD+MYDARIP  W +VSW+SSTLGFWFTEL+ERN+QFSTW+F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTV + N+V +  ++EI  PP+EGVY+YGLY++GA WDRRN KL ES  KVLF  LPV+ I AI+ +   +        +Y CP+YKKPRRTDLTFI  VYLR       DHW LR VALLCDIK
Sbjct: 1694 DSLMVLGSLLSNRYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHEQLEVCQKSLTGYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQPHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIMLDTPVMAKGPVEIWLLDLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQVGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETLITIHVHQRDIFDDLVKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMNMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQVHYDFGLRNILSVLRTLGSQKRARPEDSELSTVMRGLRDMNLSKLVDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQLYETSLVRHGLMTLGPSGSGKTTVITILMKSLTECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLFEVHNIENASPATVSRMGMVYISSSALSWRPILQAWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQSLNLLEGLIPSKEEGGVS--SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGS-KLNLPEIPKGSQQTMYEFYVTDYGDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTNFLIDTIAKQHKAVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQRTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFGIIGCGYFDPCRKFRPEICDMVGNLVSVSRVLWQWTKVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAAN---ILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPRHPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELSKLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTISMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKKGVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVTIHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKD------PKLYVCPIYKKPRRTDLTFITVVYLRT--VLSPDHWILRGVALLCDIK 4731          

HSP 2 Score: 220.705 bits (561), Expect = 1.573e-55
Identity = 104/151 (68.87%), Postives = 121/151 (80.13%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            S++GYY+ILWGDVDIEKI+ EL EFQNRCRKLP+ LKDW AF DL+K IDDF+   PLLE+MTN AMK RHW R+S+LT   FDVESD F LRNI+EAPLLK K++IEDICISA+KEKDIEAKL  V   W+   L F  FK +GELLL+G
Sbjct: 1532 SISGYYEILWGDVDIEKINAELQEFQNRCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDRISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIEDICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKG 1682          
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Match: sp|M0R8U1|DYH5_RAT (Dynein heavy chain 5, axonemal (Fragment) OS=Rattus norvegicus OX=10116 GN=Dnah5 PE=1 SV=1)

HSP 1 Score: 2749.93 bits (7127), Expect = 0.000e+0
Identity = 1360/1882 (72.26%), Postives = 1593/1882 (84.64%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQ 6100
            + YN+PFK  IQ+ V  LSNS++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRL FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTVKFH+K Y+ IL+  S EGE +EL+KPV AE NVE+WL  LL  +Q SLH VIR A  +I ++ F ++EFL+ +PAQVGLLGIQ+LWTRDS EAL NAK D+KIMQ+TN+ FL LLN+LI+ TT DL  +ER K+ETLITIHVHQ+DIFD L    VKSP+DF+WLKQ RFYF ED D+ ++ ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI+++L+CKKE KK F+FTDGD V MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGFIDN+VLARKF+TLY+LCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+ TDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFP I LDK GYPELE AI++Q++EA +I+HPPW LK+IQLFETQRVRHGMMTLGPSG+GKT+CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS LDW P+L+G+L +R+  E  I+ +L+  +FPD+YR+SIQ L +KME LEAFV+ Q+  +L+GLIP K++  +  +   H  RL++F++MWS+GA+LE+E R ++E ++RS     L LP++  D  DTMFDY V+ +G W HW+  + EY+YP D+TPEYGSILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  ++S  +PE H  K+LNFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KM VFIDD+NMPVINEWGDQ+ NEIVRQL+E  GFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPS++S+DKIF +IG G+YC +RGF+ EV+  V  L+P+TRRLW +TK KMLPTPAKFHYVFNLRDLSRIWQGM+N   +VI +   LL LWKHEC RVI+DRF    D++WF K +   + E+  E+   ++ V +   DA+F+DF+RDA EATGE P++TD +MPK+YEPIAS + L++RL +F  LYNESIRG GMDMVFF DAM HL+KISR+IRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN SNL+EDLK LYRTAGQQGKGITF+FTD EIK+E FLEYMNNVLSSG VSNLFARDE+DEI  +L  IMKKE+P+RPPTNDNL EYF+SR + NLH+VLCFSP+GEKFRNRALKFP LISGCT+DWF RWPKDAL+AV+ H+LSS+ I C   +KKEL+  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK IY+EK     +LA RM++GL+KL EA ESVA L + LA KEKEL +AN +A+ VLK VT++  AA +VK +VQ VKDKAQ+IV+ I +DK IAE KLEAA+PAL EAE AL TIKP+DIATVR LGRPPHLIMRIMDCVL+ F RR++ +  D +++   PSW ES+KLM+   FL NL  FPKDTINEE +E +SPY EM DY I+ A+RVCGNVAGL SWT+AM SFF INKEVLPLK NL  Q+ R+  +M+DL  AQ+ LD+KQ EL  VQA Y++A+ +KQ
Sbjct: 1595 NRYNMPFKAQIQNWVQCLSNSTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEIPNVVQCCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLCFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVKFHDKIYDRILSISSREGETIELDKPVMAEGNVEVWLNSLLEESQSSLHLVIRQAAANIQESGFQLIEFLSSFPAQVGLLGIQMLWTRDSEEALQNAKFDKKIMQKTNQSFLELLNMLIEMTTKDLSSMERVKYETLITIHVHQRDIFDDLCHMHVKSPTDFEWLKQCRFYFKEDSDKTMIHITDVAFTYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQISIILTCKKEHKKSFIFTDGDNVTMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFIDNVVLARKFFTLYQLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASHTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPNILLDKAGYPELETAISKQVEEAGLINHPPWKLKVIQLFETQRVRHGMMTLGPSGSGKTSCIHTLMKAMTDCGKPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGFLKRRSPQEAEILRQLYAETFPDLYRFSIQNLEFKMEILEAFVITQSTHMLQGLIPTKEQ--AGDVDPEHLGRLFVFAMMWSVGAVLELEGRRRMELWLRSREGPTLHLPQL-TDPGDTMFDYYVAPDGTWRHWSMCIPEYVYPPDTTPEYGSILVPNVDNVRTDFLIKTIAKQGKAVLLIGEQGTAKTVIIKGFMSKFDPESHTVKNLNFSSATTPLMFQRTIESYVDKRMGTTYGPPAGKKMAVFIDDLNMPVINEWGDQVTNEIVRQLMEQNGFYNLEKPGEFTSIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSDASMDKIFGVIGEGYYCAQRGFSKEVQDAVIKLVPLTRRLWQMTKLKMLPTPAKFHYVFNLRDLSRIWQGMLNITSEVIKDTDELLRLWKHECKRVIADRFSMSSDVTWFDKAVVSLVEEEFGEE---KTPVVDCGVDAYFVDFLRDAPEATGETPEETDAEMPKLYEPIASLNHLQERLSVFLQLYNESIRGTGMDMVFFRDAMVHLVKISRVIRTPRGNALLVGVGGSGKQSLTRLASFIAGYTSFQITLTRSYNTSNLMEDLKVLYRTAGQQGKGITFIFTDNEIKEESFLEYMNNVLSSGEVSNLFARDEIDEINSDLTSIMKKEHPKRPPTNDNLYEYFMSRVRGNLHIVLCFSPVGEKFRNRALKFPALISGCTIDWFSRWPKDALVAVSEHFLSSYNIDCTAEIKKELVQCMGSFQDGVAEKCADYFQRFRRSTHVTPKSYLSFIQGYKFIYEEKHVEVQSLANRMNTGLEKLKEASESVAALSQELAVKEKELQVANEKADMVLKEVTMKAQAAEKVKAEVQKVKDKAQAIVDSISKDKAIAEEKLEAAKPALEEAEAALQTIKPSDIATVRTLGRPPHLIMRIMDCVLLLFHRRVNAVKIDLDKSCTVPSWQESLKLMTAGNFLQNLQQFPKDTINEEVIEFLSPYFEMSDYNIETAKRVCGNVAGLCSWTKAMASFFSINKEVLPLKANLIVQENRHALAMQDLQKAQAELDDKQAELDVVQAEYEQAMTEKQ 3470          

HSP 2 Score: 210.69 bits (535), Expect = 1.501e-52
Identity = 99/152 (65.13%), Postives = 117/152 (76.97%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN Y D LW +V+IEKI++EL EFQNRCRKLP+ LKDW AF D++KTIDDF+   PLLE M + AM  RHWQR++ LT H  DV ++ F LRNI+E PLLK+KEEIEDICISAVKE+DIE KLK V  EW    L F +FK RGELLLRGD
Sbjct: 1422 TVNSYQDTLWSEVNIEKINSELLEFQNRCRKLPRALKDWQAFLDMKKTIDDFSECCPLLEYMASNAMVERHWQRITTLTGHSLDVGNETFKLRNIMEVPLLKYKEEIEDICISAVKERDIEQKLKQVINEWDNKTLTFSSFKTRGELLLRGD 1573          
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18341641 (tr|A0A267GD23|A0A267GD23_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010548g3 PE=4 SV=1)

HSP 1 Score: 4839.63 bits (12552), Expect = 0.000e+0
Identity = 2369/3041 (77.90%), Postives = 2668/3041 (87.73%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDI 9577
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETLSQLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDNIKTVKFHEKQYETILACYS EGE LELEKPVKAE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDST+AL NAKSD+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIF+ L K  +KSP+DF+WLKQTRFYF+ED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VLSCKKERKKQF+FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP D+EQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYP+LEAAI +Q+ EA +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKALTDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF ++FP+I RY+IQ+L +K++ LEAF+VRQ CDLLEGLIP+++EK+ + +    Y RLY+F++MWS+GALLE EDR KLE  +R    +KLDLP+   DS++TMFD++V E+GEW HW+ KVEE++YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQL+E  GFYNLEKPGDFT IVDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF +EVR +V  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  +V+ ++  LL LWKHECCRVISDRF   +D++WFVKT+ R L ED+ +D     ++ E   +F+DF+RDA EATG+EPDD  F+MP +YEPI +F+ L DRL+ F G YNESIRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGYK FQITLTRSYN+SNL+EDLKFLYRTAGQQGKGITFLFTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFL+RT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS FEIVC+  VK ELI +MGVVHDGVAE+CVDYF R+RR THVTPKSYLSFL GYK IY +K  HY  LA RMDSGL+KL+EAQ+SV  L E L  KEKELAIANREAEEVLK V +Q+ AA EVKNKVQVVKD+AQ+IV+ I +DK IAE KLEAA PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVL+ FQR LDT+  DPER   KPSW ES+KLMSN  FLN L+ F KD++ EE++E + PYLEMEDY  + A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR  K+ EDL AAQ  LDEK+ EL K +AIYDEA+RKKQ L DDA  CRRKM AA +LI GLA EK RWT QS E+KAQI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK L+ RKIP S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASR+PLLIDPQGQGKIW+KNRE   ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF L++TTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LL+RLTST+GSLVDDE+LI VLK TKVTS +V QK+ IA +T+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MTYEVWKYA RGLYE DK+TFTLL+ALK+DM + K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R EK W+QWFDKEAPEEE+IPDGY+TNLD FRRLLL+R WCPDRTLSQAKKYI DSLG+KFAEG ILD + V+EES PRTPMVGLLSMGSDPTP+IE+LAKKHK EC+AISMGQGQE+H+RRL+A  L  GGWVLLQNCHLSLDYM E+MDQ+IE E +++DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRTYTSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMDIKKG++W T+ YMLGEIQYGGRVTDD+DK LLNTFC+ WF+D MF P F FFK +SIP   KL EY++ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP+DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI  VRTTL DLKLAI+GTIIMNE+LRDALDSMYDA+IP  W K+SW+SS LGFWFTELI RN QFSTW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E++ K+L EPLPV+ I AI+      +S+D  + +Y CP+YKKPRRTDLT++A++ LR   PP    DHW +R VALLCD+
Sbjct:  968 NRYNAPFKKQIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNIKTVKFHEKQYETILACYSSEGEQLELEKPVKAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTDALKNAKSDKKVMASTNQSFLDLLNLLINQTTHELTKVERTKFETLITIHVHQRDIFEDLCKMHIKSPTDFEWLKQTRFYFIEDTDKCMISITDVDFEYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLSCKKERKKQFIFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGTVKRSNPNDSEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPQLEAAIAKQVQEAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTRCIHTLMKALTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPTFERDQLFPLFESTFPEILRYAIQFLTFKIDVLEAFIVRQCCDLLEGLIPKREEKEGA-LRPEFYRRLYVFTIMWSVGALLEWEDRNKLETQMRE---LKLDLPEYAADSDNTMFDFLVGESGEWQHWDEKVEEFLYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLAKFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTIVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCEERGFPEEVRAMVAKLVPLTRRLWQLTKMKMLPTPAKFHYVFNLRDLSRIWQGMINTVSEVVKDSSVLLSLWKHECCRVISDRFTTYDDVNWFVKTMSRVLVEDMGDD---AGKLLEPTHYFVDFLRDAPEATGDEPDDASFEMPHIYEPIPTFEALSDRLRYFMGQYNESIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLMEDLKFLYRTAGQQGKGITFLFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELIGVMKKEFPRRPPTNENLQEYFLTRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSKFEIVCSETVKHELIQTMGVVHDGVAESCVDYFNRYRRSTHVTPKSYLSFLQGYKKIYTDKLQHYQGLAARMDSGLEKLLEAQDSVKVLSEELVVKEKELAIANREAEEVLKQVAIQQQAAQEVKNKVQVVKDRAQAIVDSIAQDKAIAEGKLEAARPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLMLFQRHLDTVTQDPERPCAKPSWSESLKLMSNTGFLNMLVTFSKDSMTEESIEFLMPYLEMEDYNFETAKRVCGNVAGLLSWTKAMQDFFWINKEVMPLKDNLAKQEVRLHKANEDLAAAQQTLDEKEAELAKARAIYDEAMRKKQALEDDAAACRRKMNAAEQLITGLADEKERWTRQSKEYKAQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNLKERKIPSSDTLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRFPLLIDPQGQGKIWLKNRETANELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLFVTTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGRVIKTEKAELEEQRVQLMEDVTNNNKIMKNLEDTLLYRLTSTQGSLVDDEELIGVLKETKVTSTDVRQKIEIAKETQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMDRSTKSPITAKRITNIIDYMTYEVWKYAARGLYEEDKLTFTLLLALKIDMHSKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRGEKAWKQWFDKEAPEEEIIPDGYSTNLDAFRRLLLIRSWCPDRTLSQAKKYIADSLGDKFAEGVILDIEAVWEESEPRTPMVGLLSMGSDPTPSIELLAKKHKKECKAISMGQGQEVHARRLVATSLQNGGWVLLQNCHLSLDYMLEVMDQLIEAETVNEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTYTSFTQDFLDISNMPQWRPMLYCVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDIKKGVNWNTVRYMLGEIQYGGRVTDDFDKFLLNTFCKVWFSDRMFEPTFEFFKGYSIPKFPKLTEYLEYIQSLPAYDTPQVFGLHANADISYQGRTTKAILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPNDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVITAVRTTLTDLKLAIEGTIIMNENLRDALDSMYDAKIPQVWRKISWDSSALGFWFTELINRNQQFSTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDGVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARPKILNEPLPVVHIYAIN-----SVSKD--EKLYMCPIYKKPRRTDLTYVATIKLRTNQPP----DHWVMRGVALLCDV 3990          

HSP 2 Score: 281.182 bits (718), Expect = 2.026e-71
Identity = 133/153 (86.93%), Postives = 139/153 (90.85%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT HHFDVESDGF LRNILEAPLL++KEEIEDICISA KEKDIEAKLKAV AEWS+HE  FGTFKNRGELLLRGDH
Sbjct:  795 TVNGYYDILFTEVDIEKISTELQEFQNRCRKLPKALKDWPAFADLNKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHHFDVESDGFTLRNILEAPLLQYKEEIEDICISAGKEKDIEAKLKAVIAEWSSHEFRFGTFKNRGELLLRGDH 947          
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18323226 (tr|A0A267E162|A0A267E162_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010548g1 PE=4 SV=1)

HSP 1 Score: 4831.54 bits (12531), Expect = 0.000e+0
Identity = 2369/3041 (77.90%), Postives = 2668/3041 (87.73%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRC--PPTKQADHWTLRAVALLCDI 9577
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETLSQLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLS+FDNIKTVKFHEKQYETILACYS EGE LELEKPVKAE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDST+AL NAKSD+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIF+ L K  +KSP+DF+WLKQTRFYF+ED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VLSCKKERKKQF+FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GF+DNI LARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP D+EQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYP+LEAAI +Q+ EA +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKALTDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF ++FP+I RY+IQ+L +K++ LEAF+VRQ CDLLEGLIP+++EK+ + +    Y RLY+F++MWS+GALLE EDR KLE  +R    +KLDLP+   DS++TMFD++V E+GEW HW+ KVEE++YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQL+E  GFYNLEKPGDFT IVDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF +EVR +V  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  +V+ ++  LL LWKHECCRVISDRF   +D++WFVKT+ R L ED+ +D     ++ E   +F+DF+RDA EATG+EPDD  F+MP +YEPI +F+ L DRL+ F G YNESIRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGYK FQITLTRSYN+SNL+EDLKFLYRTAGQQGKGITFLFTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFL+RT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS FEIVC+  VK ELI +MGVVHDGVAE+CVDYF R+RR THVTPKSYLSFL GYK IY +K  HY  LA RMDSGL+KL+EAQ+SV  L E L  KEKELAIANREAEEVLK V +Q+ AA EVKNKVQVVKD+AQ+IV+ I +DK IAE KLEAA PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVL+ FQR LDT+  DPER   KPSW ES+KLMSN  FLN L+ F KD++ EE++E + PYLEMEDY  + A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR  K+ EDL AAQ  LDEK+ EL K +AIYDEA+RKKQ L DDA  CRRKM AA +LI GLA EK RWT QS E+KAQI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK L+ RKIP S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASR+PLLIDPQGQGKIW+KNRE   ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF L++TTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LL+RLTST+GSLVDDE+LI VLK TKVTS +V QK+ IA +T+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MTYEVWKYA RGLYE DK+TFTLL+ALK+DM + K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R EK W+QWFDKEAPEEE+IPDGY+TNLD FRRLLL+R WCPDRTLSQAKKYI DSLG+KFAEG ILD + V+EES PRTPMVGLLSMGSDPTP+IE+LAKKHK EC+AISMGQGQE+H+RRL+A  L  GGWVLLQNCHLSLDYM E+MDQ+IE E +++DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRTYTSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMDIKKG++W T+ YMLGEIQYGGRVTDD+DK LLNTFC+ WF+D MF P F FFK +SIP   KL EY++ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP+DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI  VRTTL DLKLAI+GTIIMNE+LRDALDSMYDA+IP  W K+SW+SS LGFWFTELI RN QFSTW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E++ K+L EPLPV+ I AI+      +S+D  + +Y CP+YKKPRRTDLT++A++ LR   PP    DHW +R VALLCD+
Sbjct:  498 NRYNAPFKKQIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLSQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSIFDNIKTVKFHEKQYETILACYSSEGEQLELEKPVKAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTDALKNAKSDKKVMASTNQSFLDLLNLLINQTTRELTKVERTKFETLITIHVHQRDIFEDLCKMHIKSPTDFEWLKQTRFYFIEDTDKCMISITDVDFEYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLSCKKERKKQFIFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFLDNITLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGTVKRSNPNDSEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPQLEAAIAKQVQEAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTRCIHTLMKALTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPTFERDQLFPLFESTFPEILRYAIQFLTFKIDVLEAFIVRQCCDLLEGLIPKREEKEGA-LRPEFYRRLYVFTIMWSVGALLEWEDRNKLETQMRE---LKLDLPEYAADSDNTMFDFLVGESGEWQHWDEKVEEFLYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLAKFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTIVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCEERGFPEEVRAMVAKLVPLTRRLWQLTKMKMLPTPAKFHYVFNLRDLSRIWQGMINTVSEVVKDSSVLLSLWKHECCRVISDRFTTYDDVNWFVKTMSRVLVEDMGDD---AGKLLEPTHYFVDFLRDAPEATGDEPDDASFEMPHIYEPIPTFEALSDRLRYFMGQYNESIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYKTFQITLTRSYNVSNLMEDLKFLYRTAGQQGKGITFLFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELIGVMKKEFPRRPPTNENLQEYFLTRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSKFEIVCSETVKHELIQTMGVVHDGVAESCVDYFNRYRRSTHVTPKSYLSFLQGYKKIYTDKLQHYQGLAARMDSGLEKLLEAQDSVKVLSEELVVKEKELAIANREAEEVLKQVAIQQQAAQEVKNKVQVVKDRAQAIVDSIAQDKAIAEGKLEAARPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLMLFQRHLDTVTQDPERPCAKPSWSESLKLMSNTGFLNMLVTFSKDSMTEESIEFLMPYLEMEDYNFETAKRVCGNVAGLLSWTKAMQDFFWINKEVMPLKDNLAKQEVRLHKANEDLAAAQQTLDEKEAELAKARAIYDEAMRKKQALEDDAAACRRKMNAAEQLITGLADEKERWTRQSKEYKAQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNLKERKIPSSDTLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRFPLLIDPQGQGKIWLKNRETANELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLFVTTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGRVIKTEKAELEEQRVQLMEDVTNNNKIMKNLEDTLLYRLTSTQGSLVDDEELIGVLKETKVTSTDVRQKIEIAKETQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMDRSTKSPITAKRITNIIDYMTYEVWKYAARGLYEEDKLTFTLLLALKIDMHSKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRGEKAWKQWFDKEAPEEEIIPDGYSTNLDAFRRLLLIRSWCPDRTLSQAKKYIADSLGDKFAEGVILDIEAVWEESEPRTPMVGLLSMGSDPTPSIELLAKKHKKECKAISMGQGQEVHARRLVATSLQNGGWVLLQNCHLSLDYMLEVMDQLIEAETVNEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTYTSFTQDFLDISNMPQWRPMLYCVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDIKKGVNWNTVRYMLGEIQYGGRVTDDFDKFLLNTFCKVWFSDRMFEPTFEFFKGYSIPKFPKLTEYLEYIQSLPAYDTPQVFGLHANADISYQGRTTKAILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPNDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVITAVRTTLTDLKLAIEGTIIMNENLRDALDSMYDAKIPQVWRKISWDSSALGFWFTELINRNQQFSTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDGVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARPKILNEPLPVVHIYAIN-----SVSKD--EKLYMCPIYKKPRRTDLTYVATIKLRTNQPP----DHWVMRGVALLCDV 3520          

HSP 2 Score: 280.411 bits (716), Expect = 2.761e-71
Identity = 133/153 (86.93%), Postives = 139/153 (90.85%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT HHFDVESDGF LRNILEAPLL++KEEIEDICISA KEKDIEAKLKAV AEWS+HE  FGTFKNRGELLLRGDH
Sbjct:  325 TVNGYYDILFTEVDIEKISTELQEFQNRCRKLPKALKDWPAFADLNKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHHFDVESDGFTLRNILEAPLLQYKEEIEDICISAGKEKDIEAKLKAVIAEWSSHEFRFGTFKNRGELLLRGDH 477          
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18339942 (tr|A0A267H528|A0A267H528_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018625g1 PE=4 SV=1)

HSP 1 Score: 4810.36 bits (12476), Expect = 0.000e+0
Identity = 2350/3039 (77.33%), Postives = 2668/3039 (87.79%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9577
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQL+E  GFYNLEKPGDFT +VDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF+DEVR L+  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  DV+ +  T+  LWKHECCRVISDRF   +D++WF +T+ R + ED+ E++    ++ E   +F+DF+RDA EATG+EPDD DF+MP+VYEPI +FD L +RL+ F G YNE+IRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN+ NL+EDLKFLYRTAGQQGKGITF+FTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFLSRT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS F +VC+  VK++LI +MGVVHDGVAE+C +YF R+RR THVTPKSYLSFL GYK IY+EK + +  LA RMDSGL+KL+EAQESV  L E L  KEKEL +ANREAEEVLK V VQ+ AA E+KN+VQVVKD+AQ+IV+ I +DK IAE KLEAA+PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVLI FQRRLD +A DPER   KPSW ES+KLMSN  FL+ L  F KD++NEE++E + PY++MEDY ++ A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR +K+ +DL AAQ+ LDEK+ EL KV+A+Y+EA+RKKQ L DDA  CRRKM+AA +LI GLA EK RWT QS E+K+QI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK ++ +KIP+S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASRYPLLIDPQGQGKIWIKNREA +ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF LY+TTKLPNP+YTPE++ARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LLFRLTST+GSLVDDE+LI VLK TKVTSA+V QK+  A DT+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MT+EVWKYAVRGLYE DK+TFTLL+ LK+DM   K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R+EK W+QWFDKEAPEEE+IPDGYNTNLD FRRLLL+R WCPDRT+SQAK+YI DSLGEKFAEG ILD + V+EES PRTPMVGLLSMGSDPT +IE+LAKKHK EC+AISMGQGQEIH+RRLM+N L  GGWVLLQNCHLSLDY+ E+MDQ++E E +H+DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRT+TSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMD+KKG++W T+ YML EIQYGGRVTDDYDK LLNTFC+ WF++ MF P F F+K +SIP  ++LNEYI+ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI+ VRTTL DLKLAIDGTIIMNE+LRDALDSMYDA+IP  WSK+SW+SS LGFWFTELI RN QF TW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD+V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E+++K+L E LPV+ I AI+   + E        +Y CP+YKKPRRTDLT++A++ LR   ++ ADHW +R VALLCD+
Sbjct: 1617 NRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEV---GKLVEPTHYFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKKGVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAINGPTKDE-------KLYVCPIYKKPRRTDLTYVAAIKLRT--SQPADHWVIRGVALLCDV 4639          

HSP 2 Score: 271.937 bits (694), Expect = 1.243e-68
Identity = 130/153 (84.97%), Postives = 137/153 (89.54%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDH
Sbjct: 1444 TVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDH 1596          
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|18305668 (tr|A0A1I8J1U1|A0A1I8J1U1_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4809.2 bits (12473), Expect = 0.000e+0
Identity = 2350/3039 (77.33%), Postives = 2668/3039 (87.79%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9577
            + YN PFKK IQ  VS LSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIM+RAHE TNV+QCCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDNIKTVKFHEKQYETI  CYS EGE LELEKPV+AE NVE+WLM L+  +QRSLHGVIR A  +I+D  F +LEFL+M+PAQ+GLLGIQL+WTRDSTEAL  AKSD+K M  TN+ FL LLNLLIQQTT +L KVERTKFETLITIHVHQ+DIFD L K  VKSP+DF+WLKQTRFYFVED D+C++SITDVDF YQNEFLGCTERLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKKQFVFTDGDLV+MNPEFG+FLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLAS GFIDN+VLARKF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KR+NP DTEQTTVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGIQLDK GYP+LEAAI++Q+  A +I+   W LKLIQLFETQRVRHGMMTLGPSGAGKT CIH LMKA+TDCGEPHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRTLK KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CKIIFEVHNIDNASPATVSRNGMVYMSSS L+W PLL GWLLKR + ER  +  LF +SFPDI  ++ Q+L +KM  LEAF+VRQ CDLLEGLIPR++EK+ +      Y RLY+F +MWSIGALLE EDR KLE ++RS   +KLDLP    DS++TMFD++VSE G W HW  KVEE+ YP DSTPEYGSILVPNVDNVRT+FL++T+  QEK VLLIGEQGTAKTVMINK+L+  NPE HM K+LNFSSAT P MFQRTIES+VDKRMGST+GPPAGRKMTVFIDDINMP+INEWGDQIANEIVRQL+E  GFYNLEKPGDFT +VDMQFMAAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS+IG GHYC+ERGF+DEVR L+  L+P+TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQGMINT  DV+ +  T+  LWKHECCRVISDRF   +D++WF +T+ R + ED+ E++    ++ E   +F+DF+RDA EATG+EPDD DF+MP+VYEPI +FD L +RL+ F G YNE+IRGAGMD+VFF DAMTHL+KISRII TPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITLTRSYN+ NL+EDLKFLYRTAGQQGKGITF+FTD EIKDE FLEY+NNVL+SGVVSNLF RDEMDEICQELI +MKKE+PRRPPTN+NLQEYFLSRT+QNLHVVLCFSP+GEKFR+RALKFP LISGCTMDWFQRWP+DAL+AVA H+LS F +VC+  VK++LI +MGVVHDGVAE+C +YF R+RR THVTPKSYLSFL GYK IY+EK + +  LA RMDSGL+KL+EAQESV  L E L  KEKEL +ANREAEEVLK V VQ+ AA E+KN+VQVVKD+AQ+IV+ I +DK IAE KLEAA+PAL  AE+ALNTIKPADIATVRKLG+PPHLIMRIMDCVLI FQRRLD +A DPER   KPSW ES+KLMSN  FL+ L  F KD++NEE++E + PY++MEDY ++ A+RVCGNVAGLLSWT+AM  FF INKEV+PLKDNL KQ+VR +K+ +DL AAQ+ LDEK+ EL KV+A+Y+EA+RKKQ L DDA  CRRKM+AA +LI GLA EK RWT QS E+K+QI RLVGDVL ATAFLSY GPFNQ+FR +LN +WQK ++ +KIP+S +LN+I+ML + T + EW+LQGLPNDELS +NGIIVT+ASRYPLLIDPQGQGKIWIKNREA +ELQ+TSLNHKYFRQHLED+LSLGRPLLIEDI EELDPALDNVLEKNFIKQGST KVKVGDKEVDV+KGF LY+TTKLPNP+YTPE++ARTSIIDFTVTMKGLEDQLLG VI+TEK ELE QR+QLMEDV  N K MK LED LLFRLTST+GSLVDDE+LI VLK TKVTSA+V QK+  A DT+IKI SAREEYRPVA+RGSILYFLI EMS+VN+MYQTSLRQFLGLFDLSM RS KSP+T KRI NII+ MT+EVWKYAVRGLYE DK+TFTLL+ LK+DM   K+K EEF T IKGGASLD+NVVQPKP  WI D TWLNLVELSNLHQFS +LDQ++R+EK W+QWFDKEAPEEE+IPDGYNTNLD FRRLLL+R WCPDRT+SQAK+YI DSLGEKFAEG ILD + V+EES PRTPMVGLLSMGSDPT +IE+LAKKHK EC+AISMGQGQEIH+RRLM+N L  GGWVLLQNCHLSLDY+ E+MDQ++E E +H+DF LWVT E+HPKFPISFLQ SIKFTNEPPQG+KAG+KRT+TSF QDFLDISNM QWRPM+Y VA+LHT VQERRKFGP+GWNIPYE+NTADLNAS+QFVQNHLDDMD+KKG++W T+ YML EIQYGGRVTDDYDK LLNTFC+ WF++ MF P F F+K +SIP  ++LNEYI+ I  LP YD+P++FGLH+NADI+YQ +T ++ILDCIL+IQPKD+  G GETRESVVY+  +D+L KLP DYV FEV ERLQ MG LQPMNIFLRQEVDRMQ+VI+ VRTTL DLKLAIDGTIIMNE+LRDALDSMYDA+IP  WSK+SW+SS LGFWFTELI RN QF TW+F GRPNCFWMTGFFN QGFLTAMRQEVTRAHKGWALD+V+L NDVTK +  +++ PP+EGVYV+GL+LEGAGWDRRN++L E+++K+L E LPV+ I AI+   + E        +Y CP+YKKPRRTDLT++A++ LR   ++ ADHW +R VALLCD+
Sbjct: 1582 NRYNAPFKKLIQQWVSNLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMTRAHETTNVIQCCVGDETLAQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNIKTVKFHEKQYETITTCYSSEGEQLELEKPVRAEGNVEVWLMTLMQQSQRSLHGVIRTAYMAISDQNFQILEFLDMFPAQIGLLGIQLIWTRDSTEALNIAKSDKKAMTSTNQGFLDLLNLLIQQTTRELSKVERTKFETLITIHVHQRDIFDDLCKLHVKSPTDFEWLKQTRFYFVEDTDKCLISITDVDFEYQNEFLGCTERLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKQFVFTDGDLVEMNPEFGLFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASVGFIDNVVLARKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRSNPNDTEQTTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIQLDKAGYPQLEAAISQQVQSAELINWDSWNLKLIQLFETQRVRHGMMTLGPSGAGKTCCIHTLMKAMTDCGEPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTLKAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKIIFEVHNIDNASPATVSRNGMVYMSSSGLNWNPLLSGWLLKRPAFERDHLFPLFEDSFPDILLFATQFLTFKMSVLEAFIVRQCCDLLEGLIPRREEKEGAMKPEF-YRRLYVFVIMWSIGALLEWEDRNKLEQHMRS---LKLDLPVYPADSDNTMFDFLVSETGTWQHWEEKVEEFTYPTDSTPEYGSILVPNVDNVRTEFLIHTIHKQEKQVLLIGEQGTAKTVMINKFLARFNPEEHMNKALNFSSATTPMMFQRTIESYVDKRMGSTFGPPAGRKMTVFIDDINMPIINEWGDQIANEIVRQLMENSGFYNLEKPGDFTTLVDMQFMAAMIHPGGGRNDIPQRLKRQFNIFNCTLPSNPSIDKIFSVIGCGHYCQERGFSDEVRALIARLVPLTRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGMINTVSDVVKDVATVFSLWKHECCRVISDRFTTYDDVNWFTRTMSRVVVEDMGEEV---GKLVEPTHYFVDFLRDAPEATGDEPDDADFEMPRVYEPIPTFDFLAERLRYFMGQYNENIRGAGMDLVFFQDAMTHLVKISRIISTPRGNALLVGVGGSGKQSLTRLASFIAGYNTFQITLTRSYNVVNLMEDLKFLYRTAGQQGKGITFVFTDNEIKDESFLEYLNNVLASGVVSNLFPRDEMDEICQELISVMKKEFPRRPPTNENLQEYFLSRTRQNLHVVLCFSPVGEKFRSRALKFPALISGCTMDWFQRWPRDALVAVADHFLSRFPLVCSDTVKQDLIQTMGVVHDGVAESCAEYFNRYRRSTHVTPKSYLSFLQGYKKIYEEKLEFFQGLAGRMDSGLEKLLEAQESVKVLSEELVVKEKELEVANREAEEVLKQVAVQQQAAQEIKNRVQVVKDRAQAIVDSIAQDKIIAEGKLEAAKPALEAAEEALNTIKPADIATVRKLGKPPHLIMRIMDCVLILFQRRLDLVAPDPERPCVKPSWSESLKLMSNTGFLSMLTQFAKDSMNEESIEFLMPYIDMEDYNLETAKRVCGNVAGLLSWTKAMQEFFWINKEVMPLKDNLAKQEVRLKKANDDLAAAQATLDEKEAELAKVRAVYEEAMRKKQALEDDAAACRRKMSAAEQLITGLADEKERWTRQSKEYKSQIGRLVGDVLMATAFLSYSGPFNQDFRLLLNRNWQKNMKDKKIPYSENLNLIEMLVEATTIAEWNLQGLPNDELSTENGIIVTQASRYPLLIDPQGQGKIWIKNREAVRELQITSLNHKYFRQHLEDALSLGRPLLIEDINEELDPALDNVLEKNFIKQGSTLKVKVGDKEVDVLKGFSLYVTTKLPNPAYTPELYARTSIIDFTVTMKGLEDQLLGRVIKTEKSELEEQRVQLMEDVTNNNKIMKNLEDTLLFRLTSTQGSLVDDEELIGVLKETKVTSADVKQKIETAKDTQIKIASAREEYRPVASRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSMERSSKSPITTKRITNIIDYMTFEVWKYAVRGLYEEDKMTFTLLLTLKIDMHGKKVKHEEFQTLIKGGASLDLNVVQPKPHKWILDSTWLNLVELSNLHQFSGILDQITRSEKAWKQWFDKEAPEEEIIPDGYNTNLDAFRRLLLIRSWCPDRTISQAKRYIADSLGEKFAEGVILDVEAVWEESEPRTPMVGLLSMGSDPTTSIELLAKKHKKECKAISMGQGQEIHARRLMSNSLQNGGWVLLQNCHLSLDYLMEVMDQLVEAETVHEDFSLWVTCEVHPKFPISFLQQSIKFTNEPPQGVKAGLKRTFTSFTQDFLDISNMPQWRPMLYGVAFLHTVVQERRKFGPIGWNIPYEFNTADLNASIQFVQNHLDDMDLKKGVNWNTVRYMLSEIQYGGRVTDDYDKVLLNTFCKVWFSEKMFEPTFEFYKGYSIPKFARLNEYIEYIQNLPGYDTPQVFGLHANADISYQGRTTKTILDCILSIQPKDSGGGSGETRESVVYKQAEDLLEKLPGDYVPFEVRERLQKMGPLQPMNIFLRQEVDRMQRVISAVRTTLTDLKLAIDGTIIMNENLRDALDSMYDAKIPQVWSKISWDSSALGFWFTELINRNQQFHTWVFGGRPNCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVLLHNDVTKMLLADVHSPPTEGVYVHGLFLEGAGWDRRNNRLTEARAKILNEQLPVVHIYAINGPTKDE-------KLYVCPIYKKPRRTDLTYVAAIKLRT--SQPADHWVIRGVALLCDV 4604          

HSP 2 Score: 271.937 bits (694), Expect = 1.406e-68
Identity = 130/153 (84.97%), Postives = 137/153 (89.54%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDIL+ +VDIEKIS EL EFQNRCRKLPK LKDWPAF DL KTIDDFN MVPLLELMTN AMKPRHWQRMSDLT H+F+VESDGF LRNILEAPLLK KEEIEDICISA KEKDIEAKLK V AEW++HE  FGTFKNRGELLLRGDH
Sbjct: 1409 TVNGYYDILFTEVDIEKISGELQEFQNRCRKLPKALKDWPAFADLSKTIDDFNEMVPLLELMTNKAMKPRHWQRMSDLTKHNFEVESDGFTLRNILEAPLLKHKEEIEDICISAGKEKDIEAKLKNVIAEWNSHEFKFGTFKNRGELLLRGDH 1561          
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Match: gnl|BL_ORD_ID|20342885 (tr|A0A2R2MTI0|A0A2R2MTI0_LINUN dynein heavy chain 5, axonemal OS=Lingula unguis OX=7574 GN=LOC106169088 PE=4 SV=1)

HSP 1 Score: 4751.04 bits (12322), Expect = 0.000e+0
Identity = 2309/3040 (75.95%), Postives = 2643/3040 (86.94%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            + YN PFKK IQ  V  LSNS+EIIE WMTVQNLWVYLEAVFVGGDIAKQLP+EAKRFSNIDKSWI+IM RAHE  NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQ+HLLSVFDN K VKFHEK Y+ IL+  S EGE ++LEKPVKAE NVE+WLM L+ MAQ+SLHGVIR A  +I D+ FN+LEFLNM+PAQVGLLGIQL+WTRD+ EAL NAK D+K+M  TN+ FL LLNLLI QTT +L KVERTKFETLITIHVHQ+DIFD L +  +KSP DF+WLKQTRFYF+ED D+ ++SITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKKERKK F+FTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFI+NIVLARKFY LYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP DTEQT VMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE A+  +++E  ++ H PWVLK IQLFETQRVRHGMMTLGPSGAGKT CI+ LMKA+TDCGEPHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT + KKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+  CKIIFE HNIDNASPATVSRNGMVYMSSS +DW P+L GWL  R+  E  I++ LF +SFP+++R++ Q L++KM+T+EAFV+ QAC+LL+GLIP +++K +  +S+ HYE LY+F++MWSIGA LE +DR K+E ++R+N  I+LDLP ++   + TMFD++V ENG W HWN+KVE Y YP D+TPEYGSILVPNVDNVRT+FL++T++ QEKAVLLIGEQGTAKTVMIN Y+   NPE HM KSLNFSSAT P+MFQRT+ES+VDKRMGSTYGPPAG+KM+VFIDD+NMP+INEWGDQ+ANEIVRQL+E+KGFY+LEKPGDFT IVDMQF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN SIDKIFS IG GHYC+ERGF++ VR+L+  L+P+TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGMINT+ +V+ + KT++ LWKHECCRVISDRF   +D +WFV T+ R + ED+ E   ++  + E + WF DF RDA EATG+EP+D DFDMPK+YEPI SF+ L++RL+ F   YNESIRGA MD+VFF DAMTHL+KISRIIRTPRGNALLVGVGGSGKQ+LTKLAS+IAGYKIFQITLTRSYN+SNL+EDLK+LYRTAGQQG+GITF+FTDQEIKDEGFLEY+NNVLSSGVVSNLFARDEMDEI  ELIP+MKKE+PRRPP+N+NL +YFLSRT+ NLHVVLCFSP+GEKFR+RALKFPGLISGCTMDWFQRWPKDALIAVA H+LS F+I C P VKK+LI +MG  HDGVAE+CV+YFQR+RR THVTPKSYLSFL GYK+IY +K      L+QRM +GL+KL+EA E+V EL + L  KEKELAIA+ +AEEVLKTVT +  AA +VKN+VQ VKDKAQ+IV+ IE DK IAE KLEAA PAL EAE AL TIKPADIATVRKL  PPHLIMRIMDCVLI FQRR++ +  D +R   KPSWGES+K+M+    L  L+ FPKD+INEETVEL++PYL+MEDY ++ A++VCGNVAGL SWT+AM  FF INKEVLPLK NL  Q+ R   +M DLNAAQ+ LDEK+ EL +VQA+YD+A+R+KQ L+DDAE CRRKM+AA+ LI GL GEK+RWT Q+ EFKAQI RLVGD+L +TAFLSY GPFNQ+FR +L+ +WQKE +TRKIPF+ +LN+IDML  PT + EW+LQGLPND+LSVQNG+IVTKASRYPLL+DPQGQGK WIKNRE   ELQ+++LNHKYFRQHLED+LSLGRPL+IEDIGEELDPALDNVLEKNFIK G T KVKVGDKEVDVM GF LYITTKLPNPSYTPE+ A+TSIIDFTVTMKGLEDQLLG VI TEK ELE++R++LMEDV  NK+KMKELEDNLLFRLTST+GSLVDDEDLI VL TTK T+ +VSQKL IA++TE+KI +AREEYRPVATRGSILYFLI +MS+V+ MYQT+L+QFLGLFDLSM RS KSP+TQKRI NIIE MT+EVWKYA RGLYE  K+ FTL +ALK+DM+AGKIK EE+ TFIKGGA+LD+NVV PKP  WI D+TWLNLVELSNLHQFS +LDQVSRNEKQW+QWFDK+APEEEVIPDGYN +LD FRRLLLVR WCPDRTL  AKKYI D+LGEK+AEG ILD +K++EES PRTP++GLLSMGSDPT +IE LAKKHK+EC AISMGQGQE+H+R+L+   +  GGW LLQNCHL L Y+ EL+D M ETE IH+DFRLWVTTE+HPKFPI FLQ+SIKF+NEPPQGIKAG+KR+Y  F QDFLD+SNM QW+PM+Y VA+LHT VQERRKFGPLGWNIPYE+NT+D NAS+QFVQNHLDDMDIK+G+SW T+ YM GEIQYGGRVTDDYDKRLLNTFCR WF D MF   F F+K ++IP  +KL++Y+  I  LP  D+PE FGLH NADITYQ+KTA++ILDCIL+I PKD+  G GETRESVV+R+ DDML KLP+DY+ FEV  RLQ MG LQPMNIFLRQE+DRMQKVI  VRTTL DLKLAI+GTIIM+E LRDALD MYDARIP++W K+SWESSTLGFWFTELIERN+QFS W F+GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALDTVVL NDVT++M+D+INQPP+EGVYV GL+LEGA WDRR  KLIE K KVL+EP+PVI I AI+ S  G   R     MY  P+YKKPRRTDLT+IA V L+   T+  DHW LR VALLCD+K
Sbjct: 2650 NRYNAPFKKQIQTWVQNLSNSTEIIENWMTVQNLWVYLEAVFVGGDIAKQLPQEAKRFSNIDKSWIRIMQRAHETPNVIQCCVGDETLMQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQAHLLSVFDNTKLVKFHEKNYDQILSIVSSEGETVDLEKPVKAEGNVEVWLMALMLMAQKSLHGVIRTAAMAIQDSGFNLLEFLNMFPAQVGLLGIQLIWTRDADEALKNAKYDKKVMAGTNQAFLELLNLLIAQTTRELTKVERTKFETLITIHVHQRDIFDDLCRMHIKSPQDFEWLKQTRFYFIEDQDKTLISITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKERKKNFIFTDGDNVDMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIENIVLARKFYILYKLCEEQLTKQVHYDFGLRNILSVLRTLGTNKRANPNDTEQTIVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGITLDKAGYPELENALKIRVEEVGLVYHAPWVLKCIQLFETQRVRHGMMTLGPSGAGKTKCIYSLMKAMTDCGEPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHRAKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMATLCKIIFEPHNIDNASPATVSRNGMVYMSSSGMDWNPILSGWLNTRSVGESSILMSLFESSFPEVWRFATQNLVFKMDTMEAFVINQACNLLQGLIPNREDKQT--LSKEHYEHLYVFTLMWSIGAYLEWDDRAKMEEFLRNNEEIRLDLPNLDGFPDSTMFDFLVEENGTWSHWNTKVEPYHYPPDTTPEYGSILVPNVDNVRTEFLIHTISKQEKAVLLIGEQGTAKTVMINGYMGKYNPEEHMAKSLNFSSATTPYMFQRTVESYVDKRMGSTYGPPAGKKMSVFIDDVNMPIINEWGDQVANEIVRQLMEMKGFYSLEKPGDFTTIVDMQFLAAMIHPGGGRNDIPQRLKRQFTIFNCTLPSNPSIDKIFSCIGEGHYCQERGFSEAVRKLIARLVPVTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMINTEFEVVKDEKTVMALWKHECCRVISDRFTSYDDYTWFVSTVSRVVREDIGE---AKVPMVELEPWFGDFFRDAPEATGDEPEDADFDMPKIYEPIPSFEALEERLRFFMAQYNESIRGANMDLVFFRDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTKLASFIAGYKIFQITLTRSYNVSNLMEDLKYLYRTAGQQGQGITFIFTDQEIKDEGFLEYLNNVLSSGVVSNLFARDEMDEITMELIPVMKKEFPRRPPSNENLYDYFLSRTRANLHVVLCFSPVGEKFRSRALKFPGLISGCTMDWFQRWPKDALIAVADHFLSKFDIECTPEVKKQLIQAMGTFHDGVAESCVEYFQRYRRSTHVTPKSYLSFLAGYKTIYSDKRGEIGELSQRMQTGLEKLVEASEAVGELSKELEVKEKELAIASAKAEEVLKTVTSKAQAAEKVKNQVQKVKDKAQAIVDSIEADKAIAEGKLEAARPALEEAEAALKTIKPADIATVRKLLNPPHLIMRIMDCVLILFQRRVNPVEVDKDRPCVKPSWGESLKMMAGGGLLTQLVEFPKDSINEETVELLAPYLDMEDYNLETAKKVCGNVAGLCSWTQAMAYFFTINKEVLPLKANLVVQEARLNVAMTDLNAAQAQLDEKEAELREVQAMYDKAMREKQALIDDAENCRRKMSAASALITGLGGEKVRWTEQNKEFKAQIGRLVGDILMSTAFLSYSGPFNQDFRQLLSKNWQKECKTRKIPFTANLNVIDMLVLPTTIAEWNLQGLPNDDLSVQNGLIVTKASRYPLLVDPQGQGKNWIKNREGGNELQISNLNHKYFRQHLEDALSLGRPLIIEDIGEELDPALDNVLEKNFIKSGKTLKVKVGDKEVDVMDGFTLYITTKLPNPSYTPEVSAKTSIIDFTVTMKGLEDQLLGRVILTEKAELESERVKLMEDVTANKRKMKELEDNLLFRLTSTQGSLVDDEDLINVLHTTKATAQDVSQKLQIAAETEVKITAAREEYRPVATRGSILYFLITDMSMVSCMYQTALKQFLGLFDLSMERSMKSPITQKRISNIIEYMTFEVWKYAARGLYEEHKLMFTLQLALKIDMQAGKIKHEEYQTFIKGGAALDLNVVTPKPCRWILDLTWLNLVELSNLHQFSGILDQVSRNEKQWKQWFDKDAPEEEVIPDGYNNSLDVFRRLLLVRSWCPDRTLPMAKKYIADTLGEKYAEGVILDVEKMWEESDPRTPLIGLLSMGSDPTNSIEALAKKHKLECGAISMGQGQEVHARKLLTKLMSQGGWALLQNCHLCLVYVMELLDLMTETENIHEDFRLWVTTEVHPKFPIGFLQISIKFSNEPPQGIKAGLKRSYAGFTQDFLDVSNMPQWKPMLYGVAFLHTTVQERRKFGPLGWNIPYEFNTSDFNASVQFVQNHLDDMDIKRGVSWNTVRYMFGEIQYGGRVTDDYDKRLLNTFCRVWFGDHMFGANFNFYKGYTIPKCTKLDDYMTFIQNLPLADTPEAFGLHPNADITYQTKTAKNILDCILSIMPKDSGGGSGETRESVVFRLSDDMLEKLPNDYIPFEVKARLQKMGALQPMNIFLRQEIDRMQKVITTVRTTLTDLKLAIEGTIIMSESLRDALDCMYDARIPAAWKKISWESSTLGFWFTELIERNNQFSNWCFEGRPNTFWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVVLHNDVTRYMKDDINQPPAEGVYVQGLFLEGASWDRRGCKLIEPKPKVLYEPMPVIHIYAIN-STGGHDPR-----MYLSPIYKKPRRTDLTYIAEVELKT--TQNPDHWILRGVALLCDVK 5676          

HSP 2 Score: 263.462 bits (672), Expect = 5.000e-66
Identity = 121/153 (79.08%), Postives = 138/153 (90.20%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VN YYDILW +V+IEKI+ EL +FQN+CRKLP+ LK+WPAFEDLRKTIDDFN MVPLLELMTN AMKPRHWQRM++LT H FDVE++ F LRNILEAPLLK+KEEIEDICISAVKEKDIEAKLK V AEW++H+ HFG FKNRGELLLRGD+
Sbjct: 2477 TVNSYYDILWQEVNIEKINTELLDFQNKCRKLPRALKEWPAFEDLRKTIDDFNEMVPLLELMTNKAMKPRHWQRMAELTGHVFDVENENFTLRNILEAPLLKYKEEIEDICISAVKEKDIEAKLKQVIAEWNSHDFHFGNFKNRGELLLRGDN 2629          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 4395.88 bits (11400), Expect = 0.000e+0
Identity = 2171/3057 (71.02%), Postives = 2539/3057 (83.06%), Query Frame = 2
Query:  419 NV*ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE---DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            N+ +S  V+ +  S+ YN PFK  IQ  V  LSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+Q CVGDET+ QLLPHLL+QLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V FH+K                                        R ++ V+ +     +   F V+       AQVGLLGIQ++WT+DS EAL NA+ DRKIM +T + FL LLN LI  TT DLG +ERTK+ETLITIHVHQKDIFD L    ++SPSDF+WLKQ RFYF+ED+DR +++ITDV F YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  KD+    ++SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E KGF+NLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IGTGHYC +RGF ++VR++V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+N   DVI   K LL LWKHEC RVI+DRF   ED++WF   L   + E+L E   D+V      E DA+F+DF++DA EATGEEP++ DFDMPKVYEPIASF  L+DRL MF GLYNESIRGAGMD+VFFTDAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY IFQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+ TD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP           FP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P VK E++  MG   DGVAE CVDYFQR+RR THVTP SYLSF+ GYK+IYKEK  H  ++   M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+ +AA +VK +VQ VKDKAQ+IV+ I  DK IA+ KLEAA+PAL EAE AL TIKP+DIATVR L RPPHLIMRIMDCVL+ FQRRL+ +  D E+N   PSW ES+KLM+   FL +L  FPKDTINEE VEL++PY +M DY I+ A+RVCGNVAGL SWT+AM +FF IN+EVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQ LL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L + WQKE+R R IPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWI+N+EA+ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE  R+ L+EDV  NK+KMKELED+LL+RLTSTKGSLVDDE LI VL  TK TS EV+QKL IA++TE+KIN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV  YA RGLYE  K  FTLL+ LK+DM++ +IK EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+ R+EKQWR WFDKEAPEEEVIP+ Y+ +LD F+RLLL+R WCPDRT++QA+KYI DS+GE++AEG ILD ++ +EES PRTP++ LLSMGSDPT  I  L K+ KVE   +SMGQGQE+H+R+L+  F+  GGW LLQNCHL LD+++ELMD + ET+ IH+ FRLW+TTE H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQ+ LD+SNM+QWRPM+Y+VA+LH+ VQERRK+GPLGW+IPYE+N AD NA++QFVQNHLDDMD+K+G+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MFN +F+F+KD+ IP  + +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S+GGGETRE+ V R+ DDML KLP DY  FEVM+RL+ MG L+PMNIFLRQE+DRMQ+V+A VR+TL DLKLAIDGTI+M+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF  W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP EGVYVYGLYLEGAGWDRRN +L++SK KVLFE +PV+ + A     E    +D    +Y CP+YKKP RTD   IA+V LR   +++ ++W LR VALLCD+K
Sbjct: 1184 NMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKT---------------------------------------RRVNHVLISKQVKHHCILFKVMFKFVFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDRMMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPKDQ--GGELSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKP----EVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEK--HLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKD--SRLYSCPIYKKPARTDQNIIAAVDLRT--SQRPEYWILRGVALLCDVK 4173          

HSP 2 Score: 223.402 bits (568), Expect = 2.348e-57
Identity = 103/152 (67.76%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYD+LW DV IE+I+NEL +FQ RCRKLP+ LK+W AF DL+KTIDDF+   PLLELM N AM  RHW+R++++T H F+VE+D F LRNI+EAPLLK+KEEIEDICISAVKE+DIE KLK V AEW      F  FK RGELLLRGD
Sbjct: 1025 TVNGYYDVLWADVHIERINNELLDFQTRCRKLPRALKEWQAFLDLKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVETDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGD 1176          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 3926.33 bits (10181), Expect = 0.000e+0
Identity = 1925/2679 (71.86%), Postives = 2243/2679 (83.73%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE---DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRIDL VLSVAAQQIAVVL+ KKERKK F FTDGD+V+MNPEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDRQIIIRVKLASCGFIDN+ LARKF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NPTDTE T VMRVLRDMNLSKL+D+DEPLF+SLI DLFPGIQLDK GYPELEAAI++Q+ EA +I+HPPW LK+IQLFETQRVRHGMM LGPSGAGK+ CIH LMKA+TDCG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CKI+FE HNIDNASPATVSRNGMV+MSSS L+W P+L+GWL+KR++ E  ++  LF++SFP +Y++SIQ L +KM+ LEAFV+ Q  ++L+GLI  K       +SR H ERLY+F++MWSIGALLE +DR K+E ++R +++I LDLP I  DS+DTMFDY V+ +G+WVHWN +VEEYIYPKD TPEY SILVPNVDNVRTDFL+ T+A Q KAVLLIGEQGTAKTV+I  YLS  NPE H  KSLNFSSAT P MFQR++ES+VDKRMG+TYGPPAG+KM++FIDDINMPVINEWGDQ+ NEIVRQL+E KGF+NLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF   GTGHYC +RGF ++VR++V  L+P+TRRLW +TK KMLPTPA FHY+FNLRDLSRIWQGM+N   DVI   K LL LWKHEC RVI+DRF   ED++WF   L   + E+L E   D+V      E DA+F+DF++DA EATGEEP++ DFDMPKVYEPIASF  L+DRL MF GLYNESIRGAGMD+VFFTDAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY IFQITLTRSYN +NL+EDLK LYRTAGQQGKGI+F+ TD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  +LIP+MK+E+PRRPPTN+NL EYF+SR +QNLHVVLCFSP           FP LISGCTMDWF RWPKDAL+AV+ H+LSS++I C P VK E++  MG   DGVAE CVDYFQR+RR THVTP SYLSF+ GYK+IYKEK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+ +AA +VK +VQ VKDKAQ+IV+ I  DK IA+ KLEAA+PAL EAE AL TIKP+DIATVR L RPPHLIMRIMDCVL+ FQRRL+ +  D E+N   PSW ES+KLM+   FL +L  FPKDTINEE VEL++PY +M DY I+ A+RVCGNVAGL SWT+AM +FF IN+EVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  VQA Y++A+ +KQ LL+DAE CR KM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFRN+L + WQKE+R R IPF  +LN+ +ML D   + EW+LQGLPND+LS+QNGIIVTKA+R+PLLIDPQ QGKIWI+N+EA+ ELQ+TSLNHKYFR HLEDSLSLGRPLLIED+GEELDPALDNVLEKNFIK GST+KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVTM+GLEDQLLG VI TEKQELE  R+ L+EDV  NK+KMKELED+LL+RLTSTKGSLVDDE LI VL  TK TS EV+QKL IA++TE+KIN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSLRQFLGLFDLS++RS KSP+T KRI NIIE MTYEV  YA RGLYE  K  FTLL+ LK+DM++ +IK EEF T IKGGASLD+    PKP  WI DMTWLNLVELS L QFS +LDQ+ R+EKQWR WFDKEAPEEEVIP+ Y+ +LD F+RLLL+R WCPDRT++QA+KYI DS+GE++AEG ILD ++ +EES PRTP++ LLSMGSDPT  I  L K+H    R +SM     IH+     +    GGW LLQNCHL LD+++ELMD + ET+ IH+ FRLW+TTE H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQ+ LD+SNM+QWRPM+Y+VA+LH+ VQERRK+GPLGW+IPYE+N AD NA++QFVQNHLDDMD+K+G+SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WF++ MFN +F+F+KD+ IP  + +++Y+  I  LP YD+PE+FGLH NADITYQSK A+ +LD IL+IQPKD+S+GGGETRE+ V R+ DDML KLP DY  FEV + L  MG L+PMNIFLRQE+DRMQ+V+A VR+TL DLKLAIDGTI+M+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF  W+F+GRPNCFWMTGFFN QGFLTAMRQE+TRA+KGWALD +VL N+VT+ M+D+I QPP EGVYVYGLYLEGAGWDRRN +L++SK KVLFE +PV+ + A     E    +D    +Y CP+YKKP RTD   IA+V LR   +++ ++W LR VALLCD+K
Sbjct:   19 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNPTDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRLKIIQLFETQRVRHGMMALGPSGAGKSTCIHTLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWLMKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLIQPK-------LSREHMERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDSQDTMFDYHVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF---GTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKP----EVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKHLEVQTLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRHISTSRLLSMLFFSYIHTH---THTHEQGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHEFQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEV-KGLNTMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWASSTLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRWMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-----ENNGVKD--SRLYSCPIYKKPARTDQNIIAAVDLRT--SQRPEYWILRGVALLCDVK 2659          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016401.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1184712:1219988:1 gene:ENSAMXG00000015872.2 transcript:ENSAMXT00000016401.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 3608.92 bits (9357), Expect = 0.000e+0
Identity = 1763/2682 (65.73%), Postives = 2163/2682 (80.65%), Query Frame = 2
Query: 1553 CYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVS-QKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAH--KGWALDTVVLWNDVTKHMQDEINQPPS---EGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            CYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK +K QF+FTDGD+VDM+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN VL+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP+++E+T VMRVLRDMN+SKLVD+DEPLF+SLINDLFPGI LDK GYP+LEAAI +Q +EA +I+H PWVLKL+QL+ETQRVRHGMMTLGPSG GKT CIH L+KA+TDCG PH+E+RMNPKAITA QMFG LDV+TNDWTDG+FSTLWR+TLK KKGE+ W+VLDGPVDA+WIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L+W P+L+ WL K  +++  ++L  F N+F     YS    IY  E +                                 RL++F+VMWS+GALLE+EDR ++E ++R N+   LDLP  ++D   T+F+++V+E GEW  W+ KV EY YPKDS P+Y SILVPNVDN RTDFL+ T+  Q KAVLLIGEQGT KTVMI  Y +  +PE H+ KSLNFSSAT+P MFQ+TIES++DKRMGSTYGPPAG+KMTVFIDDINMPVINEWGDQI NEIVRQL+E  GFY+LE+PG+F ++VD+Q +AAMIHPGGGRNDIPQRLKRQFC+FNCTLPSNSSIDKIF  + +G++C ERGF + V  L + L+P  RR+W   K KMLP+PAKFHY+FNLRDLSRIWQGM+    +V  + + L+ L++HEC RVI+DRF+   D + F   L++  +E+   D+V   +    + +F+DF+RDA E TG+EP+DT+  +PK+YEPI SF  L +RL +F   YNES+RG+ MD+VFF DAM HL+KISRIIRTP+GNALLVGVGGSGKQ+LT+LAS+IAGY+ FQI LTR+YN +NL+EDLK LYR AG QGKG+TF+F D +IKDE FLEYM NV++SG VSNLF RDE+ EI Q+LIP MK+++PR PPT DNL  YFLSR + NLHVVLCFSP+GEK  +RA+KFPGLISGCT+DWFQRWPKDAL+AVA H+LS + + C+  VK+ +I +MG   D VA+ C +YFQRFRRQT+VTPKSYLSF+ GY++IY EK  +   LA+RM++GL +L EA+++V EL + LA KEKEL +A+++A+ VL+ V V+  AA +VK +VQ VKDKAQ+IV+EIE DKK+AESKLEAA+PAL  AE AL TIKPADIATVRKLG+PPHLIMRIMD VL+ FQRR+D++  DPER   +PSW E++KLM+N+ FL+ L+NF KDTINEE VEL+ PYL MEDY ++ A+R+CGNVAGL SWT AM  FF INKEVLPLK NL  Q+ R   + ++L  AQ  LD KQKEL + Q +YD A+ +KQ+LL+DAE CRRKM+ A  LI+GL GEK+RWT  S+EF+ QI  L GDVL AT FLSY GPFNQE+RN+L   W+KE+    IP+S S N+I ML D   LGEW+LQGLPND+LS+QNGIIVT ASRYPLLIDPQGQGK WIKNREA  +LQVTSLNHKYFR H+ED LSLG+PLLIED+GEELDP LDN+LEKNFI+ GST+KVKVGDKEVDVMK F LYITTK+ NP+Y+PE+ A+T+I+DFTVT+KGLEDQLLG VI TEKQELE++R++++ +V  NK+KM+ELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ EVS +KL++A++TEIKIN AREEYRPVATRGSILYFLIVEMSLVN+MYQTSLRQFLG+FD S+ +S KS +T KR+ NI++ +TYEV++Y VRGLYE  K  FTLL+ LK+D++A  I   EF   IKGGASLD+N V+PKP+ WI DMTWLNLV LS+LH FS +  QVS+N++ W+ WFD+ APEE  +PDGY + L  F +LLL+R WCPDRT++QA+ YI +S+G+++AEG ILD D +  E+  RTPM   LSMGSDPT  IE LAK     CR ISMGQGQE+H+RRL+A  +  GGW+LLQNCHL LD+++EL++ +  +E I + FR+WVTTE+HPKFPI+FLQ S+KFTNEPPQGIKAG++RTY+S  QD L+I+NM QWRP+++AVA+LHT VQERRKFGPLGWNIPYE+N AD  +S+QFVQNHL+D+D+K G++W  + YMLGE+QYGGRVTDD DKRLLNTF R WF+++MF  KF F++ ++IP    L EY   I+ LP  D+PE+ GLH NADI+ Q+  A  IL  I+NIQPKD+S GG ETRES V R+ ++ML KLP DYV+ EV   LQ MG++QPM IFLRQE+DRMQ +I  VR+TL DLKLAIDGTIIM+EDLRDALDS+YDAR+P  W + SW+S+TLGFWFTEL+ERN QF +W F GRP+ FW+TGFFN QGFLTAMRQE TR +  KGW LDTVVL NDVT+ M++++  PP+    GVY+YGL+L+GAGWD+RN K++ES  KVLF PLPV+ + A  +S   +  R    ++Y CPVY+KPRRTDLTFI +++LR    +  DHWTLR +ALLCD K
Sbjct:   12 CYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKKPQFIFTDGDVVDMDKEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQVLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPSESEKTVVMRVLRDMNISKLVDEDEPLFMSLINDLFPGIVLDKAGYPDLEAAIVKQAEEAGLIAHQPWVLKLVQLYETQRVRHGMMTLGPSGTGKTTCIHTLLKAMTDCGTPHKELRMNPKAITASQMFGTLDVATNDWTDGVFSTLWRKTLKAKKGEYTWIVLDGPVDAVWIENLNSVLDDNKTLTLANGDRIPMAPTCKVVFEPHNIDNASPATVSRNGMVFMSSSVLNWKPILQAWLKKLPASQAELILNFF-NTF-----YSRLKYIYLTEKVIG-------------------------------RLFVFAVMWSVGALLELEDRSRMEMFLR-NHPAALDLPNTQQDQ--TIFEFVVNEAGEWDPWSVKVPEYHYPKDSVPDYSSILVPNVDNTRTDFLLQTIMKQGKAVLLIGEQGTGKTVMIKGYTTKYDPETHLSKSLNFSSATLPSMFQQTIESYIDKRMGSTYGPPAGKKMTVFIDDINMPVINEWGDQITNEIVRQLMEQGGFYSLERPGEFVSVVDLQLVAAMIHPGGGRNDIPQRLKRQFCVFNCTLPSNSSIDKIFHTLASGYFCSERGFTESVSSLAKALVPTIRRVWQTVKAKMLPSPAKFHYIFNLRDLSRIWQGMLTVGAEVCRDPEVLVSLFRHECTRVIADRFIDQNDRNVFDGILEKISTEEHGSDLV---KGVAWEEYFVDFLRDAPEITGDEPEDTEVVIPKIYEPIPSFSALSERLTLFLQQYNESVRGSAMDLVFFKDAMIHLVKISRIIRTPQGNALLVGVGGSGKQSLTRLASFIAGYQSFQIVLTRTYNATNLMEDLKTLYRIAGLQGKGVTFIFADNDIKDESFLEYMTNVVASGEVSNLFTRDEISEITQDLIPTMKQQHPRLPPTIDNLYSYFLSRVRSNLHVVLCFSPVGEKLGSRAVKFPGLISGCTVDWFQRWPKDALVAVAQHFLSGYSLQCSEEVKQSVIGTMGTFQDLVAQTCTEYFQRFRRQTYVTPKSYLSFIKGYQTIYSEKIGNVRTLAERMNTGLDRLKEAEQAVNELSKALAVKEKELEVASKKADAVLQEVAVKAQAAEKVKTQVQKVKDKAQAIVDEIEGDKKVAESKLEAAKPALAAAEAALQTIKPADIATVRKLGKPPHLIMRIMDAVLLLFQRRVDSVTMDPERPCLRPSWAEALKLMNNSGFLSMLLNFNKDTINEEMVELLLPYLSMEDYNLEAAKRICGNVAGLCSWTEAMADFFGINKEVLPLKANLKLQEARLAVAQDELAKAQEQLDAKQKELDEAQELYDGAVSEKQSLLEDAEACRRKMSNAMALIDGLGGEKIRWTESSTEFQRQIKHLPGDVLLATGFLSYAGPFNQEYRNLLLQQWKKEMSGNHIPYSQSFNLITMLVDNATLGEWNLQGLPNDDLSIQNGIIVTSASRYPLLIDPQGQGKTWIKNREANHDLQVTSLNHKYFRAHIEDCLSLGKPLLIEDVGEELDPVLDNILEKNFIRSGSTYKVKVGDKEVDVMKEFTLYITTKMANPAYSPEVSAKTAIVDFTVTVKGLEDQLLGRVILTEKQELESERVKMLAEVTSNKRKMQELEDNLLYRLTSTQGSLVEDESLIEVLRVTKSTAEEVSLKKLLVAAETEIKINEAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGIFDSSIEKSPKSQITSKRLINIMDFLTYEVFRYTVRGLYEDHKFLFTLLLTLKIDLQAKNISHPEFQALIKGGASLDLNSVEPKPRRWILDMTWLNLVHLSSLHPFSRLPSQVSQNDRGWKSWFDEAAPEEAPLPDGYESLLGAFHKLLLIRSWCPDRTIAQARHYITESIGQRYAEGVILDMDSMCTENDKRTPMTCFLSMGSDPTENIERLAKSKGFPCRPISMGQGQEVHARRLLAQSMADGGWLLLQNCHLGLDFLDELLETINTSENIAESFRVWVTTEVHPKFPINFLQSSVKFTNEPPQGIKAGLRRTYSSITQDQLEITNMPQWRPLLFAVAFLHTTVQERRKFGPLGWNIPYEFNQADFTSSVQFVQNHLEDVDVKLGVNWNCLRYMLGEVQYGGRVTDDMDKRLLNTFTRIWFSENMFGEKFCFYRGYTIPNAKTLPEYHSHIDALPLVDTPEVLGLHPNADISCQTNMASEILSTIINIQPKDSSGGGDETRESTVLRLANEMLEKLPPDYVAHEVRTHLQKMGLVQPMTIFLRQELDRMQNIIGCVRSTLTDLKLAIDGTIIMSEDLRDALDSVYDARVPKLWQRSSWDSATLGFWFTELLERNQQFHSWTFNGRPHQFWLTGFFNPQGFLTAMRQETTRMNLAKGWTLDTVVLLNDVTRMMREDVTGPPTGDVGGVYIYGLFLDGAGWDKRNCKILESLPKVLFTPLPVVHVYA--VSSATDPKRPQGVSLYPCPVYRKPRRTDLTFIFTLFLRT--VQNPDHWTLRGLALLCDCK 2646          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1910.19 bits (4947), Expect = 0.000e+0
Identity = 1128/3075 (36.68%), Postives = 1736/3075 (56.46%), Query Frame = 2
Query:  479 FKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKD---EKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEE-YIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLS-EDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXX---XXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV--ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIE---TEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQD-FLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFN-PKFRF--FKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDAS---AGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNC-FWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQD-EINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD----LTFIASVYLRCPPTKQADHWTLRAVALLCDI 9577
            F+K++      LS   E+IE  +TVQ  W+YLE +F+G DI KQLP E+  F +I+ SW  IM R +++ N L+       L +L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIK+++ ++ +     A   +S +GE +E   PV  E  VE WL  +    + +L   +R    ++        +++  +P Q+ +   Q+ WT D T+ L+  K  +D+  ++   ++ + +L+        +L K+ R K   L+T+ VH +D+ D+L K      + FDWL Q R Y+ +DVD CI+  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCSD +D++ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS        F+F   D+  +    GIF+TMNPGYAGR ELP+NLK  FR ++M+VPD  +I  + L   GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + S+LR  G+++R  P   ++  ++  ++DMN++KL   D PLF  +I DLFP ++     Y +L+  I  ++ ++ +   P  V K+IQL+ET+  RH  M +G +G+ K+    +L KAL+     GEP      E  +NPKA++  +++G  D+STN+WTDG+ S+L R     +K +  W+V DGPVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY   S L W P ++ W+ KR   E   +  LF         +   +    +   E   V   C L + L   ++     D+    R+  E  +IFS++WSI A ++ + R K++ ++R    ++   P     ++DT+++Y V ++N  W  +  K+ + + YP ++ P Y  I+VP VD VR  FL+N++   +  VLL G  GT KT +    L   +P      ++N SS T     Q  IES V+KR   TY P  G+KM  F+DD+NMP ++++G Q   E++R  ++   +Y+ +        +DM  +A+M  PGGGR  I  RL+ +F + N T P+ S I  IF   GT    K + F +EV+ +   L   T  L+     + LPTPAK HY+FNLRD+S+++QG++ +  D     +++  LW HEC RV SDR V   D   FV  L   L    DL+  +I    Q       F DF+++                P VYE +  F  LK  ++     YN +     M +V F DA+ H+ ++ R+I  PRGN LLVG+GGSG+Q+L++LA+YI  Y +FQ+ +T+ Y      ED+K LYR  G   K   FLF D +I DE FLE +NN+LSSG V NL+  DE +E+   L    +KE      T D +  Y + R + NLH+VLC SP+GE FRNR  ++P L++  T+DWF  WP+DAL+ VA  YL    +     ++ ++      +H  VA+         +R  +VTP +YL  ++GYK +  EK         ++ +GL K+ + +  V  +   L + +K++A   ++ EE L  +  QK  A+E +  V    +K  +  EEI + K +AE+       A PAL EA  AL ++   D+  ++  GRPP L+  +M  V+I                  +P+W E+ + +  + F+  L++F KD I++  ++ I  Y    D+  ++  RV      L  W RAM  +  I + V P +  L     +  +    L  A++   E +++L +++  YDE L +K+ L   +E    K+  A +L+ GLAGE++RW       +  +  LVGD L A AFLSY GPF   +R  +L   W K+ R  ++P S   N    L+ PT + +W++QGLP+D  S +NG+IVT+ +R+PL++DPQGQ   WIKN E+++ L+V  L    F + LE+++  G P+L++++ EELDP+L  +L K+F   G    +K+GDKEV+    F+ YITTKL NP YTPEI  +T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   K+K++ELED +L  L    GSL+DD  L+  L+T+K+T+ EVS +L  +  TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+LS+ +SQ+S   ++RI N+ +  TY V++Y  RGL+E  K+ F+  M  K+   AGK+ ++E+  F++GG  LD       P  +W+ D  W N+ EL  L  F  ++    +  K W QW+    PE   +P  + T  +  +++L+VR    DR       +I ++LG +F E  +LD   V E+S  +TP++ +LS G DPT  +  LA+   +     A+S+GQGQ   + R++   +  G WV L NCHLSL +M +L D+++E    E  H DFRLW+++  HP+FPI+ LQ  IK T EPP+G+K+ +KR Y    +  F   S  + +R +++++ + H+ + ER+KF  LGWNI Y +N +D   S   +  +LD+ +    + W  + Y++  + YGG VTDD+D+RLL T+   +F +   N P F+      + IP     + Y + I +LP  + PE+FG H NADI  Q    +++ D +L++QP+  S    G G +RE  V  +  D+  K+P + V +E  ++L +     P+N+ L QE+ R   ++  +RT+L +L+  I G ++M+  L +    ++DAR+P  W K       L  W  +L +R  QF+ W     P   FW++GF    GFLTA+ Q   R H   ++DT+  W  +   + D  +  PP +GV++ GLYLEGAGWD++NS L+E++   L  P+P I  + ++  K+      + KNMY CP Y  P R+      +F+  V L+       +HW  R  ALL  +
Sbjct: 1407 FEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDIC-LVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRM-VELWFIFSLIWSICASVDEDGRKKIDNFLR---EMEGTFP-----NKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNA-PFY-KIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMK------MDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIF---GTMINQKLQEFQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQ----QPIFGDFLKE----------------PHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLE--TADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGA--EEI-KCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMIL--------------RGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQL-DKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYE---EIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVP-ELVDYESTQKL-LQDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNV-SVDTLS-WEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKK------VAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVS-YEHWIKRGTALLMSL 4405          

HSP 2 Score: 61.2326 bits (147), Expect = 2.832e-8
Identity = 39/129 (30.23%), Postives = 61/129 (47.29%), Query Frame = 3
Query:   57 SNELTEFQNRCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRG 437
            S   T ++N   KL + LKD  W   E  +  I+ F   +P++  + +PAM+ RHW ++       FD  S  F L  I+   L +  E I +I  +A KE  IE  L+ +   W    L    +K++G
Sbjct: 1253 STAQTMYKN-LNKLSRELKDKQWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKG 1380          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1892.47 bits (4901), Expect = 0.000e+0
Identity = 1124/3074 (36.56%), Postives = 1745/3074 (56.77%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-KQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKS-DRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLI--YKMETLEAFV-------VRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRS-------NNNIKLDLPKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIIS-MGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIK--KGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHM-QDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9565
            PF   IQ     LS  SE+IE WM VQ  W+YLE++F+GGDI  QLP+EAK+F +IDK + KIMS    +  + +CC+    LS L          CQKSL  YL+ KR  FPRFFF+SD  LL ILG +S+P  +Q H++ ++DNI +++F      ET+  A  S EGE +EL++PV AE  VE W+  +L   +R+   + + A       +  V   L+ Y   V L G Q+ WT +  +      S +++ M+Q  ++    ++ L+++ T  L K +R K  T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D   V     +F Y  E++G   RLVITPLTDR Y+TL QAL M +GGAPAGPAGTGKTE+ KD+ + LG   VV NC + MD+  +G+IF GL+Q G+WGCFDEFNRID  VLSV + QI  + +    + K+F F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V ++VPD Q I  + L S GF+   VLA+K   LYKL  EQL+KQ HYDFGLR + SVL   G+ KR +P   E   +MR LRDMNL K V +D PLF+ LI+DLFPG+   +  YP    A+   ++E      P  V K++Q++ET   RH  M +GP+G GK+  I+ L +A T  G   +   +NPKA++  +++G LD  T DWTDGI S ++R   +   K E  +++ DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMV++    L + P  + W+  R   E+  + +LF    P I    ++ +    + E L+  V       V Q   +L+ L+  +D      +S    E  +I ++  S+GA L    R K +  ++         +   L  P        T+FD+       +W+ W+S V +YI+  D+  ++  ILVP VD  R ++L+  +   ++ V+L+GE GT+KT     +L++ NP++ M  ++NFSS T     QR++E+ V+KR   TYGPP G+ + VF+DD+NMP ++E+G Q    +++ LL+  G Y+  K  +   + D+ F+AAM   GGGRN++  R    F +FN   P   ++  I+S I  GH    R F + +R +   L   T  L+      + PTP+KFHY+FNLRDLSR++ G+  T  +        + +W++EC RV  DR +   D +     +K  + E    ++ S          F D+     E+            P+VYE I  +D  K   +     YNE+     M++V F DA+ HL ++ RIIR  RG+ALLVGVGGSGKQ+LTKLA++ AG  +F+I L+R Y+ SN  EDLK LY   G + K   FLFTD  + +EGFLE +NN+L+SG+V  LF  DE + +  ++     K       + +++ +YF++++  NLH+VL  SP+G+  R R   FPGL++   +DWF  WP  AL AVA  +L    ++  P    E +I  + +VH  V E    + Q+ RR  +VTPK+YL F++ Y ++ ++K        +R++ GL KL EA   +A+L + LAE++  LA  +   E +L+ ++     A E K   +    + +   + I  +KK AES L  A PAL  A  AL  +  +D+  +R   +PP  +  + +C+L+        M G  E N     W  +  +MS   FL +L+    D+I+   V+ +  +L+  + + +  + +    +G+L +  A+M + ++ +E+ P ++ + + +  + +S  +L   QS L+  QKELG +   Y  A+ +KQ L ++A+   R++ AA +LI GL  E  RWT    E K +  RL+GD L + AFLSY G FN +FRN ++   WQK++  R IP S    I  +LTD   +  W  + LP DELSVQNGI+ T+ASR+P+ IDPQ Q   WIK +E +  L+++S N   F + LE ++  G P L +D+ E +DP +DNVLEKN         + +GDKEVD    F+LY+ TKL NP Y+P +F +  +I++TVT+KGLEDQLL +++  E++ELE QR +L+++   NK+ +K+LED+LL  L ++ G+++D+ +L+  L+ TK  + EV +KL +A  T   I+  R+ YRP A RG+IL+F++ EM+LVN MYQ SL  FL +FD S+ +S  + +  KR+ NI+  +T  V+ Y   GL+E  K+ F+  M +K++   G+   EE   F+KG  SL+ +  + KP  W+ D  W ++V L+ L  ++F A+++ + +N K+W+ WFD ++PE+   P  Y  +L  F++LLL+RC+  DR       Y+  ++GEK+ +  ++  + +FE+S P +P+V +LS G +P   +  LA++        + ++MGQGQE  + +L+   +  G W++LQNCHL + ++++L   +      H DFRLW+TT+    FPI  LQ S+K   EPP G+K  ++ TY     + L       +R +VY +A+ H  VQERRK+G +GWN+PY++N +D    ++ +  +L     +    + W ++ Y++GE+ YGGR  D +D+R+L  +   +  D   D F P F FF     D+ IP       Y++ I  LP  ++PE+FGLH NA+I Y ++ A+ +   ++ +QP+   +GGG +R+  + ++  D+  KLPS +   +V+ R ++   + P ++ L QE++R  +++ ++  +L +L+ A+ G + M+ +L +   ++++ +IP+           +LG W      R+ Q+S+W+  G P   W++G    + +LTA+ Q   R   GW LD   L+  VT +  +DE+ + P +G YV GLYLEGA WD     L+ SK K L   LP++ +  I      E  R  L+N  + PVY    R +     L F A ++     T+   HW L+ V L
Sbjct: 1325 PFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLER-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLD-YQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQF-EGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDLNEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPED------LSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIHNPDT--KFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH---TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDS---AMRDPILFGDYRTALSESE-----------PRVYEDIQDYDACKALFQEILEEYNEN--KTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGH--SKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMI--PAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILV--------MRGHKEIN-----WKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKS-KRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQP-FHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAF-DLDVI-RKKLGPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCR-RNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPI------EAHRLRLQNTLRTPVYTTSMRRNAMGVGLVFEADLF----TTEHHSHWVLQGVCL 4335          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001372.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2730.28 bits (7076), Expect = 0.000e+0
Identity = 1369/1971 (69.46%), Postives = 1612/1971 (81.79%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQ--TLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 6334
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++     N  L+   G   Q   +  +  + A +  F +T + SY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDWAVPGVVRHDAQHIQFDLTFSTSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2021          

HSP 2 Score: 68.5514 bits (166), Expect = 2.950e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2724.5 bits (7061), Expect = 0.000e+0
Identity = 1369/1973 (69.39%), Postives = 1609/1973 (81.55%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLA----SYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 6334
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T     +A+ + T Q   +R  R +++ K++D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T+CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++     N  L+   G   Q +   +    S  A         +RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQLFCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGVT--NLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPASRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2023          

HSP 2 Score: 68.5514 bits (166), Expect = 2.829e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001365.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001365.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2705.63 bits (7012), Expect = 0.000e+0
Identity = 1374/1980 (69.39%), Postives = 1613/1980 (81.46%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFG-LRNIL-SVLRTLGQQK--RANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKI-SRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIF-QITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEK---FDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELR 6334
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G L NIL S++ +L      R           +R LR+  LS  +D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF +IGTGHY   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++ + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K  ++++ T   +  + GV     Q +    ++   + +F QITL+RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK            RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L   WQ+EL+
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILENILLSLIHSLSDSVIIRHLTAKPWAKRTLRALRNTGLSTPIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKKEAKLLVTAYCDWAVPGVVRHDAQHIQFDLTFSTLFPVFTQITLSRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKRLCVCVIYTWGDRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLLLGEWQRELK 2032          

HSP 2 Score: 68.5514 bits (166), Expect = 3.105e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001375.1 (pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001375.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2674.43 bits (6931), Expect = 0.000e+0
Identity = 1359/1987 (68.39%), Postives = 1596/1987 (80.32%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNL-----SKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALT--DCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITN--------------------AKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNIL 6307
            +S  V+ +  S+ YN PFK  IQ  VS LSN+++IIE WMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSW+KIM+RAHE  NV+QCCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIKTV+FHEK Y+ ILA  S EGE ++L+KPV A+ NVE+WL  LL  +Q+SLHGVIR+A  ++ D+ F+++EFL+ YPAQVGLLGIQLLWTRDS EAL NA+ +RK M QTN+ FL+LLN LI  TT DL  VER K+ETLITIHVHQ+DIFD L +  +KSP+DF+WLKQ RFYF EDVD+ IV ITDV FIYQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQIA+VL+CKKER+ QF FTDGDLV+MNPEFGIFLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLASCGF+DNIVLARKFYTLYKLCEEQL+KQV++ +G+  ++  L+T G      P  ++      V R + +     + L+D+DEPLF+SLI+DLFPGI LDK GYP+LEAAINRQ+++A ++ H PW LK+IQL+ETQ VRHGMM LGPSGAGKT CIH LM+A+T  +CG PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+T + KKGEHIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+L+GWL +R+  ER  +  L+  SF ++YRY+   L +KM+TLEAFV+ Q+ ++L+GLIP KD     +++  H  RLY+F++MWS+ A LE++DR ++E ++RS+ +++LDLP +    ED+MFDYMV  +G+WVHW+S+VEEY YP D TPEY SILVPNVDNVRTDFL++ +A Q K+VLL+GEQGTAKTVM+  YLS  +PE H+ K+LNFSSAT P MFQRTIES+VDK+MG+TYGPPAG+K+TVFIDDINMP+INEWGDQ+ NEIVRQL+E +GFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQ  IFNCTLPSN+SIDKIF  +    +   RGF + VR L   L+P TRRLW LTK KMLPTPAKFHYVFNLRDLSRIWQG++NT  DV+++                     + LL L+KHEC RVI+DRF   ED  WF + L    SE+L         V E  A+F+DF+RDA EATG+EP+D DFDMPK+YEPIAS+D+L+DRL  F   YNES+RGA MD+VFFTDAM HL+K   ++       L+   G S +  L  +    A + I+   L RSY+ SNLLEDLK LYR AGQQGKGITFLFTD EIKDE FLEYMNNVLSSG VSNLFARDEMDEI  EL P+MKK++PRRPPT +NL E+F++R + NLHVVLCFSP+GE+FR RAL+FP LISGCTMDWF RWPKDAL+AV+ H+LSS+ + C   VK+E++  MG   DGVAE C DYFQRFRR THVTPKSYLSF+ GYK++YKEK      LA RM  GLQKL EA ESVA L   L  KEKEL +AN +A++VLK VTV+  AA +VK +VQ VK+ A+ IV+ I  DK +AE KL AA+PAL EAE AL TIK +DIATVR LGRPPHLIMRIMDCVL+ FQRR++ +  DPER    PSW ES+KLM+   FL +L  FPKDTI EE VEL+ PY +M DY ID AR+VCGNVAGL SWT+AM  FF INKEVLPLK NL  QQ R   +M DL +AQ+ LD KQ EL  VQA Y++ALR+KQ L+DDAE CRRKM  A+ LI GLAGEK RWTN S EF AQI RLVGDVL ATAFLSY GPFNQEFRN+L
Sbjct:   56 DSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEFLDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCG------PPISDARDRYNVFRPLAVNAETKANLIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTGAECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDH--GGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVPNVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIESYVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQRLKRQLSIFNCTLPSNASIDKIFGSLANSRFIAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPTPAKFHYVFNLRDLSRIWQGLLNTTADVVSSPEESTAVDLCPVIRPAPPDRPQLLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGER-AFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVLGV-TNLTLMTFDGHSLQDMLCDIDVRSANHTIY---LLRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHVTPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQKVKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGSLKQFPKDTITEEMVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKAMAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISGLAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSYAGPFNQEFRNLL 2029          

HSP 2 Score: 68.5514 bits (166), Expect = 2.831e-11
Identity = 32/46 (69.57%), Postives = 35/46 (76.09%), Query Frame = 3
Query:  324 EDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +DICISAVKE+DIE KLK V AEW      FG FK RGELLLRGD+
Sbjct:    1 QDICISAVKERDIEFKLKQVVAEWDGKTFTFGNFKTRGELLLRGDN 46          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2655.55 bits (6882), Expect = 0.000e+0
Identity = 1320/1908 (69.18%), Postives = 1563/1908 (81.92%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAE----SNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKM 6139
            +S  V+A+  S+ YNVPFK  IQ  V KLSN++EIIE WM VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE   ++ CCVGDETL+QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASDPHTIQ+HLL +FDN+  V FHEK YE IL+  S EGE++ L +PV A+     NVE WL  LL   + ++H VIR A   I D  F + EF   +PAQVGLL  Q++WTRDS  AL NAK+DRKIM  TN++FL LLN LI  TT DL K ER K+ETLITIHVHQKDIFD LV+  +KS +DF+WLKQ+RFYFVE+ D+C++ ITDVDF Y NE+LGCT+RLVITPLTDRCYITL+QALGMSMGGAPAGPAGTGKTET KDMG+CLGKYVVVFNCSDQMD+RGLGRI+KGL+QSG+WGCFDEFNRI+LPVLSVAAQQI +VL CKK ++ QFVFTDGD+V+M+ EFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDR II+RVKLAS GF DN +L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR+NP + E+T VMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELE AI  Q   A ++ HPPWVLK+IQL+ETQRVRHGMM LGPSGAGKT CIH+LMKA+TDCGEPHREMRMNPKAITAPQMFG LDV+TNDWTDGIFSTLWR+TLK KKGEHIW++LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS LDW P+++ WL    + +  ++     + F D+  +    +  KM+ LE   ++QA +LL+GL+P  DE+   ++   H +RL +FS+MWS+GALLE+EDR ++EA++R++ +  LDLP    D  D++F+Y+V ++G W HWN++V E+ YP+D+ PEY +ILVPNVDNVRTDFLM  +  QEKAVLLIGEQGTAKTVMI  Y++  + E H+ KSLNFSSAT P MFQRT+ES+VDKRMG+TYGPPAGRKMT+FIDDINMP+INEWGDQI NEIVRQL+E  GFYNLEKPG+FT IVD+QF+AAMIHPGGGRNDIPQRLKRQFCIFNCTLPSN+SIDKIF     GH+C ERGF +EV QL   L+P TRRLW  TK KMLPTPAKFHY+FNLRDLSRIWQGM+    +V  ++  LL L+ HEC RVI+DRF   +D  WF  T+ + + +D      + +   E + +F+DFMRDA E TGEEPDD D + PKVYEPI SF QL +RL+ F   YNES+RGA MD+VFF DAM HL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGY  FQITL+R+YN+SNL+EDLK LYR  GQQGKG+TF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DEI QELIP++KKE+PRRPPTN+NL +YFLSR + NLHVVLCFSP+GEKFR RALKFP LISGCTMDWFQ WP+DAL AVAGH+L+ + + C P VK+ ++ +M V  D VAE CV+YF+RFRRQT+VTPKSYLSF+ GYKSIY EK  + + L++RM +GL KL EA++SV++L   L  KEKELA+A+R A+EVL  VT +  AA  VK +VQ VKDKAQ+IV+EI  DK +AE KLEAA+PAL EAE AL TIKPADI TVRKL +PPHLIMRIMDCVL+ F+RR+DT+  +PER   +PSW E+ KLM+   FLN+L+ F KDTINEE V+L+ PY+EMEDY ++ AR VCGNVAGL SWT+AM++FF INKEVLPLK NL  Q+ R   +  +L+ AQ+ LDEKQ+EL  VQA+YD A+R+KQ L+DDAE CRRKM
Sbjct: 1557 DSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTSFPAQVGLLA-QMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAVKRSNPEEPEKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADER---RLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPS-HLDLPGSAND--DSIFEYVVGDSGGWEHWNTRVPEFAYPRDTVPEYSAILVPNVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTPNMFQRTVESYVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPTPAKFHYIFNLRDLSRIWQGMLIMNSEVCRSSDMLLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHG---TAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQTYVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQKVKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEEMVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAVREKQILVDDAEACRRKM 3454          

HSP 2 Score: 224.557 bits (571), Expect = 1.886e-58
Identity = 101/152 (66.45%), Postives = 127/152 (83.55%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            SV+GYY+ILW D+DIEKI+NEL +FQN+CRKLPK LK+W AFEDL+K ID+FN   PLLE+M N AM  RHW+R++++T H FD+ESD FAL+NI+EAPLL FK++IEDICISA KE+DI+AKLKAV +EWS+    F  FK+RGELLL+G 
Sbjct: 1395 SVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLKKKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAPLLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPFKSRGELLLKGS 1546          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 341.658 bits (875), Expect = 1.634e-100
Identity = 254/838 (30.31%), Postives = 427/838 (50.95%), Query Frame = 2
Query:  443 VAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGG-DIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEI--WLMGLLNMAQRSLHGVIRAANNSIND-TEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFY----FVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTE----QTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIIS----HPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC-GEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRT---LKGK-KGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPL 2893
            + + ++  Y   F++D  D+ SKL+  SEI   W+ VQ  W+ L  +     DI   LP E  +F ++   +  I +RA +    ++  +        L   ++ L++ + SL+ +LE++R  FPRF+F+ +  LL+I+G       +   +  +F +I+++ F E   + I    S+EGE L L + ++ + +++   WL  L    + S+    R     + D T+  V+  ++ Y  Q  LL  Q++WT    + L   +  +   +   +   LL  L             + K E L+  ++H  ++  QL     K  +   W K  +FY     ++D++   +S +     Y+ E++G  ERL+ TPL    + TL  +L    GG   GPAGTGKTETVK  G+ LG+ VVVFNC D  D++ L R+  G++Q G+WGCFDEFNR+D  VLS  +  I  + +  +  K      + +   ++P   +F+T+NPGY GR ELPENLK +FR  +M  P    I  + L   GF D+  LA K     +L   + +   HY FGLR +  VLR        +P  +E    + TV+  L+ + L  L D DE +F   ++ +F     D  G P    AI + + +A   S       ++ K +Q +  Q+ +  ++ +G +G GKT     ++ A+    G  +    ++ K +T   ++G +  +T +W DG+F+++ RR    + G  K   IW+V D  +D  ++E +NSVLDDNK LTL NG+R+P+ P+ +I+FE  N+D+ +PAT++R G+++ S+   D C +
Sbjct: 1412 LVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEV-IHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLE---DFITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVV--VSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNV------KKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEE-TPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRN------CSPLISEFGEGEKTVVESLKRVILPSLGDTDELVFKDELSKIF-----DSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFST---DVCSI 2222          

HSP 2 Score: 45.0542 bits (105), Expect = 1.634e-100
Identity = 32/134 (23.88%), Postives = 63/134 (47.01%), Query Frame = 3
Query:    6 VNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRM-SDLTSHHFD---VESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEW 395
            V   ++  W  VD+  + ++L  F  R  +LP+ +K +  ++ L   ++   S+  +L  + + A+KPRHW  +  D+         ++   F+L++++   L   +  +  I   A KE  IE  L  +K  W
Sbjct: 1245 VQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFW 1378          

HSP 3 Score: 296.975 bits (759), Expect = 1.431e-80
Identity = 301/1377 (21.86%), Postives = 631/1377 (45.82%), Query Frame = 2
Query: 3362 ILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIE---SFVDKRMGSTYGPPAG-RKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGG-GRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGM---INTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDL-SEDI--VSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLS----SFEIVCAPIVKKELIIS--MGVVHDGVAENCVDYFQRF--RRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQR---MDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMD--CVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVEL---ISPYLEME-----DYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQN-GIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFD-LSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKM 7390
            I++P +D ++ + +   + + ++ ++L G  G+ KT+++N  L  +N   +    +NFS  T        +    ++V    G T  P +  + + +F D+IN+P ++++G Q     +RQL+E +GF+   +   +  I  +  + A   P   GR  + +R  R   I     PS  S+ +I+ I    +Y        E R   +     +  L+   K +   T  + HY+F+ R+L+R+ +G+   INT        ++L+ LW +E  R+ +DR V V++ + F + L   + + L ++D+  +S + +  +    +DF         +E + TD         + +F  +++R K F    +E +    + MV     + H+L+I R ++  +G+ +L+G   +GK  LT+  +++ G KI Q  + R  N+S+    LK        +      +  +  I +  FLE MN +L++  + +LF  +E D++   L     +       T   L ++F+    +NLHVV           +  +  P L + C ++W   W    +  VA + +      F     P V KEL+ +  +  + D V    + + + F  + +  V P+S   F+ G +++ K     Y +L +    ++ GL+KL E+   V EL + L++K  EL    +EA   L  + +++N +   +   + +K   +   E+I + K++    ++  EP + EA+  +  IK   +  +R +  PP  +  +M+  C ++ +Q                 +W +  + +  + F++N++++      + T+ +   I  Y+E E     ++T +   R       L  W  A ++F ++ + V PL+  + + +    K+  +L AA+ +  + +  +   +  Y   +R  + +  +    +  +  +  L++ L  EK RW N + +F      L+G+ + ++ + +Y G  N+  R  +    ++ L    + +  +   ID L       +W   GL  ++  ++N  I++      P L+DP       I N    K + ++ L   + ++ LE+++  G  ++I+D GE  DP +  ++ + F   G+   V++GD EVDV   F+L+I +  P+      + +R  ++ F    + +E ++  + +  E  E++ +R  L++     K K+K LE  LL  L +++G+++++++L+  L   K  +  + +KL  + +   + ++  EEY  +      ++ ++ +    +  Y  S+ QFL  F  + + +S+++   + R+  I+  +  EV+      L   DK  F ++MA+ M
Sbjct: 2390 IVIPTIDTIKHEKIFYDLLNSKRGIILCGPPGSGKTMIMNNAL--RNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPE-NKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEI----YYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGVYTAINTGPR--QTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDF---------KEVNKTD---------LVNF--IEERFKTF---CDEELE---VPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRN-KTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQF---------------SNWRDIQQFIRKDDFIHNIVHY------DTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKR-LENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTAL---DK-KFKMIMAMTM 3702          

HSP 4 Score: 68.9366 bits (167), Expect = 1.724e-11
Identity = 50/224 (22.32%), Postives = 104/224 (46.43%), Query Frame = 2
Query: 7841 DPTPTIEMLAKKHKVECRAISMGQGQEI-HSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVI---HDDFRLWVTTEIH-PKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWF 8497
            D T  +  LAK  K   + I +G  + + +++  ++   + GGW+LLQN  +SL +++  + + +E       H+ F++++T  +   K P   LQ + +F  E   GI   +K  + S  Q F    + +      + +++ H  +  R +  P G++  Y +N  D   +  +++N L   +    + W  +   +  I YGG++ ++ D  ++   C   F
Sbjct: 3795 DGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGS--QFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVL-ATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVF 4015          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 4462.91 bits (11574), Expect = 0.000e+0
Identity = 2181/3051 (71.48%), Postives = 2569/3051 (84.20%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFKK+IQ  V KLSN+++IIE WMTVQNLW+YLEAVFVGGDIAKQLPKEAKRF NIDK W+KIM+RAHEN NV+QCCVGDETL QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASD HTIQ+HLL+VFDNIK+VKFHEK Y+ I+A  S EGE +E+ KPV A+ NVEIWL  LL M+++SLH VIR A  +IND+ FN+LEFLN +PAQVGLLGIQ++WTRD+TEAL NAK D+K+MQQTN  F  LLN+LI+QTT +L +V RTKFETLITIHVHQ+DIFD L +  +++PSDF+WLKQ RFYF +D D C V+ITDV FIYQNEFLGCTERLVITPLTDRCYITLAQAL MSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRIDLPVLSVAAQQI ++L+ KKERKKQF+F+DGD+VDMNPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLASCGFIDNI L+RKFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E TTVMRVLRDMNLSKL+D+DEPLF+SLINDLFPGI LDK GYPELE AI  + +E  +I+HPPW LKLIQLFETQRVRHGMM LGPSGAGKT CIHVLMKA+TDCG PH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKGE IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CKI+FE HNIDNASPATVSRNGMVYMSSS LDW P+++ W+ KR   E  I+   F  S+ ++  +  + L+ KM+ L+   + Q   LL+GLIP+KD  D  Q S  H E LY+FS+MWSIGALLE++DR K+E ++R N    LDLP++ ++  + +F++MV++ GEW HWN++VEEY+YPKD  P++ SILVPNVDNV  D+L+ TV+ Q KA LLIGEQGTAKTVMI  Y+S  +PE H+ KS NFSSA+ P +FQRTIESFVDKRMGSTYGPPAG+KMTVF+DDINMP+INEWGDQ+ NEIVRQL+E KGFYNLEKPGDFTNI D+QF++AMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIFS+IG G++CKERGF ++V+     L+P TR+LW LTK KMLPTPAKFHY+FNLRDLSRIWQG++NT  +VI + + L+ LWKHEC RV+SDRF   +D  WF KT+KR + ++L ED      + +  A+F+DF+RDA EATG+EP+D DF+ PK+YEPI SFD L++RL M+  LYN+SIRGAGMD+VFF DAM HL+++SRIIRTPRGNALLVGVGGSGKQ+LT+L+S+IAGYK FQITLTRSYN SNL+EDLK+LYRTAGQ G+GITF+FTD EIKDEGFLEY+NNVLSSG VSNLFARDE+DEIC ELIP+MKKE+PRRPPT +NL EYFL+R K NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA H+LSSF+IVC   +K +++ SMGV+HDGVA  C DYFQRFRR THVTPKSYLSF+ GYKSIY EK      LAQRM +GL KL+EA +SVA+L + LA KEKELA+A+ +A++VLK V+++  AA +VK +VQ VKDKAQ+IV+EI  DK +AE KLE A+PAL EAE AL TIKPA I+TVRKL +PPHLIMRIMDCVL+   +++D +  DPERN  KPSW ES+KLMS + FLNNL+NF KD+IN+ETVEL++ YLE +DY ++ A+RVCG+VAGL SWTRAM +FF INKEVLPLK NL  Q+ R   +  DLN AQ+ LDEKQ EL + QA+Y+ A+++KQ LLDDAE CRRKM AA+ LI GL GEK RWT QS EF  QI RLVGDVL  T FLSY GPFNQEFR +L ++WQKE+++RKIPF+++LN+  M+ D   +GEW+LQGLPNDELSVQNGIIVTKA+R+PLL+DPQGQGK WIKNRE   E+Q+TSLNHKYFR HLED+LSLGRPLLIED+GEELDPALDNVLEKNFIK GST KVKVGDKEVDVMKGF LY+TTKLPNP+YTPEI ARTSIIDFTVT+KGLEDQLLGLVI TEK ELE++R +L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI+VL  TK T+ EVSQKL++A+DTEIKIN AREE+RPVATRGSILYFLIVEMS VN MYQTSL+QFLGLF  SM RS  SP+T KRI NII+ +T+EVW+Y+ RGL+E+ K  FTLL+A K+D++  +IK  EF T IKGGASLD+    PK   WITDMTWLNLVELS L QFS +L+Q+SRNEKQW+ WFDK+APEE  IPDGY  +LDTFR+LLL+R WCPDRT+SQA+KYI +S+G ++ E  IL+ +K +EES  RTP++  LSMGSDPT  IE LAKKHK +CRAISMGQGQE+H+R+L+ +F+ TGGW LLQNCHL L++M EL+D ++E+E IH+DFRLW+TTE H +FPI  LQMSIKFTNEPPQG++AG+KRTY   +QD LD+SN+ QWRPM+Y+VA+LH+ VQERRK+GPLGWNIPYE+N AD  AS+QFVQNHLDDMDIKKG+SW T+ YMLGE+QYGGRVTDD+DKRLLNTF + WF++ MF+P F F+K + IP  + + ++++ I+ L   DSPE+FGLH NADITYQS  A+  LD IL+IQPKD+S+GGGETRES+V++M DDML KLP DY+  EV  RLQ MG L PMNIFLRQE+DRMQ+VI  VR TL DLKLAIDGTIIM+E LRD+LD MYDARIP+ W KVSWESST+GFWFTELIERN+QF TW F GRPN FWMTGFFN QGFLTAMRQEVTRAHKGWALD+VVL NDVT+  +D+I  PP+EGVYV+GL+L+GAGWDRR  KL+E  +KVLF P+PVI I AI+ S  G  +R     +YQCP+YKKPRRTDLT+IA V L+    +  DHW LR VALLCDIK
Sbjct: 1581 DSLMVLGSLMSNRYNAPFKKNIQLWVQKLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFQNIDKQWVKIMTRAHENCNVVQCCVGDETLGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDSHTIQAHLLNVFDNIKSVKFHEKDYDRIMAVISSEGETVEMVKPVMAQGNVEIWLGTLLTMSRQSLHNVIRQAYVAINDSSFNLLEFLNTFPAQVGLLGIQMIWTRDATEALTNAKYDKKVMQQTNAAFQELLNVLIEQTTKELTRVVRTKFETLITIHVHQRDIFDDLCRMHIRTPSDFEWLKQIRFYFNDDTDVCSVNITDVTFIYQNEFLGCTERLVITPLTDRCYITLAQALFMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIYIILTGKKERKKQFIFSDGDVVDMNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIIRVKLASCGFIDNITLSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRNNPGDSENTTVMRVLRDMNLSKLIDEDEPLFLSLINDLFPGIVLDKAGYPELEQAIATEAEEIGLINHPPWRLKLIQLFETQRVRHGMMVLGPSGAGKTKCIHVLMKAMTDCGTPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEKIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKIVFEPHNIDNASPATVSRNGMVYMSSSGLDWRPVVQAWINKRPIPEGEILNGFFEKSYEELLTFLRESLVSKMDILDHNYIIQTLTLLDGLIPKKD--DGGQFSSQHLEHLYVFSLMWSIGALLELDDRAKMETFMREN--FDLDLPQVSEN--ENIFEFMVNDAGEWAHWNTRVEEYVYPKDHVPDFLSILVPNVDNVCMDYLIETVSKQSKAALLIGEQGTAKTVMIKGYMSKYDPEKHLSKSFNFSSASTPLLFQRTIESFVDKRMGSTYGPPAGKKMTVFVDDINMPIINEWGDQVTNEIVRQLMETKGFYNLEKPGDFTNIADIQFLSAMIHPGGGRNDIPQRLKRQFLIFNCTLPSNASIDKIFSVIGGGYFCKERGFINDVQDFALKLVPCTRKLWQLTKVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDY---QPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAAEKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSNWQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKDNEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKTTAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELSKLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAISMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKKGVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNFYKGYVIPKGTSVQQFLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDSSSGGGETRESIVHKMADDMLEKLPEDYIQHEVKARLQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWESSTIGFWFTELIERNAQFRTWCFDGRPNVFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTRFFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAIN-STGGRDNR-----LYQCPIYKKPRRTDLTYIACVDLKT--NQNPDHWILRGVALLCDIK 4614          

HSP 2 Score: 237.269 bits (604), Expect = 6.329e-62
Identity = 110/153 (71.90%), Postives = 129/153 (84.31%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +VNGYYDILW DV+IEKI+ EL +FQNRCRKLP+ LKDW AF DL+KTIDDFN   PLLELM N AMK RHW R+++LT H FD+ESD F+LRNI+EAPLLK KE+IED+CI+AVKEKDIEAK+K V A+WS  +L F  FKNRGELLLRGD+
Sbjct: 1419 TVNGYYDILWQDVNIEKINQELLDFQNRCRKLPRALKDWQAFLDLKKTIDDFNESCPLLELMANKAMKQRHWDRIANLTGHTFDIESDTFSLRNIMEAPLLKHKEDIEDVCIAAVKEKDIEAKMKMVIADWSTKDLTFANFKNRGELLLRGDN 1571          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO32004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWB3])

HSP 1 Score: 3745.28 bits (9711), Expect = 0.000e+0
Identity = 1839/2614 (70.35%), Postives = 2176/2614 (83.24%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQ 8269
            +S  V+ +  S+ YN PFKKDIQ  V KLSN+S+IIE WM VQNLWVYLEAVFVGGDIAKQLPKEAKRF NIDKSW+KIM+RAHE +NV+ CCVGDET+ QLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDN+KTV FHEK Y+ IL+  S EGE + LE  V A+ NVEIWL  LLN A  SLHGVIR A ++IND  F ++ F+N +PAQVGLLGIQ++WTRD+ EAL +A+ D+KIM  TN++FL LLN LI  TT +L K+ERTKFETL+TIHVHQ+DIFD LVK  ++S +DF+WLKQ+RFYF ED+D CIVSITDVDF YQNEFLGCT+RLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMDFRGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI +VL+ KK+RK QF+F+DGD+VD+NPEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQII+RVKLASCGFI+N++LA+KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRA+P D+E TTVMRVLRDMNLSKLVD+DEPLF+SLINDLFPGI LDK GYPELEAAI +  ++A +I HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI+VLMKA+ +CG+PHRE+RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGE+IW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP CK++FE HNIDNASPATVSRNGMVYMSSS +DW P+LK WL  R   E  +  +LF   F +++ Y  Q L  KM+ LE  V+ Q  D+L+GLIP K+E     +S  H  RL++F++MW +GALLE+EDR K+E ++  +   KLDLPK+ + S +T+F+++V   GEW HWN++VEE++YP DS P+Y SILVPNVDNVRT+FL++T+A Q KAVLLIGEQGTAKTVMI  Y+S+ NPE HM KS NFSSAT P +FQRTIES+VDKR+G+TYGPPAGRKMT FIDDINMP+INEWGDQI NEIVRQL+E+KGFYNLEKPG+FT+IVD+QF+AAMIHPGGGRNDIP+RLKRQF IFNCTLPSN+SIDKIF +IG G +C ER FN EV  +++ L+  TR LW  TK KMLPTPAKFHY+FNLRDLSRIW+GM+N  GD I + K  L LWKHE  RVI+DRF    D  WF K + + L + + +D   +      + +F+DF+RDA E TGEEP+D D D PK+YE + S + L ++L M+  +YN+++RG  +D+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYK+FQITLTRSYN +NL++DLK+LYR AG  G+GITF+FTD EIKDE FLE++NNVLSSG VSNLFARDE+DEI Q LI +MKKE PR PPT DNL  YF+SR ++NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA ++LS FEIVC+  +K++++ +MGVVHD VAE C++YF RFRRQTHVTPKSYLSFL GYK+IY E   H   LA RM +GL KL+EA  SV +L + L  KEK+LA+A+ +A++VL  VTV   AA +VK  VQ VKDKAQ IV+EI  DK +AE KL AA+PAL EAE AL TIK ADI+TVRKL +PPHLIMRIMDCVL+ F+R +  +  D +R  P PSWGE+ KLMS++ FL  L+NF KDTINEETVEL+ PYLEMEDY ++ A++VCGNVAGL SWT+AM  F+ +NKEVLPLK NL  Q+ R + +M DLN AQ  LDEKQ EL KVQA+YD A+ +KQTLLDDAE+C+ KM AA+ LI GL GEK RWT QS EF+AQI RLVGDVL AT FLSY GPFNQ FR +L+  WQ+EL   KIPF+ +LN+  ML DP  +GEW+LQGLP D+LS+QNGIIV KA+RYPLLIDPQ QGK W+ NRE   +LQVTSLNHKYFR HLEDSLSLGRP+LIED+GEELDPALDNVLEKNFIK GST+KVKVGDKE DVM GF +YITTKL NP+YTPEI ART+IIDFTVTMKGLE+QLLG VI TEK+ELEA+R++LMEDV  NK+KMKELEDNLL+RLTSTKGSLV+DE L+ VLK TK T+ EVS+KL IA++TE KIN AREE+RPVATRGSILYFLIVEMS+VNIMYQTSLRQFLG+FD+SM+RS+KSP+  KRIQNIIE +TYEV+KY+ RGLYE+ K  FTLL+ALK++++ GK+K +EF T IKGGA+LD+     KP  WITDMTWLNLVELS L QFS +LDQV RN+  WR WFDK+APEE  IPDGY T+LDTFR+LLLVR WCPDRTL QA+KYI D++GE++AEG IL+ +  +EES  +TP++  LSMGSDPT +IE LAK+  +ECRA+SMGQGQE+H+RRL+     TGGWVLLQNCHL L++M+EL++ +  TE  H+ FR W+T E HP+FPIS LQ SIKFTNEPPQG+K G+KRTY    QD LDI+NM QW+P++YAVA+LHT VQ
Sbjct:  874 DSLMVLGSLLSNRYNAPFKKDIQSWVQKLSNTSDIIENWMVVQNLWVYLEAVFVGGDIAKQLPKEAKRFGNIDKSWVKIMTRAHETSNVVTCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNVKTVDFHEKDYDRILSIVSSEGETVPLETAVMAKGNVEIWLGDLLNQAMSSLHGVIRDAFHAINDPAFALMSFMNTFPAQVGLLGIQMIWTRDAEEALKHARHDKKIMASTNQKFLNLLNSLIDVTTQELTKMERTKFETLVTIHVHQRDIFDDLVKMHIRSVTDFEWLKQSRFYFKEDIDDCIVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTAKKDRKTQFIFSDGDVVDLNPEFGIFLTMNPGYAGRQELPENLKIQFRTVAMMVPDRQIIMRVKLASCGFIENVILAQKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRASPQDSESTTVMRVLRDMNLSKLVDEDEPLFLSLINDLFPGITLDKAGYPELEAAIQKNTEDAGLIFHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTACINVLMKAMGECGQPHRELRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGENIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPQCKVVFEPHNIDNASPATVSRNGMVYMSSSVMDWKPILKAWLNSREPQEHDVFEQLFDCVFDELHTYMKQSLHPKMDVLECNVIAQCLDILQGLIPSKEEH--GILSASHLSRLFVFALMWGVGALLELEDRAKMEEFLVDHG--KLDLPKLAEGSHETIFEFVVDSKGEWEHWNNRVEEWVYPTDSKPDYASILVPNVDNVRTNFLVDTIAKQSKAVLLIGEQGTAKTVMIKGYMSTYNPELHMTKSSNFSSATTPLLFQRTIESYVDKRVGTTYGPPAGRKMTAFIDDINMPIINEWGDQITNEIVRQLMEMKGFYNLEKPGEFTHIVDIQFLAAMIHPGGGRNDIPERLKRQFSIFNCTLPSNTSIDKIFGVIGCGWFCPER-FNSEVSDIIKQLVVCTRILWQQTKIKMLPTPAKFHYIFNLRDLSRIWEGMLNVTGDEIDSRKLALALWKHEVTRVIADRFTNEVDREWFEKQITKSLVDTVGDDAAGE---LMAEPFFVDFLRDAPEVTGEEPEDADLDAPKIYELVPSLEFLNEKLGMYMMMYNDTVRGGHLDLVFFKDAMIHLVKVSRIIRTPCGNALLVGVGGSGKQSLTRLASFIAGYKMFQITLTRSYNATNLMDDLKYLYRVAGSDGQGITFIFTDNEIKDEAFLEFLNNVLSSGEVSNLFARDELDEITQNLISVMKKELPRVPPTQDNLYNYFISRARKNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFTRWPKDALIAVADYFLSKFEIVCSAEIKQKVVQTMGVVHDMVAEACIEYFDRFRRQTHVTPKSYLSFLDGYKTIYAENKGHIGELANRMKTGLDKLVEATMSVNQLSKELVVKEKDLAVASVKADKVLAEVTVSAQAAEKVKASVQKVKDKAQIIVDEINADKVVAEGKLAAAKPALEEAEAALQTIKAADISTVRKLAKPPHLIMRIMDCVLLLFRRSISNVVPDFDRGCPTPSWGEAQKLMSSSGFLQALMNFQKDTINEETVELLQPYLEMEDYNLETAKKVCGNVAGLCSWTQAMSFFYGVNKEVLPLKANLIVQEARLKVAMGDLNKAQGQLDEKQAELDKVQAMYDAAVGEKQTLLDDAESCKNKMVAASALINGLGGEKERWTQQSKEFQAQIGRLVGDVLLATGFLSYSGPFNQTFRTLLSARWQQELEANKIPFTENLNLTSMLADPATIGEWNLQGLPTDDLSIQNGIIVNKATRYPLLIDPQTQGKAWLLNREKANDLQVTSLNHKYFRNHLEDSLSLGRPMLIEDVGEELDPALDNVLEKNFIKSGSTYKVKVGDKECDVMSGFTMYITTKLGNPAYTPEISARTAIIDFTVTMKGLEEQLLGRVINTEKEELEAERVKLMEDVTSNKRKMKELEDNLLYRLTSTKGSLVEDESLVAVLKITKETAEEVSEKLAIAAETETKINLAREEFRPVATRGSILYFLIVEMSMVNIMYQTSLRQFLGVFDMSMARSEKSPIPAKRIQNIIEFLTYEVFKYSCRGLYENHKFLFTLLLALKIEIQDGKVKNQEFQTLIKGGAALDLKACPAKPFKWITDMTWLNLVELSKLPQFSGILDQVRRNDSGWRGWFDKDAPEEHPIPDGYQTSLDTFRKLLLVRSWCPDRTLPQARKYIADAMGERYAEGVILNLEATWEESDTKTPLICFLSMGSDPTGSIESLAKRKGIECRAVSMGQGQEVHARRLIQQSCATGGWVLLQNCHLGLNFMDELLETVTNTENAHETFRTWITCEAHPQFPISLLQSSIKFTNEPPQGVKPGLKRTYAGITQDQLDITNMPQWKPILYAVAFLHTVVQ 3479          

HSP 2 Score: 229.95 bits (585), Expect = 9.203e-60
Identity = 107/151 (70.86%), Postives = 125/151 (82.78%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
             VNGYYDILW +VDIEKI+NEL +FQNRCRKLPK LK+W AF +L+K IDDFN   PLLELM N AMK RHW+R+++LT H FDVE++ F LRNI+EAPLLK KE+IEDICISAVKEKDIEAKL  V A+W + E  F +FKNRGELLL+G
Sbjct:  712 GVNGYYDILWTEVDIEKINNELLDFQNRCRKLPKALKEWDAFNELKKKIDDFNECCPLLELMANKAMKERHWERLANLTGHKFDVENENFLLRNIMEAPLLKHKEDIEDICISAVKEKDIEAKLSQVVADWKSQEFSFASFKNRGELLLKG 862          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO42024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2L5])

HSP 1 Score: 3402.84 bits (8822), Expect = 0.000e+0
Identity = 1684/2381 (70.73%), Postives = 2000/2381 (84.00%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGE-EPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQV 7567
            +S  V+ +  S+ YN PFK +IQ  V+KL+ S+EIIE W+ VQNLWVYLEAVFVGGDIAKQLP+EAKRFS IDKSW+KIM RAHEN NV+QCCVGD+TL QLLPHLLEQLEICQKSL+GYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL VFDN+KTV F EK+Y+ ILA  S E E + LEKPV A+ NVE+WL  LL  A  SLH VIR A+  I D  F ++EFL+ YPAQVGLLG+Q++WTRD+ +AL +A+SD+KIM Q N+ FL +LN LI+ TT +L KVER KFET ITIHVHQ+DIFD LV+  +K+PSDF+WLKQ+RFY+ E+ D+C+VSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGM+MGGAPAGPAGTGKTET KDMG+ LGKYVVVFNCSDQMD+RGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERKKQF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKI FR VAMMVPDRQIIIRVKLA+CGFI NIVL+ KF+TLYKLCEEQLTKQVHYDFGLRNILSVLRTLG  KRANP D+E   VMRVLRDMNLSKLVD+DEPLF+SLI+DLFPG+QLDK GYP++E AI + ++EA +I+HPPWVLKLIQL+ETQRVRHGMM LGPSGAGKT CI++LMKA+T CG PH+E RMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TL+ KKG+HIW+VLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSP+CK++FE HNIDNASPATVSRNGMVYMSSSALDW P+L+ WL  R+S E  I+  LF   F D+  +    ++ +ME LE   + QA +LL GLIP +D    +  S  H E+L+IFS+MWSIGALLE+ DR K++  + +  ++K   P +    +DT+F+Y+V++ G+W HW+ +VE Y YP DS PEY  ILVPNVDNVRTDFL+N +A QEKAVLLIGEQGTAKTVM   Y    +PE H+FK++NFSSAT P MFQRTIES+VDKRMG+TYGPPAG+KMT FIDDINMP+INEWGDQI NEIVRQL+E+KGFY+L+KPG+FT+IVD+QF++AMI PGGGRNDIP RLKRQF +FNCTLPSN+SIDK+FS IG G++ K RGF  EV  ++  L+  TR+LW  TK KMLPTPAKFHY+FNLRDLSRIWQGM+    +++   K LL LWKHEC RVI+DRF    D  WF K+L   + ED   ++   S + + + +F+DF+RDA E TG+  P+D +F+ PKVYEP+ +F+ L +RL  F  +YNE++RG  MD+VFF DAMTHL+KISRIIRTPRGNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTRSYN+SNL++DLK LY+TAG +GKGITF+FTD EIKDE FLEYMNNVL+SG VSNLFARDE+DE+  +LI +MK EYPRRPPTN+NL +YF++R K NLHVVLCFSP+GEKFRNR+LKFPGLISGCTMDWF RWPKDALIAVA ++LSSF++ C P VK+ ++ +MG+ HD VAE C  YF+RFRRQTHVTPKSYLSF++GYK IY ++      LA RM++GL KL+EA ESVA+L E L  KEKELA+A+R+A+ VL+ VTV   AA +VK++VQ VKDKAQ+IV+EI  DK+IAE KLEAA+PAL EAE AL TIKPA I+TVRKL +PPHLIMRIMDCVL+ F +++D +  DP+R   KPSWGES+K+MS   FL  L+NFPKDTINEETVEL++PYLEMEDYT++ A++VCG+VAGL SWTRAM  F+ INKEVLPLK NL  Q+ R  K+  +LN AQ+ LDEKQKEL  VQA YD+A+R KQTL+DDAE CRRKM  A  LI+GL GEK+RWT QS +F  QI RLVGDVL AT FLSY GPFNQEFRN+L ++W+K++R  KIPFS  +N+ +MLTD   +GEW+LQGLPNDELS+QNGIIVTKASRYPLLIDPQGQGK WI+ +E   ELQ+TSLNHKYFR H+ED+LSLGRPL+IED+GEELDPALDN+LEKNFIK G T+KVKVGDKEVDVM GF LYITTKL NPSYTPEI ARTSIIDFTVTMKGLEDQLLG VI TEKQELEA+R +LME+V  NK++MK+LEDNLL+RLTST+GSLV+DE LI+VL +TK TS EVS+KLI+A++TE+KIN+AREEYRPVA RGSILYFLIVEMS VN+MYQTSL+QFLG+FD+SM+RSQKSP+  KRIQNII+ +T+EV++Y  RG YE  K  FTLL+ LK+D++  KIK EEF   IKGGA+LD+N V+PKPK WI D+TWLNLVELS L QF+++L QV
Sbjct: 1547 DSLMVLGSLLSNRYNAPFKAEIQKWVAKLTGSTEIIENWLIVQNLWVYLEAVFVGGDIAKQLPQEAKRFSQIDKSWVKIMQRAHENANVVQCCVGDDTLGQLLPHLLEQLEICQKSLSGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLGVFDNVKTVTFDEKEYDKILAINSRENEQIMLEKPVVAQGNVELWLFALLKEAMNSLHAVIRMASVGIKDPSFKLIEFLDAYPAQVGLLGLQMIWTRDAEDALSSARSDKKIMAQRNQYFLDMLNELIEVTTRELTKVERIKFETFITIHVHQRDIFDDLVRKNIKTPSDFEWLKQSRFYWREETDQCLVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMAMGGAPAGPAGTGKTETTKDMGKALGKYVVVFNCSDQMDYRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKKQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKIMFRTVAMMVPDRQIIIRVKLAACGFIRNIVLSAKFFTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGAVKRANPEDSEDRIVMRVLRDMNLSKLVDEDEPLFLSLIDDLFPGLQLDKAGYPDIEQAIAQCVEEAKLINHPPWVLKLIQLYETQRVRHGMMALGPSGAGKTKCINILMKAMTICGAPHKEFRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGDHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPTCKVVFEPHNIDNASPATVSRNGMVYMSSSALDWKPILQSWLKTRSSTESEILFNLFEQLFDDVQNFLTVSVVPRMELLECNYIVQASNLLNGLIPGEDAPKQADAS--HLEKLFIFSIMWSIGALLELSDRKKVKFMMETFPDLKW--PPV--SGQDTIFEYVVNDQGDWQHWSERVEAYDYPTDSVPEYSGILVPNVDNVRTDFLINCIAKQEKAVLLIGEQGTAKTVMTKGYCERYDPELHVFKAMNFSSATTPNMFQRTIESYVDKRMGTTYGPPAGKKMTSFIDDINMPIINEWGDQITNEIVRQLMEMKGFYSLDKPGEFTSIVDIQFISAMIQPGGGRNDIPSRLKRQFTVFNCTLPSNASIDKVFSTIGCGYFHKARGFPVEVVNMISPLVASTRKLWQKTKVKMLPTPAKFHYIFNLRDLSRIWQGMLVVTSEILKTPKVLLNLWKHECHRVIADRFTNQPDRDWFEKSLMAVVEEDFGAEV---SAMIDPEPYFVDFLRDAPEPTGKSHPEDAEFEAPKVYEPVETFESLNERLDSFVEMYNETVRGGRMDLVFFKDAMTHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSYNVSNLMDDLKVLYKTAGHEGKGITFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEMTNDLISVMKAEYPRRPPTNENLYDYFITRVKNNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVASYFLSSFDVKCKPEVKEAMVNTMGIFHDTVAEFCTQYFERFRRQTHVTPKSYLSFISGYKQIYSQQHSDIDLLATRMNTGLAKLVEATESVAKLSEELVIKEKELAVASRKADVVLQEVTVSATAAEKVKSQVQKVKDKAQAIVDEIAEDKQIAEGKLEAAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLFMKKIDPVQQDPDRPCVKPSWGESLKVMSQGGFLTTLLNFPKDTINEETVELLAPYLEMEDYTMENAKKVCGDVAGLASWTRAMAIFYGINKEVLPLKANLVIQEARLNKATTELNVAQAQLDEKQKELDAVQAKYDQAMRDKQTLVDDAEACRRKMANATALIDGLGGEKIRWTEQSKKFDQQIQRLVGDVLLATGFLSYSGPFNQEFRNLLQSTWKKDMRKAKIPFSEDINLTNMLTDAATIGEWNLQGLPNDELSIQNGIIVTKASRYPLLIDPQGQGKAWIRTKEQPNELQITSLNHKYFRNHMEDALSLGRPLIIEDVGEELDPALDNILEKNFIKSGKTYKVKVGDKEVDVMDGFRLYITTKLGNPSYTPEISARTSIIDFTVTMKGLEDQLLGRVILTEKQELEAERTKLMEEVTANKRRMKDLEDNLLYRLTSTQGSLVEDESLIEVLSSTKATSEEVSEKLIVAAETELKINTAREEYRPVANRGSILYFLIVEMSYVNVMYQTSLKQFLGVFDISMARSQKSPIPAKRIQNIIDYLTFEVFRYTTRGFYEEHKFLFTLLLTLKIDLQEKKIKHEEFQVLIKGGAALDLNAVEPKPKKWILDLTWLNLVELSKLPQFTSILGQV 3918          

HSP 2 Score: 209.92 bits (533), Expect = 1.064e-53
Identity = 99/151 (65.56%), Postives = 117/151 (77.48%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRG 455
            +VNGYYDILW ++DIEKI+ EL +FQNR RKLPKGLK+W AF +L+KTIDDF+   PLLE+M N AMK RHW R+S +     DVES+ F LR ++ APLL  KEEIEDICI+AVKEKDIE+KLK V  EWSA    F  FKNRGELLL+G
Sbjct: 1385 NVNGYYDILWQEIDIEKINQELLDFQNRIRKLPKGLKEWQAFLELKKTIDDFSECCPLLEMMANKAMKERHWGRISQMVGVTLDVESETFQLRQLMSAPLLPNKEEIEDICIAAVKEKDIESKLKGVIGEWSAQSFSFAGFKNRGELLLKG 1535          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1866.66 bits (4834), Expect = 0.000e+0
Identity = 1130/3085 (36.63%), Postives = 1731/3085 (56.11%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILAC--YSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAA-NNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK-SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLK-GKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKR-NSNERPIMLELFTNSFPDIYRYSIQYLI-----YKMETLEAF----VVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDL-------PKIEKDSEDTMFDYMV-SENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMD--FMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNE-SIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEE---IERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEF-RNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKV---ECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNH----LDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFND---DMFNPKFRFFK----DHSIPAVSK------LNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTK-HMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVY-LRCPPTKQADHWTLRAVAL 9565
            PF + +      LS+  E++E WM VQ  W+YLE++F+GGDI  QLP+EA++F +IDK++ KIM+   +N  VL+ C     L QL   +    + CQKSL  YL+ KR  FPRFFF+SD  LL ILG + DP  +Q H++ +FDNI +++F E   +  LA    S EGE+++  + V AE  VE W+  +L   +R+   + + A  N  N  +   +E++  Y   V L G Q+ WT +  +     K  D+  M+    +    ++ L+ +  ++L K +R KF T++ I VH +DI D  V+D +    +F+W  Q RFY+ +  D  ++     +F Y  E++G   RLVITPLTDR Y+T+ QAL M +GGAPAGPAGTGKTET KD+ + LG   VV NC + MDF+ +G+IF GL+Q G+WGCFDEFNRID+ VLSV + QI  + +      K+  F +G  + ++   GIF+TMNPGYAGR ELPE++K  FR V  +VPD Q I  + L S GF+   VLA+K   LYKL   QL+KQ HYDFGLR + +VL   G+ KR +P  +E   +MR LRDMNL K V +D PLF+ LI DLFPG+   +  YP    A+   + +   I  P    K++Q++ET   RH  M +GP+G GKT  I+ L  A T  G   +   MN KA T  +++G LD  T DWTDG+ S ++R   K   K E  ++V DG VDA+W+EN+NSV+DDNK LTLANG+RI +   C ++FEV ++  ASPATVSR GMVY+    L + P  + W   R N+ ER  +  LF    P      ++ ++      K++T+       +V Q   +L+ L+P  +   S+ +     E ++I S++WS GA L  + R   +  I+    I  +        P     ++ T+++Y   S+   WV W   V EY++  D   +Y  ILVP VD VRT +L+  + +  + VLL+GE GT+KT     YL   + +  +  ++NFSS T     Q  +E+ V+KR   TYGPP G+++ VF+DD+NMP ++E+G Q    +++ LLE  G Y+  K   + N+ D+ F+AAM  PGGGRN++  R    F +FN T PS  S+ +I+S I TGH    + F   ++ LV+++   T  L+      + PTP+KFHY+FNLRDLSR++QG+  T  D   +    + +W++EC RV  DR     D       +   + ++ SE          TD    D     D +    E+        P++YE +  +D  K    +FE +  E ++  A M++V F DA+ HL +I R+IR  +G+ALLVGVGGSGKQ+LTKLA++ AG  +F+ITLTR Y+ ++  EDLK LY + G + K + FLFTD  +  EGFLE +NN+L+SG+V  L+  DE + I  ++     K     PP  +++ +YF+++   NLH+VL  SP+G+  R R   FPGL          + P      V  H +                     VH  V      + Q+ RR  + TPK+YL F++ Y  + + K  +      R++ GL KL+ A E +AEL E LA ++  +   +   E++L  +      ANE   K ++   K + I E+   I  +K  AE  L AA PAL EA+ AL  +  +D+  +R   +PP  +  + +C++               R   + SW  +  +MS   FL +L     D I    V+     L+  + T++  + V    AGL  +  A+M +  + +E+ P ++ + + +  +  S  +L   +  L   ++EL ++   YD+A+R+K +L ++AE   R++ AA +LI GL  EK+RWT    + K Q  RL+GD L   AFLSY G F  +F R++L   W+ ++  R+IP S    +  +LT+   + +W+ +GLP D+LS++NGI+ T+ASRYPL IDPQ Q   WIK +E +  L+V + N   F + LE ++  G P+L +D+ E +DP +DNVL+KN   +     V +GDKEVD    F LY+ TKL NP YTP  F+R  ++++TVTMKGLEDQLL +++  E++ELE QR +L+++   NK+ +K+LED LL  L +++G+++D+ +L++ L+ TK  + EVS+KL + + T I I+  R+ YRP A  G++L+F++ EMS+VN MYQ SL  +L +FDLS+ +S    +  KR++NI++ +T  V+ YA  GL+E  K+ F+  M +K+    GK+K EE   F+KG  +L+ +  Q KP +W+ D  W +++ L  +    F ++ D + RNEK WR+W D +APE    P  Y  +L  F+RLLL+RC+  DR       ++   +GEK+    +L  + + E+S P +P++ +LS GSDP   +  LA++      + + ++MGQGQE  + +L+   +  G W++LQNCHL + ++  L   +      H DFRLW+TT+  P+FPI  LQ S+K   EPP G+K  ++ TY   +   L       + P+V+ + + H  VQERRK+G +GWNI Y++N +D    +  +  +    L + D+K  + W ++ Y++GE+ YGGRV DD+D+R++ T+   +  D   D F P F F+     D+ IP   +       + Y+D I ELP  ++P++FGLH NA+I Y +  A+ +   ++ +QP+ A   GG +RE  + ++  D+ GKLP     F+V    + +  + P  + L QE+DR   +I ++ T+LI+L+ A+ G + M+ +L +   S+++  IP+           +LG W     +R  Q++ W+  G P   W++G      +LTA+ Q   R H GW LD   L+  VTK H  DE+ +    G +V GLYLEGA WD   S L   K KVL E LPV+ +  I      E  R  L+N ++ PVY   +R +   +  V+      T+   HW L+ V L
Sbjct: 1312 PFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEK-CQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRTNRLITKEAIYNYCN--QITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDRKKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQF-EGTEIALDARMGIFITMNPGYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGELKRGSPELSEDVVLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAE--SSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDL--KYNEILVPTVDTVRTTWLLQLMVNIHRPVLLVGETGTSKTATTANYLRGMDQDTTLLLNINFSSRTTSINVQHNLEANVEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHL---QPFPKNIQDLVEHITTSTLELYTNIIRDLPPTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSE---------HTDIAMRDPCLFGDYRNTLTED--------PRLYEDVVDYDATK---AIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANK--AGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL--------NDKIPDQYRETVVDHVV--------------------FVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANE---KKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVAL-------------RGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQ-KPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVK--IPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQP-FHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQTAGDSGGISREEFITKIASDIQGKLPP---LFDVDRVRKNLSEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAVIWLSGLHIPDSYLTALVQATCRKH-GWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPI------ESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCL 4304          

HSP 2 Score: 81.6481 bits (200), Expect = 6.959e-15
Identity = 38/135 (28.15%), Postives = 72/135 (53.33%), Query Frame = 3
Query:   21 DILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTF 425
            + LW ++D+  +S+ +  +  + ++LP+ +K  P    L + + +F + +PL   + N A++ RHW+++ D+T   FD+  + F L+N+    L  F + I DI  SA KE  IE  +  V   W+A +     +
Sbjct: 1139 NTLWANLDVSVLSDGIDGYIKQLKRLPREVKALPLCHVLEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMFAMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMKFTVAKY 1273          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1739.93 bits (4505), Expect = 0.000e+0
Identity = 1024/2771 (36.95%), Postives = 1576/2771 (56.87%), Query Frame = 2
Query:  440 VVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHE-----KQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAK--SDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDC---GEPH----REMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLE-LFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDE---KDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVS-ENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSE--DLS-EDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDK-----KIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRN-ILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKP-KAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIE---TEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFN-QDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMF-NPKFRF--FKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSN 8638
             ++  ++  Y   F+ ++      LS   E++E  +TVQ  W+YLE +F+G DI KQLP+E+  F +++ +W  IM R +++ N L+       L  L     +  EI QKSL  YLE KR +FPRF+F+S+  LLEILGQ+ +P  +Q HL   FDNIKT+K         + E +   YS EGE +E    V  E  VE WL  +    + +L  +++     +  +     +++  +P Q+ +   Q+ WT D  +AL ++K   D+K ++   ++ + +LN   +     L K++R K   L+TI VH +D+ ++L+K      + F+WL Q R Y+ +D+D C+V  T+  F Y  E+LG + RLVITPLTDRCY+TL  AL +  GG+P GPAGTGKTETVKD+G+ LG YV+V NCS+ +DF+ +GR++ GL+Q+G+WGCFDEFNRI++ VLSV AQQI  +LS       +FVF +G  +++    GIF+TMNPGYAGR ELP+NLK  FR ++M VPD  +I  + L + GF +  VLA+K +TLY L  +QL+KQ HYDFGLR + SVLR  G++KRANP  +++  ++  ++DMN++KL  QD PLF  +++DLFPGI+     Y +L  AI  ++ +      P  +LK+IQL+ET+  RH  + +G +G+GK+    VL  A+T     GEP     RE  +NPKA++  +++G  D++TN+WTDG+ S++ R+T   +K E  W++ D PVD +WIE++NSV+DDNK LTL NG+RI M     ++FEV ++  ASPATVSR GMVY     L W P +  WL +R   +    L+ LF    P +  +   +    + T E   V   C L + L   ++     +    +R+  E  ++F ++WS+ A ++ + R K++ ++R    ++   P     ++DT+++Y V  +   W  W  K+        S P Y  I++P VD VR DFL+  +   ++ VLL G  GT KT +  K L   +P+ +    +N S+ T     Q  IES V+KR    Y P  G++M  F+DD NMP  + +G Q   E++R  ++  GF+          + DM  +A+M  PGGGR  I +RL+ +F + N T P  S I +IF   GT    K + F ++V+ L   +   T  ++     KMLPTP + HY+FNLRD+S+I+QG++    D+      +  LW HEC RV SDR +   D   FV  L   L    DL+  ++    Q       F +FM+D          DT      +YE +  F  +K  ++     YN       +++V F DA+ H+ +I R+I  PRGN LLVG+GGSG+Q+LT+LASYI  YK+FQI +T+ Y      +DLK LY  AG   K   FLF D +  +EGFLE +NN+LSSG V NL+  DE +E+   L  I  KE  +  P  +++  +F+ R + NLH+VLC SP+G+ FRNR   +P  ++  T+DWF  WP DAL+ VA  YL + E+      K  +      VH  V +         +R  +VTP +YL  ++GY+S+  EK     + A ++ +GL K+ + +  V  +   L +   ++A   ++ EE L  +  QK  A+E +  VQ   +K       IE DK     + A+  L+ A PAL+EA  AL ++   D+  ++  GRPP L+ ++M+ V+I  Q               +P+W E+ + + +  F+  L+N+ KD + +  ++ I  Y    D+  ++  RV      L  W RAM  +  I + V P K  L +   + E+    L  A++ L E    + +++  YDE   +K+ L   AE    K+  A +L+ GLAGE+ RW    +  +  I  LVGD L A AF+SY GPF   +R+ ++  +W  ++R   +  + + +    L  PT + EW++QGLP+D  S +NG++VT+ +R+PL+IDPQGQ   WIKN E +  L++  L    + + LE+++  G P+L++++ EELDP+L  +L K+ +K G  + +K+GDKEV+    F  YITTKL NP YTPEI  +T+I++F V  +GLE QLLG+V++ E+ ELE Q+  L+ ++   KKK++ELED +L  L + +GSL+DDE L+  L ++K TS EV+++L ++  TEIKI++ARE YRP A R SIL+F++ +M  ++ MYQ SL  ++ LF+ S+ +SQ+SP    RIQN+ E  TY V+KY  RGL+E  K+ F+  M  K+   AGK+ ++E++ F++GG  LD       P   W+TD +W N+ EL  L  F  ++    +  + W QW+    PE   +P  +    +  +R+L+VR   PDR    A  +I ++LG KF E  +LD   V ++S  RTP++ +LS G DPT  +  LA+   +  R  A+S+GQGQ   + R++   +  G WV L NCHLSL +M +L D+++E    E  H DFRLW+++  HP+FPIS LQ+ IK T EPP+G+KA +KR Y     Q F       +++ +++ + + H+ + ERRKF  LGWNI Y +N +D   S   +  +LD+ +      W  + Y++  + YGG VTDD+D+RLL+++    FND     P ++      + +P    L+ Y   +  L    +  +F  HS+
Sbjct: 1229 TLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEI-QKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAV-GMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVF-EGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLLSMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARM-LELWFLFCLIWSVCASVDEDSRKKMDNFLRE---LEGQFP-----AKDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFY-KIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDY-GFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIF---GTMINQKLQDFEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQ----SPIFGNFMKD----------DT------MYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTP--ESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIEL-GDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIA-----IEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQ--------------SEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQL-DKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYE---ETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPLFARHSS 3936          

HSP 2 Score: 72.0182 bits (175), Expect = 5.825e-12
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 3
Query:   84 RCRKLPKGLKD--WPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLR 452
            R  K+ + +KD  W   + ++  I+ F   +PL++ + N AM+ RHW ++       FD   D F L  I+E  L +F E+I +I  +A KE  IE  +  + + W    L  G +K+RG   L+
Sbjct: 1090 RLNKIIREVKDKNWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLK 1214          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 4289.57 bits (11124), Expect = 0.000e+0
Identity = 2124/3053 (69.57%), Postives = 2522/3053 (82.61%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+ +  S+ YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTDRCYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T  +VI +   LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EATGEEP+++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTR YN +NL+EDLK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+ V+ H+LS+F+I C+P VK E++  MG   D VAE CVDYF R+RR THVTPKSYLSF+ GYK+IY EK       A+ M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQGLPNDELS+ NGIIVTKA+R+PLLIDPQ QGK WIKN+EA+ ELQ+TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+E+E +R  L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++RS KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IKGGASLD+     KP  WI DM+WLNLVELS L QFS +LDQ+S +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FEV +RLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP +    SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A     E  + +D    +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct: 1084 DSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEK------RAEVMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIP-ARWMKSWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-----ENNVVKD--PRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 4113          

HSP 2 Score: 213.772 bits (543), Expect = 1.909e-54
Identity = 99/152 (65.13%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDILW +++IEKI+NEL +FQ RCRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++++T H+ DVES+ F LRNI+EA  LK+KEEIEDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD
Sbjct:  922 TVNGYYDILWTNINIEKINNELLDFQTRCRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGD 1073          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3919.01 bits (10162), Expect = 0.000e+0
Identity = 1999/3045 (65.65%), Postives = 2377/3045 (78.06%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLD-QVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLS-QAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFE--VMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            YN PFK  IQ  V  LSN+S+IIE WM VQNLW+YLEAVFVGGDIAKQLPKEAK FS+IDKSW+KIM+RAHE  NV+Q CVGD T+ QLLPHLLEQL+ CQKSLT YLEKKRLLFPRFFFVSDPALLEILGQASD HTIQ+HLL+VFDNIK+V+FHEK Y+ ILA  S E E +EL++P+ AE NVE+WL  LL  +QRSLH VIR A  +I +  F +++FLN + AQVGLLGIQ++WTRDS EAL NA  DR IM +TN+ FL LLN LI  TT DLG VERTK+ETLITIHVHQ+DIFD L +  + +PSDF+WLKQ RFYF ED D+  ++ITDV F YQNEFLGCTERLVITPLTD                           ET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFK L+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KK EHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K++    ++ R H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+    WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T  +VI +   LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EAT E  +++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLT  YN +NL+EDLK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+  + H+LS+F+I C+P VK E++  MG   D VAE CVDYF                                      M++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLV DVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQ                                             +TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+                                    SLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRP ATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++ S KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IK GASLD+     KP  WI DM+WLNLVELS L QFS +LD Q+S +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++ QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FE  V ERLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP+    + SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A +  K+          +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct: 1292 YNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEK-YDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMT-CGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKK-EHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQ--CGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAE-HWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATEEP-EESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE-SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYF--------------------------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQ---------------------------------------------ITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKR------------------------------------SLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLA-SSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIK-GASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTY-GINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVKD--------PRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 4159          

HSP 2 Score: 153.295 bits (386), Expect = 3.413e-36
Identity = 79/152 (51.97%), Postives = 96/152 (63.16%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VNGYYDILW +++IEKI+NEL +FQ  CRKLP+ LK+W AF DL++TID+F+   PLLELMT+ AM  RHW+R++                               EDICISAVKE+DIE KLK V  EW      F  FKNRGELLLRGD
Sbjct: 1150 TVNGYYDILWTNINIEKINNELLDFQT-CRKLPQALKEWQAFLDLKRTIDEFSECCPLLELMTSKAMMARHWKRIT-------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGD 1269          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 3789.96 bits (9827), Expect = 0.000e+0
Identity = 1864/2689 (69.32%), Postives = 2219/2689 (82.52%), Query Frame = 2
Query: 1535 TPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQG---DVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFE--TDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKN--MYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            T L   CYITLAQALGM MGGAPAGPAGTGKTET+KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA+VL+CKK+R K FVFTDGD VDMNPEFGIFLTMNPGYAGRQELPENLKINFR+V+MMVPDRQIIIRVKLASCGFIDN+ LA KF+TLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KRANP+DTE T V RVL+DMNLSKL+D+DE LF+SLI DLFPGI+L+K GYPELEAAI+++I E  +I+HPPW LK+IQ++ETQRVRHGMM LGPSG+GKT CI +LMKA+T+CG+PHREMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWR+TLK KKGEHIW+VLDGPVDAIWIENLNSVLDDN+TLTLANGDRIPM+P+CK++FE HNIDNASPATVSRNGMV+MSSS L W P+L+GWL +R+ NE  ++ +LF++SF ++YR+S+Q L +KM+ LEAFV+ Q  ++L+GLIP K     +Q    H ERLYIF++MWS GALLE+EDR K+E + R N+ I+  LP+I    E+TMFDY V+  G WVHW+++VEEYIYP D TP+Y SILVPNVDNVRTDFL++T++ Q KAVLLIGEQGTAKTV++  ++S  +PE  + K LNFSSAT P MFQRT+ES+VDKRMG+TYGPPAG+KM++ IDDINMPV+NEWGDQ+ NEIVRQL+E KGFYNLEKPG+FTNIVD+QF+AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF +IG GH+C +RGF +EV++ +  L+ +TRRLW LTK KMLPTPAKFHY+FNLRDLSRIWQGM+ T     ++I   + LL LWKHEC RVI+DRF   +D+ WF +TL + + + L E+     +V +   + +F+DF+RD  EATGEEP+++DFDMPKVYEPI SF+ LKDRL MF   YN+SIRG GMDMVFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LAS+IAGYKIFQITLTRS  +  L+  LK LYR AG QGKGI+F++TD EIK+E FLEYMNNVLSSG VSNLFAR+EMDEI  +L+P+MK+E+PRRPPTN+NL +YF+SR + NLHVVLCFSP+GEKFRNRALKFP LISGCTMDWF RWPKDAL+ V+ H+LS+F+I C+P VK E++  MG   D VAE CVDYF R+RR THVTPKSYLSF+ GYK+IY EK      LA RM++GLQKL EA ESVA L + L  KEKEL IAN +A+ VLK VTV+  A+  VK +VQ VKDKAQ+IV+ I  DK IAE KLEAA PAL EAE AL TIKP+DIATVR L RPP LIM+ MDCVL+  +RR++ +  + E N    SW ES+ LM++  FL+ L  FPKDTINEETVEL+ PY  + +Y I+ AR    NVAGLLSWT+AM SFF INKEVLPLK NL  Q+ R   +  DL  AQ+ LD KQ EL  V+A Y+EA+ +K TLL+DA+ CRRKM  A+ LI GLAGEK RWT QS EF AQ  RLVGDVL ATAFLSY GPFNQEFR++L   WQ EL+ R IPF  +L+I ++L D + + EW+LQGLPNDELS+ NGIIVTKA+R+PLLIDPQ QGK WIKN+EA+ ELQ+TSLNHKYFR HLE+SLSLGRPLLIED+GEELDP LDNVLEKNFIK GST+KVK+GDKEVDVMKGF+LY+TTKLPNP+YTPEI ARTSIIDFTVT++GLEDQLLG VI TEK+E+E +R  L+EDV  NK+KMKELEDNLL+RLTST+GSLVDDE LI VL  TK T+ EV+QKL IA DT+I+IN+AREEYRPVATRGSILYFLI EMS+VN+MYQTSL QFLGLFDLS++RS KS  T +RI++IIE MT++V+ YA RGLYE  K  FTLL+ LK+DM+   +  +EF T IKGGASLD+     KP  WI DM+WLNLVELS L QFS +LDQV  +EK W+ WFDKEAPEEEV+P+ Y + LD FRRLLL+RCWCPDRT++QA+KYI+D++GEK+ EG ILD +  +EES PRTP++  LSMGSDPT +I  L KK K+E R +SMGQGQE+H+R+L+   +  GGW LLQNCHL L++M+ELMD +IETE I+D FRLW+TTE+H  FPI+ LQMSIKFTNEPPQG+KAG+KRTY   NQD LD+SN  QW+PM+Y VA+LH+ VQERRKFGPLGWNIPYE+N AD NA++QF+QNHLDDMD K+ +SW T+ YM+GEIQYGGRVTDDYDKRLLNTF + WFN +MF   F F+K + IP  S +++Y+  I  LP YD+PE+FGLH NADIT+QSK A+ +LD IL+IQPKD+S+GGGETRE+ V RM DDML KLP DY+ FEV +RLQ MG L+PMNIFLRQE+DRMQ+VI  VR+TLIDLKLAIDGTIIM+E+LRDALD MYDARIP+ W K SW SSTLGFWFTEL+ERN QF TWLFKGRPNCFWMTGFFN QGFLTAM+QE+ RA+KGWALD +VL N+VTK M+D+I  PP++GVYVYGLYLEGA WDR N +L ESK KVLFE +PVI + A + +   E  + ++K+  +Y CP+YKKP RTD+  IASV L+   T+  +HW LR VALLCD+K
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQ----HLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVTAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNII--FQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEE---HKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEV-KRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKT--TQPPEHWVLRGVALLCDVK 2687          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1569.67 bits (4063), Expect = 0.000e+0
Identity = 1016/3065 (33.15%), Postives = 1629/3065 (53.15%), Query Frame = 2
Query:  467 YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFH-EKQYETIL-ACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNA-KSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHY-ERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIK-LDLPKIEKDSED-----TMFDYMVSENGE-WVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDV-ITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFR-NILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKEL-QVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNL--HQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMS---WKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNP--KFRFFKD----HSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFK-GRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTD-----LTFIASVYLRCPPTKQADHWTLRAVAL 9565
            +  PF   IQ     L+  SE IE W+ VQ+ W+ LE +F G DI  QLP+EAK+   I K + +IM       N+ +CC     LS L     +   I QK+L  +L+ KR  FPRFF +SD  LL +LG   DP  IQ H++ ++DNI++++   +   +T++ A  S EGE +E  KPV  E+ VE W+M +L   +R+   + + A        ++ ++++  Y   + L   ++ WT +   A+ N  K D+  +++  EQ    ++ L+        + +R K   ++   VH +DI D  V   +K   DF+W  Q RFY+V++ D   V   +    Y  E++G   RL ITPLT R Y+TL QAL M +GGA AGPAG GKTETVKD+ + LG + VV +C++ MD   LG+I  GL++ G WGCFDEFNRI   VLSV + QI  + +      K F F +G  + ++   GI++TMNP Y  R ELPE++K+ FR V ++ PD Q I  + L S GF+    LA+K   LYK    QL+KQ HYDFGL +  SVL+  G+ KR +   +E   +MR LRD+NL KLV +D P+F+ LI+D+FPG+   + G+P     +   + ++     P  V K++Q++E    +   M +G +  GK+  I+ L +A T  G   +   +NPKA +  +++G  D  T DWTDGIFS L+R   +    +  +++ DG VD+ W+EN+NSVLDDNK LTLANGDRI +   C ++FEV ++ +ASPATVSR  +V++    L + P  + W+  R       +  LF    P     ++        T +  +V Q C +L+ L+  K+   S+++   ++ E LY      S+GA L    R K +  ++S + +  +D  K      +     T++D+   E  E WV W+S V EYI+  +   ++  IL P VD  RT +++  +   ++ VLL+GE GT+KT +I   L + + +  +  ++NFSS T     QR +E+ ++KR   TYGPP G+K+ VF DDINMP ++++G Q    ++R LL+  G Y+ ++   F  I D+ ++AAM   GGGRN++  R    F +FN   P+  S+  I++ I  GH    R F   ++++ Q +   T +L+      + PTP+KFHY F+ R+LSRI+ G+  T+ D      +  + +W++EC R   DR     D +     +K+ + E    D    S+    D       R A+E   +          +VYE I  +D  K   ++FE                  DA+ HL ++ RI+R+ RG+ALL+G  GS  Q LTKLA++ A  ++F+I L R YN  N   DLK LY   G + +   FLFTD  I +EGFLE +NN+L S +V  LFA DE + I +++     +E      + +++ +YFL ++  NLH+VLC S  G+  + R   FP L+S   +DW+  W   AL AVA   L +  I  A      +I  + +VH  + +       + +R  + T KS+L F++ Y ++ +EK +H     + ++  L +L EA+E            E  L +A++      K V  +K A                + +EEI++++ I+                                 +PP  +  + +C+L+        + G  E N     W  + K+MS   FL++L+    D+I+   +  I  +L+    +++  + +    +G+L +  + MS+++I KEV P KD + + +  + +S  +L   ++ L+  QKE   ++  Y++A  +K+  LD+A+   R++TAA +L+ GL  E+  WT    E K Q + L+GD L A AFLSY G FN +FR N++   W ++++ + IP S    I + LT+   +  W  +GLP DE SVQNGI+ TK SR+PL IDPQ Q   WIKN+E    L QV+SLN   F + LE S+  G P L++D+ E++DP + NVLE+N +       + +GDKEV+    F+L++ T L NP Y+P +F +  +I+++ T++GLEDQLL +     ++  + Q L L+E++  NK  +K L D+LL  L ++ G+++D+ +LI+ L+ TK  ++E  +KL +A    ++  + RE YRPVA RG++L+F + +M+LVN MYQ SL  +L LF+LS+  S   P  Q+R++NII  +TY V  Y    L+   K+ F++ M +K++   G +  +E    IK   S D   VQ KP  WI D  W ++ +L+ L   QFS++   + +N   W+ W+D  APE+   P  Y+ +L  F++LLL+RC   DR       Y+  ++G       I +   ++E S   +P+V ++S GSDPT  +   A+K   +   I++GQGQE    +L+   +  G W++LQNCHL + ++++L   + +    + +FR+W+TT     FPI  LQ S K   EPP+ IK  +K TY+  +Q  L       +  +VY +A+ H  VQER K+G  GW++P  +N +D +ASL+ +  +L     ++G S   W+++ Y++GE+ YGGR  D +D+R+L  +   +F D +F+P   F FF++    + IP   + + Y + I ++P   +PE+ GL S  +I Y ++  + +   +  +QP +   G G   +  +  +  D+  +LP  +    V E L     L P ++ L QE+ R  K++  ++ ++++L  A+ G + M+++  D   +  +  +P+           +L  W + L  R  Q+S W  + G P   W++G    + +L A+ Q   R  KGW LD      +VT++  ++      +  Y+ GL+LEGA WD  N  L  SK KVL   LP+  ++ I + K        L+N  + PVY    R +     L F A ++     T    HW L  V L
Sbjct: 1277 FGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERI-QKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEA-------VYHYVDWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQF-EGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLELSEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQT-LGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCIDVTLNSETIVPRT-DVNMVSQLCLMLDVLLESKN--SSAEVLECYFLEALYC-----SLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPEYIH--NPAMKFADIL-PTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH---TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETD----SEAVLADPILFGDYRAAREECEQ----------RVYEDIGDYDVSKAIFQLFE------------------DAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLIS-MVPTLFADDEKESIIKQINSEALQE--GAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHF--GAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKNEHVLQ-CKCLEGSLNRLREAREQ---------IDELNLKLADQ------KVVLAKKTAT-------------CTAFLEEIDKNQTIS-------------------------------FAKPPKQVQVVCECILV--------LRGKKELN-----WLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIK-NLSGDGTKVQ-KPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGNCVHPPLI-NFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCH-EQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQP-ETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGT--DLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRK-KGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPI--LKVIPVQKNSL----RLRNTLRTPVYTTSLRRNASGAGLVFEADLF----TTMHTSHWVLSGVCL 4171          
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1565.44 bits (4052), Expect = 0.000e+0
Identity = 1057/3130 (33.77%), Postives = 1664/3130 (53.16%), Query Frame = 2
Query:  476 PFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPV---KAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPE-LEAAINRQIDEALIISH--PPWVL--KLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGE-PHREMR------MNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLK-----RNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLI--PRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIR---SNNNIKLDLPK-IEK-----DSEDTMFDYM--VSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMI-NKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVF----------ETDA---WFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLK-FLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIM---KKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXX---XXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIK-PADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPK--PSWGESMKLMSNNQFLNNLINFPKDTINEETVELI-SPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKV-------QAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVS--QKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECR--AISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEEL--MDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQ--------WRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDM-------FNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLG-KLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXX-XXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRT--------DLTFIASVYLRCPPTKQADHWTLRAVALLCDI 9577
            PF+ +++    +L +  E I++W+ +Q  W+YLE +F   DI +Q+P+E + F  +D++W +IM    +++ VLQ       L +L        +I  K L  YLEKKRL FP                                                  YS EGE +EL + +   +A   VE WL+ L +    S+  +I  +  +   T  N  +++  +P QV L   Q+ WT +  +AL   K  +++  Q NE   L+   L         K  RT    L+TI VH +D+   L+ +KV   +DF+WL Q R+Y++ D  R  V I + D  Y  E+LG + RLVITPLTDRCY TL  A  +++GGAP GPAGTGKTET KD+ + L    VVFNCSD +D+  +G+ FKGL+ SG+W CFDEFNRI+L VLSV AQQ+  +      + + F F +G ++ +NP   + +TMNPGYAGR ELP+NLK+ FR VAMMVP+  +I  + L S GF++   L+ K    Y+LC EQL+ Q HYD+G+R + +VL   G  K   P + E   ++R ++D+N  K +  D PLF  + +DLFPG+ L    Y   LEAA     +E   I +  P  V   KLIQ +E   VRH M+ +G S AGKT  +HVL   L+   E  H E        +NPK+IT  Q+FG+ D+ +++WTDG+ +  +R     +  +  W+V DGP+D +WIE++N+VLDDNK L L +G+ I MS    +IFE +++  ASPATVSR GM+YM  S L W PL+  W+       ++ + R ++L+LF    P   +   ++    + T  +  V   C L + ++  P K   D   I R      +  S++WS+G   + + R K   +IR   S  N +  +P+ IE+     + +  ++DY     E G W+HWN  +E  I   +   +   I+VP +D VR  +LM+   SQ   +L +G  GT K+V + +K L++ + + ++   +NFS+ T     Q  I S +DKR    +GPP G++  +F+DD+NMP   ++G Q   E++RQ L+  G Y+L+     + +VD+QF+AAM  PGGGRN +  R  R   I +    S+ ++  IFS I      K+  F+ E   +   ++     ++      +LPTPAK HY FNLRD SR+ QG +  +   +   +TL+ L+ HE  RV  DR V  ED +W  + +   + +  +   V   QVF          E D     F D+M    E  G+E         ++Y  + S +   + +K     YN+ +    M++V F   + HL +ISR+++ P GNALLVGVGGSG+Q++T+LA+ +A   +FQ  ++++Y ++   +DLK  L R AG +G+   FL TD +IKDE FLE +++VL++G V NLFA DE  EI + + PI    KK     P T   L  +F++R K+NLHVV+ FSPIG+ FR R  +FP LI+ CT+DWFQ WP++AL  VA  +L S E+  +   ++E+I      H   A    D+     R  ++TP SYL  +  ++ +  +K +   N  QR  +GL +L  A+  VA++K+    L  K ++  I N +  EV++  +++  A + V   V V ++ A     E +  K   E+ L  A PAL  A  AL+T+K P+DI+ V+ +  PP  +  +M  V +    + D +  DP     K    WG S KL+ +  FL +L  + KD I    ++ I + ++   D+             GL  W  AM  + ++ K V P K  L + Q       E L A ++VLD+K+ EL +V       Q  ++E   +K  L    E+C RK+  A +LI GL+GEK+ W+  + + +   D L GDVL +   ++Y GPF   FR      W    +++ IP S   ++   L +P  +  W++ GLPND  S+ NG+IV + SR PL+IDPQGQ   W+KN E    L V  L    + + LE+ +  G PLL+E++GEELDP+L+ +L K   KQG    +K+G++ ++    F  Y+TT+L NP Y PE+  + S+++F +T +GLEDQLLG+V+  E  ELE +R  L+     NK+++KE+ED++L  L S+KG++++DE  I++L + K+ S E++  Q++ IA  TE+KI  +RE YR VA   SIL+F I +++ ++ MYQ SL  F+ L+  S+ +  KS V ++R++ + +  TY ++    R L+E DK+ F+ L+   +  R  +I+  +    + GG  L   V  P P +W+ D +W  +   S L  F   L+   +N + ++  +D   P    +P  +   L   +++++ RC  PD  +    K++  +LG+KF +    D  K F +S    P+V +LS G+DP   ++  + K     R  +IS+GQGQ   + +++   +  G WV LQNCHL++ +M  L  + +       H DFRLW+T+   PKFP+  LQ  +K TNE P G++  + ++Y +   D +   N           W  +++ + + H  VQER+KFGPLGWNIPY +N +DL+ S++ +Q  +++ D    + ++ I Y+ GE  YGGRVTDD+D+RLL T    ++ +D+        +P  ++F     P  S   +YI  I  LP    PE+FGLH N DI+   +  + + D +L  Q   A  G     ++ +Y + +++L  +LP  +    V+ +  ++   + MN  L QE++R   + + +  +L +L  A+ G ++M+ +L     ++   ++P             LG + T+ + R      W   G+P  FW++GFF  Q FLT + Q   R ++   +   +L  D      D+   PP +GVYV GL+L+GA WD+    L E   ++LF+ +P+I ++     K+  I  D   ++Y CP+YK   R            F+ ++ L     K+  HW  R VA+L  +
Sbjct:  694 PFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKI-MKGLNAYLEKKRLFFP-------------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRSR-AYEKTARN--QWVKEWPGQVVLCTSQIFWTLEVHKALGLKKYYQQLQNQLNEIVELVRGELP--------KQTRTTLGALVTIDVHARDVVKDLI-EKVSDETDFEWLAQLRYYWMNDNVR--VHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDF-EGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPNENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAA-----EECCKIHNVQPTKVFTDKLIQTYEMMIVRHFML-VGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESI-RTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWNDTIEN-INLGEINTKGQEIIVPTIDTVRYTYLMDLCISQ-GPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLD-HGHYDLKDTSKIS-LVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSI-VAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFN---VPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLE--GDE---------RLYTEVPSIETFAEVVKSCLEEYNQ-MHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLT---LFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEM--SENERQEVITICKTFHTS-ANQLSDFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRV---VHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIP-DPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQ-------ESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIV-RNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQGVE-SIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAKEP-ELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSI-QDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARK-EIEHSDLMFLLTGGIGLQNTVANPDP-SWLQDKSWDEICRASELPGFQG-LEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLT---DPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYD---KVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFA----PPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVL-YEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQ---IPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKEGV-LTEQHPRILFDSMPIIWVKP---EKKNMIQTD---SLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLST--KKRPQHWIKRGVAMLLQL 3680          

HSP 2 Score: 60.8474 bits (146), Expect = 3.637e-8
Identity = 30/98 (30.61%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  147 IDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESD-GFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRG 437
            I  F   +P++ ++ NP ++ RHW++MS +    FD+  + G +LR +L+  L  F EE E I ++A KE  +E  ++ +   W     H    K+ G
Sbjct:  567 IQKFKDYIPVVSILCNPGLRGRHWEKMSQIAG--FDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTG 662          
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 6092.3 bits (15804), Expect = 0.000e+0
Identity = 3040/3051 (99.64%), Postives = 3046/3051 (99.84%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  ++++  S+ YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK
Sbjct: 1624 DSLMILSSLLSNRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4674          

HSP 2 Score: 324.709 bits (831), Expect = 3.768e-88
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH
Sbjct: 1462 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 1614          
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000049144.1 (SMESG000049144.1)

HSP 1 Score: 6027.2 bits (15635), Expect = 0.000e+0
Identity = 3014/3040 (99.14%), Postives = 3021/3040 (99.38%), Query Frame = 2
Query:  461 HEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            + YNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRF   EDISWF K L R ++EDL E  V   Q    + +F+DF+RDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK
Sbjct: 1635 NRYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTNEQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFTAHEDISWFNKVLLRIVNEDLGEVHVGSLQ---DERYFVDFLRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 4671          

HSP 2 Score: 324.709 bits (831), Expect = 3.705e-88
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH
Sbjct: 1462 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 1614          
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000039073.1 (SMESG000039073.1)

HSP 1 Score: 4259.52 bits (11046), Expect = 0.000e+0
Identity = 2095/3053 (68.62%), Postives = 2529/3053 (82.84%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNE--RPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S   + A  S+ YN PFK  IQ+ V KL+ ++EIIE W+ VQNLW+YLEAVFVGGDIAKQLP+EAKRF NIDKSW KIM RAHE  NV+QCC+GD+TLSQLLPHLLEQLE+CQKSLTGYLEKKRL+FPRFFFVSDPALLEILGQASD HTIQ+HLLSVFDN KTV F EK Y+ ILA  S E EA++L++P+ A+ NVEIWL  LL M+++SLH VIR+A+ +IND++F + EF   +P+QVGLLGIQ++WTRDS EAL  +K+D+KIMQ TN++FL +LN LI  TT +L K+ERTKFETLITIHVHQ+DIFD LV  K+ +P DF+WLKQ+RFYF ED D+CIVSITDVDFIYQNEFLGCT+RLVITPLTDRCYITL+QALGMS+GGAPAGPAGTGKTET KDMGRCLGK+VVVFNCSDQMD+RGLGRI+KGL+QSGSWGCFDEFNRI+LPVLSVAAQQI+VVL+CKKERK QF+FTDGD+VDM+PEFGIFLTMNPGYAGRQELPENLKINFR VAMMVPDR IIIRVKLASCGF+ N VL++KFYTLYKLCEEQL+KQVHYDFGLRNILSVLRTLG  KR NP D+E   VMRVLRDMNLSKLVD+DE LF+SLI DLFP +++    YP++ AAI++QI++A +I+H PW LKLIQLFETQRVRHGMMTLGPSGAGKT CI+VLM+A+TDCGEPH+EMRMNPKAITAPQMFGRLDV+TNDWTDGIFSTLWRRT K KKGEHIWL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM+P+ KIIFEVHNIDNASPATVSRNGMVYMSSS LDW P+L+ WLL   + +     +L  F   F + YRY  Q L  KM TLE   +RQA DLL GL+   D K   +I   H E+L +FS+MWS+GALLE+EDR KL+ +I     + + + K     +DT+F+Y+V++ GEW HW ++V EY+YP D  PEY SILVPNVDN RTDFL+NT++ Q KAVLLIGEQGTAKTV++  Y    NPE  +FKSLNFSSAT P MFQRT+ES+VDKRMG+T+GPP GRKMT+FIDDINMPVINEWGDQI NEIVRQ++E+ G Y+LEKPGDFT IVD+Q +AAMIHPGGGRNDIPQRLKRQF IFNCTLPSN+SIDKIF I+G G++C ERGF  +V+  V NL+  TR+LW  TK KMLPTPAKFHYVFNLRDLSRIWQGM+    DVI +   L+ LWKHEC RVI+DRF +  D  WF KTLK    E+   ++V+  Q   T+ +F+DF++DA EATGEE ++T+ + PK+YEPI S++QL DRL  +   YNE++RG  +D+VFF DAMTHL+KISR+IRT +G+ALLVGVGGSGKQ+LT+LAS+I+GY+ FQITLTRSYN+SNL+EDLK LYRT+GQ GKGITFLFTD EIKDE FLE++NN+LSSG ++NLFARDEMDEI QEL+ +MKKEYPRRPP+N+NLQEY++SR  + LHVVLCFSP+GEKFRNR+L+FPGLISGCT+DWFQRWPKDALIAV+ ++LS+FEIV  P VKK ++ +MG+  D VAENC++YFQRFRR THVTPKSYLSF++GYK +Y +K +    LA RM++GL+KL+EA ESV EL + LA KEKEL +A ++A EVL  V V+ +AA +VK +VQVVKD+A+++V  I RDK IAE KLEAA+PAL+EAE+AL TIKP  IATV+KLGRPPHLIMRIMDCVLI F++RLD++  DPER  PKP+W E++KLMS + FL +L+NFPKDTIN+E V+L+ PY  MED+ +  A+ V G+VAGL SWT+AM SFF INKEVLPLK NL  QQ + E +M++LN AQ +LD KQKEL  VQA Y++A+ +KQ L DDAE CRRKMT A  LI GLAGE+ RWT  S  F  QI +LVGDVL  TAFLSYCGPFNQ+FRNIL  SW+ EL T  IPF+  +  I MLTD   + EW++QGLPNDELSVQNG+IVT+A RYPLLIDPQGQGK WI+N+E   ELQVT+LNHKYFR HLED+LSLGRPLLIED+GEE+DPALDNVLEKNFIK GSTFKVKVGDKEVDVMKGF+LY+TTKLPNPSYTPE+FA+TSIIDFTVT+KGLEDQLLG+VI TEKQELEA+R +LME+V  NK+K KELEDNLL+RLTST+GSLV+DE LI+VL+ TK T+ +V QKLII  DTEIKINSAREEYRPVATRGSILYFLIVEMS+VN MYQTSL+QFLGLFD SM+ SQKSP+T KRI NIIE +TYEV++Y  RG YESDK TFT+L+ +K+ M++G+IK EEF  FIKGGA+LD+N V+PKPK WI D+TWLNLVELS L  F  + +QV++N+K W+ WFD +APEE  IPDGY+ NL+TF++LLL+R WCPDRT+  AKKYI++++G +FAEG I + +++ EE    TPM+  LSMGSDPT  IE LAKK  ++C +ISMGQGQE+H+R+L++  +  G W+LLQNCHL L++M+E ++ +  TE IH+ FR WVTTE HPKFPI+ LQ+ IKFT +PP GI+AG++RTY    QD LDI+N  QW+PM++ VA+LHT VQERRKFGP+GWNIPYE+N +D  +++QFVQNHLDDMD+K+G+SWKT+CYM+GE+QYGGRVTDDYDKRLLNT+ + WF+ +MFNPKF F+K + IP+   L+EY   I++LP  DSPE FGLH+NADI Y++  A  +L  I+NIQPKD+  G GETRESVVYR+ DDML +LP DY  FEV E+LQ MG L+P+NIFL+QEVDRMQKVI+ VR+TL+DLKLAIDGTIIM+E+L+DALD+++DARIPS W K+SWES+TLGFWFT+L++RN QF +WL++GRP CFWMTGFFN QGFLTAMRQE+TR HKGWALD VVL NDVTK M++++N  PSEGVYV+GLYL+GAGW+ R++KL E   KVL+ PLPV+ + A+ ++          +  Y+CPVYKKPRRTDL +I  + L+    +  DHW LR VALLCDIK
Sbjct: 1575 DSLMALGALLSNRYNAPFKPKIQEWVQKLTGTTEIIENWLLVQNLWIYLEAVFVGGDIAKQLPQEAKRFVNIDKSWQKIMQRAHEIPNVVQCCMGDDTLSQLLPHLLEQLELCQKSLTGYLEKKRLIFPRFFFVSDPALLEILGQASDSHTIQAHLLSVFDNTKTVTFDEKVYDKILAINSQENEAVQLDEPINAQGNVEIWLGDLLKMSRKSLHSVIRSASITINDSQFKLFEFETSFPSQVGLLGIQMIWTRDSEEALTQSKTDKKIMQATNQRFLDILNELIAVTTQNLTKIERTKFETLITIHVHQRDIFDDLVVLKINTPKDFEWLKQSRFYFKEDTDQCIVSITDVDFIYQNEFLGCTDRLVITPLTDRCYITLSQALGMSLGGAPAGPAGTGKTETTKDMGRCLGKFVVVFNCSDQMDYRGLGRIYKGLAQSGSWGCFDEFNRIELPVLSVAAQQISVVLTCKKERKNQFIFTDGDVVDMDPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRAIIIRVKLASCGFLQNTVLSKKFYTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAFKRENPDDSEPFIVMRVLRDMNLSKLVDEDEALFLSLIEDLFPEMKVSTKTYPDIGAAIDKQIEQAKLINHDPWRLKLIQLFETQRVRHGMMTLGPSGAGKTKCINVLMRAMTDCGEPHKEMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRRTHKVKKGEHIWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNTKIIFEVHNIDNASPATVSRNGMVYMSSSILDWQPILRSWLLILETTDAVSNTILNTFKLIFSEAYRYVTQTLSPKMVTLECNYIRQAIDLLAGLVHGMDIK---EIKTSHLEKLIVFSMMWSLGALLELEDRLKLQEFITHKKALPVPICK----DDDTIFEYVVNDKGEWEHWTARVPEYLYPNDHIPEYISILVPNVDNTRTDFLINTISKQNKAVLLIGEQGTAKTVIVKGYCGKYNPEQQIFKSLNFSSATTPNMFQRTLESYVDKRMGTTFGPPGGRKMTIFIDDINMPVINEWGDQITNEIVRQMMEMTGVYSLEKPGDFTTIVDIQIIAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFRILGCGYFCTERGFKPDVQHTVNNLVTATRKLWQKTKIKMLPTPAKFHYVFNLRDLSRIWQGMLIVNSDVINSGSKLMSLWKHECMRVITDRFTEQADKDWFEKTLKVTGEEECGSEVVAGLQ---TEPYFVDFLQDAPEATGEENEETELEAPKIYEPIESYEQLSDRLIQYMTQYNETVRGGKLDLVFFKDAMTHLVKISRVIRTTKGHALLVGVGGSGKQSLTRLASFISGYETFQITLTRSYNVSNLMEDLKLLYRTSGQLGKGITFLFTDNEIKDESFLEFLNNMLSSGEIANLFARDEMDEILQELVSVMKKEYPRRPPSNENLQEYYMSRVLKYLHVVLCFSPVGEKFRNRSLRFPGLISGCTIDWFQRWPKDALIAVSNYFLSTFEIVSTPEVKKAVVNTMGIFQDLVAENCINYFQRFRRLTHVTPKSYLSFISGYKEVYIKKREEIGTLATRMNTGLKKLVEATESVNELSKELAVKEKELEVARKKAGEVLAQVEVKASAAQKVKEQVQVVKDRAEALVNNISRDKAIAEEKLEAAKPALQEAEEALETIKPQHIATVKKLGRPPHLIMRIMDCVLILFKKRLDSVTADPERPCPKPTWDEAVKLMSGSNFLTSLLNFPKDTINDEVVDLMEPYFNMEDFNLASAKNVSGDVAGLCSWTKAMASFFSINKEVLPLKANLAVQQSKLEFAMKELNNAQEILDAKQKELDIVQAEYNKAMDEKQALEDDAEACRRKMTNAKALIGGLAGERERWTEASKTFDKQIKQLVGDVLIVTAFLSYCGPFNQDFRNILQRSWKHELVTNGIPFTDDMTAISMLTDNATISEWNIQGLPNDELSVQNGLIVTRAPRYPLLIDPQGQGKSWIRNKEKNHELQVTALNHKYFRNHLEDALSLGRPLLIEDVGEEIDPALDNVLEKNFIKSGSTFKVKVGDKEVDVMKGFQLYVTTKLPNPSYTPEVFAKTSIIDFTVTIKGLEDQLLGVVILTEKQELEAERTKLMEEVAENKRKTKELEDNLLYRLTSTEGSLVEDESLIEVLRVTKETAEDVQQKLIIGRDTEIKINSAREEYRPVATRGSILYFLIVEMSMVNEMYQTSLKQFLGLFDKSMALSQKSPITSKRINNIIEYLTYEVFRYTARGFYESDKFTFTILLTMKIAMKSGQIKHEEFQIFIKGGAALDLNAVEPKPKKWIQDLTWLNLVELSKLPYFQQITEQVAKNDKGWKTWFDSDAPEEAHIPDGYD-NLETFKKLLLIRSWCPDRTVPMAKKYIEETMGIRFAEGVITNLEEMQEEGDENTPMICFLSMGSDPTDNIERLAKKKNLKCGSISMGQGQEVHARKLLSVSMQEGRWMLLQNCHLGLNFMDEFLEIITTTENIHESFRCWVTTEGHPKFPINILQLGIKFTYDPPLGIRAGLRRTYALLTQDQLDITNAFQWKPMLFCVAFLHTTVQERRKFGPIGWNIPYEFNQSDFTSTVQFVQNHLDDMDLKRGVSWKTVCYMIGEVQYGGRVTDDYDKRLLNTYAKNWFSPEMFNPKFSFYKGYPIPSGKSLDEYRAFIDKLPLIDSPECFGLHANADIIYETSNANQMLTTIVNIQPKDSGGGAGETRESVVYRLADDMLQRLPEDYNPFEVKEKLQKMGSLKPLNIFLKQEVDRMQKVISIVRSTLVDLKLAIDGTIIMSENLKDALDNIFDARIPSFWMKLSWESATLGFWFTDLLDRNEQFHSWLYEGRPVCFWMTGFFNPQGFLTAMRQEITRNHKGWALDAVVLSNDVTKFMKEDVNNSPSEGVYVHGLYLDGAGWEARSAKLREPLPKVLYTPLPVVHVYAVSVNNPVADKAKANERFYECPVYKKPRRTDLNYIFPLNLKT--NEAPDHWILRGVALLCDIK 4614          

HSP 2 Score: 204.142 bits (518), Expect = 1.279e-51
Identity = 97/152 (63.82%), Postives = 122/152 (80.26%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGD 458
            +VN YYDI W +++I+ I+ +L +FQN+CRKLPK LK+W A++DLRKTIDDFN   PLLE M++ AM PRHW+R+  +T H F+V+SD F LRN++EAPLL  KEEIEDICISAVKEKDIEAKLK V  +WSA    F +FK+RGELLL+GD
Sbjct: 1413 TVNSYYDIAWSEINIDTINQQLLDFQNKCRKLPKALKEWQAYDDLRKTIDDFNETCPLLEQMSHNAMMPRHWERIETVTGHKFEVDSDNFLLRNLMEAPLLANKEEIEDICISAVKEKDIEAKLKTVTNDWSAQSFSFSSFKSRGELLLKGD 1564          
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4046.12 bits (10492), Expect = 0.000e+0
Identity = 2022/3056 (66.16%), Postives = 2438/3056 (79.78%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+++  S+ YN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQ +E+KGFY+LE+PG+FTNIVD+QF++AMIHPGGGRNDIP+RLKR F IFNCTLPSN+SIDK                      LV  +  I  R  +  K  +     KFHYVFNLRDLSRIWQG+INT  DVI N + LL LWKHEC RVISDRFV ++D  WF+K ++R +SE++S D+   ++  E  ++F+DF+RDA E TGEEP+D DF  PK+YEPI+  D LK RL MF   YNESIRGAGMD+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LA++IAGY         SYN+SNLLEDLK LYR+AGQ+GKG TF+FTD +IKDEGFLEYMNN+LSSGVVS LF +DE+DE+   L+P+MKKE+P+RPPTN+NL EYF SR ++NLHVVLCFSP+G+KFR RAL FPGLISGC  DWFQ+WPKDAL+AVA HYL +FE+VC    K  +I S+  +HD VA  C +YF ++RR THVTPKSYLSFL  Y+ +Y EK D    LA+RMDSGLQKLIEAQ+S+AEL   LAEKEKEL +AN+EAE+VL+TVT Q  AA  VK+KVQ VKD+   IV  I  DK IAE+KLEAA+PAL EAE+ALNTIKPADI+TVRKL +PPHLIMRIMDCVL+ FQR +D +  DPER   KPSWGES+KLM+N+ FLNNL+NF +D+INEE V+L++PYL MEDY ++ A++VCGNVAGLL WTRAM  F+ +N+EVLPLKDNL KQ+++   +  DL  A+++L EK++ L  V+A Y+ A+++KQ L DDAE CRR+M  A +LI+GL+GEK+RWT QS  FK Q  +L                   +FR  L T+W  E+  + IP +  L++I +LTD   + EW+LQGLPNDELS+QNGIIVT A+RYPLLIDPQGQGKIWIKNREA KELQ+TSLNHKYFRQHLED+LSLGRP+LIEDI EELDPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LYITTKLPNP YTPEI+A+TS+IDFTVT+KGLEDQLLG VI+TEK+ELE  R++L+E++  NK++M+ELED+LL RL +T+GSLVDD+DL+ VL  TKVTS EVS +L  A++TE +IN+AREEYRPVATRGS+LYFL  EMS VN MYQ  L+QFL LFD SM +S KSP+T +RI  IIE MT+++WK+AVRG+Y+ D++T TL++ALK+D+++  I+ EEF   IKGG+ LD+  V PKP  WITD+TWLNL  LS L+QFSA+++QV + EK W+QW+DKE PE E IP GY +NLDTFRRLL+VR WCPDRTL QAKKYI  SLGE FAE  +L+ +K+  +S  R+ ++ LLSMGSD TP IE LAKK  + C+A+SMGQGQEIHSR+L++ F+  GGWVLLQNCHL LDY+EEL  Q+IE E +H+ +RLW+TTE H KF I+ LQ+SIKFTNEPP+GIKA + RTYT   QDFLD      W+ M++ +A+LH  VQERRKFGPLGWNIPYEYN +D NAS+QF+QNHLD ++ KK     G+ WK + YM+ EIQYGGRVTDDYDK+                               K      I   LP  D+PE FGLH NADITY +KT + ILD IL+IQPKDA++GGGETRESVV R C DML KLPS+Y+ ++V E+LQ MG L PMNIFLRQEVDRM KVI  VR TL DL+LAI GTIIMNE+LRDALD++YDA+IP  W K+SW+S+TLGFWF+ELI+RN+QFS+WL  GRP  FWMTGFFN QGFLTAMRQEVTR+H GWALD+VVL + VTKH+ DE+ +PP EGVYVYGL++EGA WD+RNS+L E K K L++ LPVI I AI  + + +I       +Y  P+YKKPRRTDLT++ASV L C  +K  DHW +R VALLCDIK
Sbjct: 1597 DSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK---------------------SLVLLVWDIIVRKEVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDL---AESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYS--------SYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK-------------------------------KCLHRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDTS---KLYTTPIYKKPRRTDLTYVASVELVC--SKTPDHWVMRGVALLCDIK 4557          

HSP 2 Score: 152.525 bits (384), Expect = 4.279e-36
Identity = 71/153 (46.41%), Postives = 98/153 (64.05%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD+    FA ++                                   +W+  +L   +FKNRGELLL+GD 
Sbjct: 1470 TVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDMMLKTFACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDR 1587          
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Match: SMESG000056575.1 (SMESG000056575.1)

HSP 1 Score: 4044.97 bits (10489), Expect = 0.000e+0
Identity = 2022/3056 (66.16%), Postives = 2438/3056 (79.78%), Query Frame = 2
Query:  428 ESWGVVAAWRSHEYNVPFKKDIQDMVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWIKIMSRAHENTNVLQCCVGDETXXXXXXXXXXXXXICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYETILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNSINDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMXXXXXXXXXXXXXXXXXXXXXXGKVERTKFETLITIHVHQKDIFDQLVKDKVKSPSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTDRCYITLAQXXXXXXXXXXXXXXXXXKTETVKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERKKQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPDRQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILSVLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFPGIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMTLGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTNDWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLKGWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACDLLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYIRSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTPEYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSKNPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFIDDINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMIHPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFNDEVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINTQGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSEDIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQLKDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVGVGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQGKGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIMKKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLISGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGVAENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSGLQKLIEAQESXXXXXXXXXXXXXXXXIANREAEEVLKTVTVQKNAANEVKNKVQVVKDKAQSIVEEIERDKKIAESKXXXXXXXXXXXXXXXNTIKPADIATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKLMSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGLLSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQKELGKVQAIYDEALRKKQTLLDDAETCRRKMTXXXXXXXXXXXXKLRWTNQSSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIPFSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDPQGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEELDPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPEIFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKKMKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTEIKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMSRSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMRAGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFSAVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPDRTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPTPTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSLDYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQGIKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGWNIPYEYNTADLNASLQFVQNHLDDMDIKK-----GMSWKTICYMLGEIQYGGRVTDDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELPNYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVVYRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAKVRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPXXXXXXXXXXXTLGFWFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGWALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESKSKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIASVYLRCPPTKQADHWTLRAVALLCDIK 9580
            +S  V+++  S+ YN PFKK I + V KL+ SSE++E WM VQNLWVYLEAVFVGGDIAKQLP+EAKRF  IDKS++K+M RA + TNV+QCC  D +L +LLP L EQLEICQKSLTGYLEKKRL+FPRFFFVSDP LLEILGQASDPH+IQ+HLLS+FDN K VKF ++QY+ I++ +S E E L++ +PVK E +VE WL  LL +AQ SLH VI+ A   I D + +++EFL+  P+QVGLLGIQ+LWTR++T+AL  A++D KIMQ+TN+ FLLLLNLLI +TT DL K  RTK+ETLITIHVHQ+DIFD L K  VKS +DF+W KQTRFYF+EDVD+C++SITDVDF YQNEFLGCTERLVITPLTDRCYIT+AQAL MS+G APAGPAGTGKTET KDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGL+QSGSWGCFDEFNRI+LPVLSVAAQQIA++L CKKE K QF+F+DGD V+MNPEFG+FLTMNPGYAGRQELPENLKINFR+VAMMVPDRQIIIRVKLA+CGFI+NI+LARKF+ LYKLCEEQLTKQVHYDFGLRNILSVLR+LG  +R  P D+E  TVMRVLRDMNLSKLVDQDEPLF+SLINDLFPGI LDK GYPELE+++ +Q+D   +I+H PWVLK+IQL+ETQ VRHGMMTLGPSGAGK+ CI VLMKALTDCG+PHREMRMNPKAI A +MFG+LDV+TNDWTDGIFSTLWRRTLK KKGEH WL+LDGPVDAIWIENLNSVLDDNKTLTLANGDRIPM P+CKIIFEVHNIDNASPATVSRNGMV+MSSSAL+W P+LKGWLL R  +ER  +  LF  SFP   ++ +  L  KM  LEAF++RQACD+L+G+I ++   D       H ERLY F++MWS+GA LE+ +R K+E +IR++N+I LDLP++E DS  TMF+Y V+  G+W HWN+ ++EYIYP D TPEY  ILVPNVDNVRT+FLM+ +A QEK+VLLIGE GTAKTVMI KY+   N E  + KS NFSSAT P +FQRTIESFV+KR+G+T+GPPAG+KM+VFIDDINMP+INEWGDQIANEIVRQ +E+KGFY+LE+PG+FTNIVD+QF++AMIHPGGGRNDIP+RLKR F IFNCTLPSN+SIDK                      LV  +  I  R  +  K  +     KFHYVFNLRDLSRIWQG+INT  DVI N + LL LWKHEC RVISDRFV ++D  WF+K ++R +SE++S D+   ++  E  ++F+DF+RDA E TGEEP+D DF  PK+YEPI+  D LK RL MF   YNESIRGAGMD+VFF DAM HL+K+SRIIRTP GNALLVGVGGSGKQ+LT+LA++IAGY         SYN+SNLLEDLK LYR+AGQ+GKG TF+FTD +IKDEGFLEYMNN+LSSGVVS LF +DE+DE+   L+P+MKKE+P+RPPTN+NL EYF SR ++NLHVVLCFSP+G+KFR RAL FPGLISGC  DWFQ+WPKDAL+AVA HYL +FE+VC    K  +I S+  +HD VA  C +YF ++RR THVTPKSYLSFL  Y+ +Y EK D    LA+RMDSGLQKLIEAQ+S+AEL   LAEKEKEL +AN+EAE+VL+TVT Q  AA  VK+KVQ VKD+   IV  I  DK IAE+KLEAA+PAL EAE+ALNTIKPADI+TVRKL +PPHLIMRIMDCVL+ FQR +D +  DPER   KPSWGES+KLM+N+ FLNNL+NF +D+INEE V+L++PYL MEDY ++ A++VCGNVAGLL WTRAM  F+ +N+EVLPLKDNL KQ+++   +  DL  A+++L EK++ L  V+A Y+ A+++KQ L DDAE CRR+M  A +LI+GL+GEK+RWT QS  FK Q  +L                   +FR  L T+W  E+  + IP +  L++I +LTD   + EW+LQGLPNDELS+QNGIIVT A+RYPLLIDPQGQGKIWIKNREA KELQ+TSLNHKYFRQHLED+LSLGRP+LIEDI EELDPALD VLEKNFIK G+  KVKVGDKEVDVMKGF LYITTKLPNP YTPEI+A+TS+IDFTVT+KGLEDQLLG VI+TEK+ELE  R++L+E++  NK++M+ELED+LL RL +T+GSLVDD+DL+ VL  TKVTS EVS +L  A++TE +IN+AREEYRPVATRGS+LYFL  EMS VN MYQ  L+QFL LFD SM +S KSP+T +RI  IIE MT+++WK+AVRG+Y+ D++T TL++ALK+D+++  I+ EEF   IKGG+ LD+  V PKP  WITD+TWLNL  LS L+QFSA+++QV + EK W+QW+DKE PE E IP GY +NLDTFRRLL+VR WCPDRTL QAKKYI  SLGE FAE  +L+ +K+  +S  R+ ++ LLSMGSD TP IE LAKK  + C+A+SMGQGQEIHSR+L++ F+  GGWVLLQNCHL LDY+EEL  Q+IE E +H+ +RLW+TTE H KF I+ LQ+SIKFTNEPP+GIKA + RTYT   QDFLD      W+ M++ +A+LH  VQERRKFGPLGWNIPYEYN +D NAS+QF+QNHLD ++ KK     G+ WK + YM+ EIQYGGRVTDDYDK+                               K      I   LP  D+PE FGLH NADITY +KT + ILD IL+IQPKDA++GGGETRESVV R C DML KLPS+Y+ ++V E+LQ MG L PMNIFLRQEVDRM KVI  VR TL DL+LAI GTIIMNE+LRDALD++YDA+IP  W K+SW+S+TLGFWF+ELI+RN+QFS+WL  GRP  FWMTGFFN QGFLTAMRQEVTR+H GWALD+VVL + VTKH+ DE+ +PP EGVYVYGL++EGA WD+RNS+L E K K L++ LPVI I AI  + + +I       +Y  P+YKKPRRTDLT++ASV L C  +K  DHW +R VALLCDIK
Sbjct: 1593 DSLMVLSSLMSNRYNAPFKKPITEWVQKLTTSSEVLENWMKVQNLWVYLEAVFVGGDIAKQLPQEAKRFQGIDKSYVKVMERARDTTNVVQCCSSDHSLVELLPRLFEQLEICQKSLTGYLEKKRLVFPRFFFVSDPVLLEILGQASDPHSIQAHLLSIFDNTKRVKFDDRQYDLIVSAFSSENEELKMIRPVKCEGHVESWLGRLLKVAQYSLHTVIQNAAFQIQDEDLDLVEFLDAQPSQVGLLGIQILWTRNATDALREARNDPKIMQKTNKTFLLLLNLLIGETTRDLTKYARTKYETLITIHVHQRDIFDDLCKLNVKSQNDFEWTKQTRFYFMEDVDKCVISITDVDFEYQNEFLGCTERLVITPLTDRCYITIAQALSMSLGAAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIILQCKKEGKTQFIFSDGDTVEMNPEFGLFLTMNPGYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLAACGFIENIILARKFFVLYKLCEEQLTKQVHYDFGLRNILSVLRSLGSARRVAPNDSEDRTVMRVLRDMNLSKLVDQDEPLFLSLINDLFPGIVLDKAGYPELESSVRKQVDSLKMINHSPWVLKVIQLYETQCVRHGMMTLGPSGAGKSVCITVLMKALTDCGDPHREMRMNPKAILASEMFGKLDVATNDWTDGIFSTLWRRTLKLKKGEHCWLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMGPNCKIIFEVHNIDNASPATVSRNGMVFMSSSALNWSPILKGWLLTRPMSEREKLYALFEKSFPQTLKFIVNNLTMKMVILEAFIIRQACDILQGIIFQESLPDK------HLERLYAFALMWSLGAFLELNERAKMEEFIRNDNSINLDLPEVESDS--TMFEYKVNAEGKWDHWNNYMDEYIYPHDFTPEYSKILVPNVDNVRTEFLMDNIAKQEKSVLLIGEPGTAKTVMITKYMGKSNIETRVSKSFNFSSATTPALFQRTIESFVEKRVGTTFGPPAGKKMSVFIDDINMPLINEWGDQIANEIVRQTMEMKGFYSLERPGEFTNIVDVQFLSAMIHPGGGRNDIPERLKRHFNIFNCTLPSNNSIDK---------------------SLVLLVWDIIVRKEVSVKKSLNTLRTKFHYVFNLRDLSRIWQGIINTNSDVIANKEVLLALWKHECMRVISDRFVSLDDEQWFIKIIQRMVSEEISTDL---AESIEDSSYFVDFLRDAPEPTGEEPEDFDFSPPKIYEPISGLDSLKSRLFMFMNHYNESIRGAGMDLVFFNDAMGHLVKVSRIIRTPLGNALLVGVGGSGKQSLTRLAAHIAGYS--------SYNVSNLLEDLKTLYRSAGQEGKGTTFIFTDNDIKDEGFLEYMNNILSSGVVSGLFQKDEIDEMTAMLVPVMKKEFPKRPPTNENLLEYFFSRVRKNLHVVLCFSPVGQKFRTRALYFPGLISGCITDWFQKWPKDALLAVAEHYLGNFEMVCDATTKTGIISSVSFIHDDVANKCSEYFDKYRRITHVTPKSYLSFLQSYQKVYVEKKDFILELARRMDSGLQKLIEAQQSIAELSIELAEKEKELEVANKEAEKVLETVTQQTAAAQGVKDKVQKVKDRCLKIVMSINEDKAIAEAKLEAAKPALLEAEEALNTIKPADISTVRKLAKPPHLIMRIMDCVLLLFQRGMDIVVRDPERPCCKPSWGESLKLMANSGFLNNLLNFQRDSINEEMVDLMTPYLNMEDYNLETAKKVCGNVAGLLGWTRAMEKFYWVNREVLPLKDNLAKQEIKLNSANSDLAVAENLLLEKEELLAIVRAQYEAAMKRKQELADDAEACRRRMNTAKQLIDGLSGEKIRWTEQSKSFKDQTKKL-------------------DFRVKLMTTWNLEVVRKSIPSTHGLDLIKVLTDAPTISEWNLQGLPNDELSIQNGIIVTSAARYPLLIDPQGQGKIWIKNREAAKELQITSLNHKYFRQHLEDALSLGRPMLIEDINEELDPALDQVLEKNFIKMGTGLKVKVGDKEVDVMKGFMLYITTKLPNPHYTPEIYAKTSLIDFTVTIKGLEDQLLGRVIKTEKEELEKSRIELVENMTNNKRRMQELEDSLLERLANTQGSLVDDQDLLDVLSNTKVTSQEVSLQLSQATETEKEINTAREEYRPVATRGSVLYFLFTEMSNVNQMYQIGLKQFLTLFDQSMHKSDKSPITHRRISIIIEYMTFDMWKFAVRGMYKEDRMTLTLMLALKIDIQSKNIRQEEFDVLIKGGSVLDLKTVPPKPAKWITDLTWLNLNALSVLNQFSAIIEQVVQTEKNWKQWYDKENPENEQIPCGYESNLDTFRRLLMVRSWCPDRTLPQAKKYISSSLGESFAEEVLLNMEKLLADSDCRSTLINLLSMGSDATPLIEQLAKKKHIPCKAVSMGQGQEIHSRKLISKFMQEGGWVLLQNCHLCLDYVEELFLQIIEAENVHEKYRLWITTEEHKKFSINLLQISIKFTNEPPEGIKANLMRTYTDVTQDFLDTCVTFHWKIMLFGLAFLHCTVQERRKFGPLGWNIPYEYNQSDFNASIQFIQNHLDGIEFKKAQKISGIDWKCVRYMISEIQYGGRVTDDYDKK-------------------------------KCLHRNSIFTRLPGKDTPEAFGLHPNADITYSTKTTKQILDTILSIQPKDAASGGGETRESVVMRQCGDMLQKLPSNYIPYQVQEKLQKMGALAPMNIFLRQEVDRMNKVIKMVRATLNDLQLAIQGTIIMNENLRDALDNLYDAKIPHVWLKISWDSATLGFWFSELIDRNNQFSSWLNDGRPVAFWMTGFFNAQGFLTAMRQEVTRSHDGWALDSVVLTSKVTKHLHDELREPPKEGVYVYGLFIEGAAWDKRNSRLTEPKPKELYDNLPVINIFAIQEATKNKIDTS---KLYTTPIYKKPRRTDLTYVASVELVC--SKTPDHWVMRGVALLCDIK 4553          

HSP 2 Score: 149.058 bits (375), Expect = 5.158e-35
Identity = 71/153 (46.41%), Postives = 97/153 (63.40%), Query Frame = 3
Query:    3 SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTIDDFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPLLKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLRGDH 461
            +V+GYY+I+W +VD++KI ++L EFQN+C++LPK LKDWPA+ DL+KTIDDFN  VPLLE+MTN AMKPRHWQR++DLT++ FD     FA ++                                   +W+  +L   +FKNRGELLL+GD 
Sbjct: 1470 TVSGYYEIIWKNVDMDKIGSDLQEFQNKCKRLPKALKDWPAYTDLQKTIDDFNEKVPLLEMMTNKAMKPRHWQRLADLTNYSFDT----FACQH-----------------------------------DWANQDLKLASFKNRGELLLKGDR 1583          
The following BLAST results are available for this feature:
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH51.992e-5571.70dynein axonemal heavy chain 5 [Source:HGNC Symbol;... [more]
DNAH82.241e-5768.02dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH82.621e-5768.02dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH81.554e-5768.87dynein axonemal heavy chain 8 [Source:HGNC Symbol;... [more]
DNAH102.675e-736.11dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-16.134e-728.10Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-16.165e-728.07Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-16.165e-728.07Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-30.000e+026.92Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-38.281e-1126.95Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94922.660e-6263.28gene:FBgn0037726 transcript:FBtr0309028[more]
CG94922.706e-6263.28gene:FBgn0037726 transcript:FBtr0309029[more]
CG94922.780e-6262.83gene:FBgn0037726 transcript:FBtr0344344[more]
CG94922.533e-6262.83gene:FBgn0037726 transcript:FBtr0309027[more]
kl-33.748e-4758.77gene:FBgn0267432 transcript:FBtr0346771[more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah51.641e-5672.09dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah5l8.883e-5867.24dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
dnah5l0.000e+067.25dynein, axonemal, heavy chain 5 like [Source:ZFIN;... [more]
si:dkeyp-86b9.11.274e-1136.59si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH101.274e-1136.59si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000021690.19.511e-5972.44dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021565.19.650e-5972.32dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000021598.11.229e-5872.32dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
ENSXETT00000035049.19.236e-5972.13dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
nifk3.200e-5669.04nucleolar protein interacting with the FHA domain ... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah52.994e-5471.64dynein, axonemal, heavy chain 5 [Source:MGI Symbol... [more]
Dnah82.249e-5667.86dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah82.249e-5667.86dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah82.249e-5667.86dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
Dnah25.096e-1336.57dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TE73|DYH5_HUMAN9.567e-5571.70Dynein heavy chain 5, axonemal OS=Homo sapiens OX=... [more]
sp|Q8VHE6|DYH5_MOUSE2.094e-5371.64Dynein heavy chain 5, axonemal OS=Mus musculus OX=... [more]
sp|Q96JB1|DYH8_HUMAN1.076e-5668.02Dynein heavy chain 8, axonemal OS=Homo sapiens OX=... [more]
sp|Q91XQ0|DYH8_MOUSE1.573e-5567.86Dynein heavy chain 8, axonemal OS=Mus musculus OX=... [more]
sp|M0R8U1|DYH5_RAT1.501e-5272.26Dynein heavy chain 5, axonemal (Fragment) OS=Rattu... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|183416412.026e-7177.90tr|A0A267GD23|A0A267GD23_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183232262.761e-7177.90tr|A0A267E162|A0A267E162_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183399421.243e-6877.33tr|A0A267H528|A0A267H528_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183056681.406e-6877.33tr|A0A1I8J1U1|A0A1I8J1U1_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|203428855.000e-6675.95tr|A0A2R2MTI0|A0A2R2MTI0_LINUN dynein heavy chain ... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah52.348e-5771.02dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah50.000e+071.86dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000016401.20.000e+065.73pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
dnah22.832e-836.68dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+036.56dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001372.12.950e-1169.46pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001370.12.829e-1169.39pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001365.13.105e-1169.39pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
ENSPMAT00000001375.12.831e-1168.39pep scaffold:Pmarinus_7.0:GL479430:481:33677:-1 ge... [more]
ENSPMAT00000006497.11.886e-5869.18pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN11.634e-10030.31Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO356036.329e-6271.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320049.203e-6070.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420241.064e-5370.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358526.959e-1536.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340775.825e-1236.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah51.909e-5469.57dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah53.413e-3665.65dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah50.000e+069.32dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
si:dkeyp-86b9.10.000e+033.15dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
dnah123.637e-833.77dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
back to top
BLAST of dynein heavy chain 5, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049144.13.768e-8899.64SMESG000049144.1[more]
SMESG000049144.13.705e-8899.14SMESG000049144.1[more]
SMESG000039073.11.279e-5168.62SMESG000039073.1[more]
SMESG000056575.14.279e-3666.16SMESG000056575.1[more]
SMESG000056575.15.158e-3566.16SMESG000056575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006343 ID=SMED30006343|Name=dynein heavy chain 5, axonemal|organism=Schmidtea mediterranea sexual|type=transcript|length=9728bp
ATTCGGTTAACGGTTACTATGACATCCTCTGGGGGGACGTGGACATCGAA
AAAATATCAAATGAATTGACAGAATTCCAAAACCGGTGCCGGAAATTGCC
TAAAGGACTAAAGGATTGGCCAGCATTTGAAGACCTCCGGAAGACGATTG
ATGATTTCAATTCAATGGTTCCTCTGTTGGAGCTGATGACAAACCCGGCA
ATGAAACCGAGACATTGGCAGAGGATGAGTGACCTCACCAGCCACCATTT
CGATGTCGAATCAGATGGATTCGCGCTCAGGAATATCTTAGAGGCGCCGC
TGCTGAAGTTCAAGGAGGAAATCGAGGACATTTGCATCTCGGCCGTGAAA
GAAAAAGATATCGAAGCAAAATTGAAAGCAGTCAAAGCTGAATGGAGTGC
TCACGAGTTGCATTTTGGAACGTTTAAGAATCGTGGGGAGTTGTTGCTGC
GTGGAGATCACACGAGTACAACGTGCCGTTCAAGAAAGACATCCAGGATA
TGGTATCAAAACTGTCGAATTCCAGTGAAATCATCGAGCAATGGATGACT
GTACAGAACCTTTGGGTGTATCTTGAAGCGGTATTCGTCGGTGGGGACAT
AGCAAAACAGTTGCCAAAGGAAGCGAAACGATTCAGCAATATTGATAAGA
GCTGGATCAAGATCATGTCGAGGGCTCATGAGAATACCAACGTGCTGCAG
TGCTGTGTGGGCGACGAAACTCTCAGTCAATTGTTGCCTCATTTGCTGGA
GCAGCTAGAGATTTGCCAGAAGAGTTTGACTGGGTATCTGGAAAAGAAAC
GACTTTTGTTTCCGCGATTTTTCTTCGTTTCCGACCCAGCACTACTGGAA
ATCCTTGGCCAAGCGTCAGATCCGCACACAATTCAATCCCATTTGCTGTC
GGTATTCGATAACATCAAGACCGTGAAATTCCACGAGAAACAATACGAAA
CGATTCTGGCGTGCTATTCAATGGAGGGAGAGGCATTGGAGCTGGAGAAG
CCCGTGAAAGCAGAAAGCAACGTGGAGATATGGCTAATGGGATTGCTGAA
CATGGCCCAGCGATCTCTTCATGGCGTTATCAGGGCGGCCAATAATTCCA
TCAACGATACTGAATTCAATGTTTTGGAATTCCTGAACATGTATCCTGCA
CAAGTGGGCCTCCTAGGAATCCAGTTACTGTGGACAAGGGATTCAACAGA
GGCACTAGTCAATGCAAAATCCGACAGGAAGATCATGCAGCAAACCAATG
AACAGTTTCTCCTCCTCCTTAATCTGCTCATTCAACAGACAACAACGGAT
CTCGGCAAGGTGGAGAGAACGAAATTCGAAACCTTGATAACGATCCATGT
GCATCAGAAAGACATATTTGATCAGCTGGTCAAGGACAAGGTCAAATCGC
CAAGCGATTTTGATTGGCTCAAACAAACTCGGTTTTATTTTGTGGAGGAT
GTGGACAGATGCATCGTTTCTATCACTGATGTGGATTTCATCTACCAGAA
TGAGTTTCTCGGCTGTACGGAGCGATTGGTCATAACGCCACTGACTGACA
GGTGCTACATCACGCTAGCGCAAGCCCTCGGAATGTCCATGGGAGGCGCA
CCCGCCGGACCAGCTGGAACAGGGAAAACTGAAACTGTGAAAGATATGGG
TCGTTGCCTTGGCAAATATGTTGTCGTATTCAATTGCTCAGATCAGATGG
ATTTCAGAGGATTGGGCAGGATATTCAAAGGTCTCTCTCAGTCGGGCTCA
TGGGGCTGCTTTGACGAGTTCAATCGAATCGATTTACCGGTGTTATCAGT
TGCCGCGCAGCAAATCGCTGTCGTGTTGTCGTGCAAGAAGGAACGAAAGA
AACAATTTGTTTTCACTGATGGCGACTTGGTGGACATGAATCCGGAATTC
GGAATATTTCTGACAATGAATCCTGGATATGCTGGTCGACAGGAGTTGCC
GGAAAACTTGAAAATCAATTTCAGAAACGTTGCAATGATGGTGCCAGATA
GGCAGATAATTATCCGTGTGAAGTTGGCCTCATGCGGTTTCATTGACAAT
ATCGTATTGGCGAGGAAGTTCTATACGCTTTACAAGCTCTGTGAAGAACA
GTTAACGAAACAAGTGCACTATGACTTCGGGTTGAGGAACATTCTCTCGG
TGCTGAGAACTCTCGGCCAGCAGAAGAGAGCTAATCCTACGGACACGGAA
CAAACGACTGTCATGCGAGTACTAAGGGACATGAATTTGAGCAAACTTGT
TGACCAGGATGAACCGCTATTTATCTCTCTGATCAATGATCTGTTTCCAG
GAATCCAGTTGGACAAAGGAGGATATCCGGAACTGGAAGCCGCTATTAAC
AGGCAAATTGATGAAGCGCTTATCATATCTCATCCACCTTGGGTGCTGAA
ACTCATTCAATTATTTGAAACCCAGCGGGTAAGACATGGAATGATGACGC
TTGGTCCGTCTGGGGCCGGGAAAACCAATTGTATACATGTGCTAATGAAG
GCGCTGACCGATTGTGGGGAACCTCACAGGGAAATGAGAATGAATCCGAA
GGCAATAACAGCTCCGCAAATGTTTGGTCGGTTGGATGTGTCAACAAATG
ATTGGACAGACGGAATATTTTCCACTTTGTGGAGGAGGACATTGAAGGGA
AAGAAAGGCGAACATATATGGTTGGTTCTAGATGGACCTGTTGATGCCAT
TTGGATTGAGAACCTCAATTCGGTACTAGATGATAACAAAACGTTGACCT
TAGCCAATGGAGACCGGATACCGATGTCACCATCTTGCAAGATCATATTT
GAGGTTCACAACATCGATAACGCCTCTCCAGCAACAGTTTCAAGGAATGG
TATGGTCTACATGAGCAGCTCGGCCCTCGATTGGTGTCCATTGCTGAAAG
GATGGTTACTAAAAAGAAATTCTAATGAAAGGCCAATAATGCTGGAGCTG
TTTACTAATTCATTCCCAGATATTTACAGATATTCCATCCAATATCTTAT
ATACAAAATGGAGACGCTAGAAGCATTCGTGGTTCGCCAGGCATGCGATT
TGCTGGAAGGATTGATACCGAGGAAGGACGAGAAAGATTCCTCACAGATT
TCTCGAATTCATTATGAACGGCTGTATATATTCTCTGTCATGTGGAGCAT
TGGAGCTTTGCTGGAAATTGAGGACCGTGGGAAACTAGAAGCATATATTC
GATCAAATAACAATATCAAGCTTGATCTACCGAAAATTGAAAAGGATTCC
GAAGATACCATGTTTGATTATATGGTCAGTGAGAATGGTGAATGGGTCCA
TTGGAATTCAAAGGTCGAAGAATATATATATCCTAAAGATTCGACTCCCG
AATATGGATCCATTCTTGTGCCGAATGTTGACAATGTTCGAACAGACTTT
CTAATGAATACTGTGGCATCTCAGGAGAAGGCAGTTCTACTTATTGGCGA
GCAGGGAACTGCCAAAACGGTCATGATCAATAAATACCTTTCCTCAAAGA
ATCCAGAATATCACATGTTTAAATCTCTTAATTTCTCCAGTGCAACGGTA
CCGTTTATGTTCCAAAGAACAATCGAAAGTTTCGTTGATAAGCGTATGGG
AAGCACATATGGGCCACCAGCGGGACGCAAAATGACCGTGTTCATAGATG
ATATAAACATGCCGGTGATAAATGAATGGGGAGATCAAATAGCCAATGAG
ATCGTGAGGCAATTATTGGAGGTGAAAGGGTTCTACAATCTTGAGAAGCC
AGGAGATTTCACGAATATTGTTGATATGCAGTTTATGGCCGCGATGATTC
ACCCGGGAGGAGGAAGGAATGATATTCCACAGAGATTAAAAAGACAGTTC
TGCATATTCAATTGCACGCTCCCTAGCAATAGCAGCATAGATAAAATATT
CTCTATTATCGGAACCGGACATTATTGTAAAGAAAGAGGATTCAACGATG
AAGTTCGACAACTTGTACAGAATTTGATTCCAATAACGAGGCGGTTGTGG
ATTCTGACCAAGGGCAAAATGCTGCCAACTCCAGCTAAATTCCATTACGT
ATTCAACTTACGTGATCTCAGTAGGATCTGGCAAGGGATGATTAATACTC
AGGGTGACGTGATCACAAATGCTAAAACCCTTCTCGGTCTCTGGAAGCAC
GAATGTTGCCGTGTTATTTCTGACAGATTTGTCCAAGTAGAAGACATAAG
CTGGTTTGTGAAAACCTTGAAGAGATGTTTGTCCGAGGATTTGTCGGAAG
ATATTGTTAGTCAAAGTCAAGTCTTTGAAACGGATGCGTGGTTCATGGAT
TTCATGAGGGATGCTAAAGAAGCTACTGGTGAAGAACCCGATGATACGGA
TTTTGATATGCCGAAAGTTTATGAACCAATCGCTTCGTTTGATCAACTGA
AAGACAGGTTGAAAATGTTCGAGGGACTCTATAATGAAAGCATTAGAGGT
GCTGGAATGGATATGGTGTTTTTCACTGACGCCATGACTCATTTATTGAA
GATATCCCGTATTATTAGAACACCACGAGGAAATGCTTTGCTTGTTGGTG
TTGGAGGCTCTGGAAAACAAACCTTGACAAAGCTGGCATCATATATTGCA
GGCTACAAAATATTCCAAATAACACTAACAAGATCTTACAATATTAGCAA
TTTGTTGGAGGATTTAAAATTCCTCTACCGTACTGCTGGTCAACAGGGCA
AAGGCATTACGTTCTTGTTTACAGATCAAGAGATAAAGGATGAAGGCTTC
CTTGAATACATGAACAATGTCCTGTCTTCTGGTGTGGTATCTAATCTATT
CGCTAGGGATGAGATGGATGAAATTTGCCAAGAACTGATTCCAATCATGA
AGAAAGAATATCCTCGACGACCTCCAACCAATGATAATCTTCAAGAATAC
TTCCTATCGAGAACGAAACAAAATTTACACGTTGTGTTGTGTTTCTCACC
GATCGGAGAAAAGTTCCGCAACCGAGCCTTAAAATTTCCTGGATTAATTT
CCGGTTGTACAATGGACTGGTTTCAAAGGTGGCCAAAGGATGCATTAATT
GCTGTTGCTGGACATTATCTCTCTTCGTTTGAAATTGTGTGTGCTCCGAT
CGTGAAAAAGGAATTGATAATCAGCATGGGAGTAGTCCACGATGGAGTGG
CGGAGAATTGCGTTGATTACTTCCAGAGATTCCGCCGTCAAACTCATGTA
ACTCCAAAATCTTATTTATCATTTTTGACTGGTTACAAATCAATTTACAA
AGAAAAATTCGACCACTACTCAAACCTTGCTCAGAGAATGGATTCTGGTC
TACAAAAGCTAATTGAAGCCCAGGAAAGTGTCGCGGAATTGAAGGAGGTT
TTAGCGGAAAAAGAAAAAGAGCTGGCAATTGCAAATAGAGAAGCAGAGGA
AGTTCTGAAAACTGTTACTGTTCAAAAGAATGCTGCAAATGAAGTGAAAA
ATAAAGTACAAGTTGTAAAAGACAAAGCTCAGAGTATTGTTGAAGAAATT
GAAAGAGATAAGAAAATTGCTGAATCAAAACTGGAAGCTGCTGAACCAGC
GTTAAGAGAAGCCGAGGATGCTTTGAACACCATCAAGCCCGCGGACATTG
CAACCGTCCGAAAATTGGGTCGCCCTCCTCATCTGATTATGCGAATTATG
GATTGTGTACTGATATTCTTCCAACGGCGTCTTGATACAATGGCAGGAGA
TCCAGAGAGAAATTCCCCAAAACCTTCCTGGGGGGAATCAATGAAATTAA
TGTCTAACAATCAGTTTCTGAATAATTTAATTAACTTTCCCAAGGATACG
ATCAATGAGGAAACCGTCGAGCTTATCTCTCCATATTTGGAGATGGAAGA
CTATACTATTGATGTAGCAAGACGGGTCTGTGGTAACGTTGCAGGTTTAC
TATCATGGACTCGGGCCATGATGAGTTTCTTCGAAATAAACAAGGAAGTT
TTACCGTTGAAAGACAACCTAACAAAGCAACAGGTTCGATACGAGAAATC
CATGGAAGATTTGAATGCTGCCCAATCAGTGCTTGACGAGAAGCAGAAGG
AGTTAGGCAAAGTTCAAGCTATCTATGATGAAGCGTTGAGAAAAAAGCAA
ACTTTATTGGATGACGCAGAAACTTGTCGAAGGAAAATGACCGCAGCAGC
AGAATTGATAGAAGGACTTGCCGGTGAAAAATTGAGGTGGACCAATCAGA
GCAGTGAATTTAAAGCTCAAATTGATAGATTGGTTGGAGATGTTCTTTCT
GCCACTGCTTTCCTTTCATATTGCGGTCCATTTAACCAGGAGTTCAGGAA
CATTCTCAATACTAGTTGGCAAAAAGAGTTGCGTACCAGGAAGATTCCGT
TTTCAACGTCCTTAAATATAATTGACATGTTGACAGACCCGACGATCCTA
GGGGAATGGAGTCTGCAAGGATTACCAAATGATGAGTTATCAGTACAGAA
TGGAATCATTGTAACAAAGGCGAGTCGATATCCACTCCTGATTGATCCAC
AAGGTCAGGGTAAAATATGGATAAAGAACCGTGAGGCACAGAAAGAACTC
CAAGTGACATCTTTGAATCATAAATATTTCCGACAACATCTCGAGGATTC
ATTATCTCTTGGACGGCCATTGCTGATTGAGGATATTGGTGAAGAATTGG
ATCCAGCATTGGACAATGTCCTTGAGAAGAATTTCATCAAACAAGGTTCC
ACGTTCAAGGTGAAAGTCGGAGATAAAGAGGTCGATGTCATGAAAGGATT
CGAATTGTATATAACTACCAAATTGCCAAACCCGAGTTACACGCCAGAGA
TATTTGCAAGGACCTCAATTATTGATTTCACTGTGACTATGAAGGGTCTT
GAAGATCAGTTATTGGGACTCGTCATACAAACTGAGAAACAAGAGCTTGA
AGCGCAGAGACTTCAATTGATGGAAGATGTTCAGGGAAATAAAAAGAAAA
TGAAGGAACTCGAAGACAACTTATTGTTCAGATTGACCAGTACAAAGGGA
TCATTAGTTGACGATGAAGATTTGATAAAGGTGTTGAAAACGACCAAAGT
CACATCAGCGGAAGTCAGTCAAAAACTGATAATTGCATCCGACACGGAAA
TCAAGATCAATTCTGCTAGAGAAGAATATCGTCCCGTAGCTACTCGAGGC
TCAATTCTGTATTTCCTTATAGTTGAGATGAGTTTAGTCAACATCATGTA
TCAAACATCTCTTCGACAGTTCTTGGGACTTTTTGATCTCTCAATGTCGA
GGTCCCAGAAATCGCCAGTTACGCAGAAAAGAATACAAAACATAATAGAA
TGCATGACTTATGAGGTTTGGAAATATGCTGTGAGGGGTCTCTATGAATC
AGATAAAATCACCTTCACCCTTCTGATGGCGCTCAAGATGGATATGAGAG
CTGGGAAAATCAAAATCGAAGAATTCCATACATTTATCAAAGGTGGAGCT
TCTCTTGATATGAACGTTGTACAGCCGAAACCGAAAGCCTGGATAACAGA
TATGACGTGGCTTAATTTGGTAGAATTGTCAAATCTTCACCAATTCAGCG
CAGTTCTTGATCAAGTGTCAAGAAATGAAAAACAATGGAGACAATGGTTT
GACAAGGAAGCTCCGGAAGAAGAGGTTATACCGGATGGTTATAACACCAA
CCTCGATACCTTTAGAAGACTATTGCTCGTTAGATGTTGGTGTCCTGATA
GGACTTTGAGTCAAGCGAAGAAATATATTCAAGATTCCTTGGGGGAGAAA
TTCGCAGAAGGGTTTATTCTCGACGCAGATAAAGTATTTGAAGAATCTGT
TCCACGAACCCCAATGGTGGGTCTGCTAAGTATGGGTTCTGATCCGACTC
CGACAATTGAAATGCTAGCTAAAAAACACAAAGTGGAATGTAGAGCTATT
TCCATGGGTCAAGGCCAAGAAATCCATTCTAGGCGGCTGATGGCGAACTT
TTTAGTCACTGGAGGATGGGTGCTGTTACAGAATTGTCATTTATCCTTGG
ATTATATGGAGGAATTGATGGATCAAATGATCGAAACGGAAGTCATTCAC
GATGATTTCAGGCTCTGGGTTACAACTGAGATACACCCAAAATTCCCAAT
ATCTTTCCTGCAAATGAGTATCAAGTTTACCAATGAACCGCCTCAAGGAA
TCAAGGCTGGAATCAAAAGAACATACACGAGTTTTAATCAGGATTTCCTG
GATATCAGCAACATGATGCAATGGCGCCCAATGGTCTATGCGGTGGCATA
CTTGCACACTTGCGTACAGGAACGCAGGAAATTCGGCCCGCTTGGATGGA
ATATTCCCTATGAATACAATACGGCTGACTTGAACGCTAGTCTCCAATTC
GTGCAGAATCATCTCGACGACATGGACATCAAAAAGGGCATGAGTTGGAA
AACAATCTGTTACATGCTCGGTGAAATACAATATGGGGGCCGGGTTACTG
ATGACTATGACAAAAGGCTTTTGAACACCTTCTGCCGCCGCTGGTTCAAT
GATGACATGTTCAACCCAAAATTCAGATTTTTTAAGGATCACAGCATTCC
AGCAGTGTCAAAGCTCAATGAGTACATAGATATCATAAATGAATTACCGA
ATTATGACAGTCCAGAAATGTTTGGGTTGCACTCCAATGCTGACATTACC
TATCAAAGTAAGACAGCACAATCAATATTGGACTGTATTTTAAACATCCA
ACCGAAGGACGCCAGTGCCGGAGGAGGTGAGACGAGAGAAAGTGTAGTGT
ATCGAATGTGTGACGACATGCTGGGGAAATTGCCATCTGATTACGTGTCA
TTTGAAGTGATGGAACGCTTGCAAATAATGGGAATCCTGCAACCGATGAA
TATCTTTCTGAGACAAGAAGTTGATAGAATGCAGAAAGTGATCGCTAAGG
TGCGTACAACGCTGATCGATTTAAAACTCGCAATTGACGGAACGATAATT
ATGAATGAGGATCTCAGAGACGCGCTGGATTCGATGTATGACGCGAGAAT
TCCGAGCTCTTGGTCTAAGGTTTCATGGGAGTCTTCAACGCTTGGGTTTT
GGTTCACGGAATTGATCGAAAGGAATTCACAATTCTCAACATGGCTGTTC
AAAGGTCGACCAAACTGCTTCTGGATGACAGGGTTCTTTAATGTTCAAGG
GTTCCTGACGGCTATGCGACAGGAGGTGACTCGGGCTCACAAGGGCTGGG
CCTTGGATACGGTTGTGCTATGGAATGATGTCACCAAGCACATGCAGGAT
GAGATCAACCAACCACCCTCGGAGGGCGTCTACGTGTACGGATTATATTT
GGAAGGTGCAGGCTGGGACCGGAGAAACAGCAAGTTGATCGAATCTAAAT
CAAAAGTCCTATTCGAGCCGTTGCCAGTCATTTTGATCCAGGCCATTGAC
ATATCGAAAGAAGGTGAAATCTCCAGAGATCTCCTGAAGAACATGTATCA
ATGCCCTGTGTACAAAAAACCAAGGAGAACGGATCTGACATTTATTGCCT
CAGTTTATCTCAGATGTCCTCCAACTAAGCAAGCCGACCATTGGACTTTG
CGAGCAGTGGCGCTCTTGTGCGATATTAAATAGGTCTGTGGTGGAAAACA
TTTCTGACATGTGATTTGATTGACTGTTTACTTTTTATCGATTATTTTCC
CCTTTATATGCCTGTGCCATTATTGATTTGTAAAAATATGCTCTTATTTG
ATTGGCTGTTTGCTTTTTATCGATAATA
back to top

protein sequence of SMED30006343-orf-1

>SMED30006343-orf-1 ID=SMED30006343-orf-1|Name=SMED30006343-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=3028bp
MVSKLSNSSEIIEQWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDK
SWIKIMSRAHENTNVLQCCVGDETLSQLLPHLLEQLEICQKSLTGYLEKK
RLLFPRFFFVSDPALLEILGQASDPHTIQSHLLSVFDNIKTVKFHEKQYE
TILACYSMEGEALELEKPVKAESNVEIWLMGLLNMAQRSLHGVIRAANNS
INDTEFNVLEFLNMYPAQVGLLGIQLLWTRDSTEALVNAKSDRKIMQQTN
EQFLLLLNLLIQQTTTDLGKVERTKFETLITIHVHQKDIFDQLVKDKVKS
PSDFDWLKQTRFYFVEDVDRCIVSITDVDFIYQNEFLGCTERLVITPLTD
RCYITLAQALGMSMGGAPAGPAGTGKTETVKDMGRCLGKYVVVFNCSDQM
DFRGLGRIFKGLSQSGSWGCFDEFNRIDLPVLSVAAQQIAVVLSCKKERK
KQFVFTDGDLVDMNPEFGIFLTMNPGYAGRQELPENLKINFRNVAMMVPD
RQIIIRVKLASCGFIDNIVLARKFYTLYKLCEEQLTKQVHYDFGLRNILS
VLRTLGQQKRANPTDTEQTTVMRVLRDMNLSKLVDQDEPLFISLINDLFP
GIQLDKGGYPELEAAINRQIDEALIISHPPWVLKLIQLFETQRVRHGMMT
LGPSGAGKTNCIHVLMKALTDCGEPHREMRMNPKAITAPQMFGRLDVSTN
DWTDGIFSTLWRRTLKGKKGEHIWLVLDGPVDAIWIENLNSVLDDNKTLT
LANGDRIPMSPSCKIIFEVHNIDNASPATVSRNGMVYMSSSALDWCPLLK
GWLLKRNSNERPIMLELFTNSFPDIYRYSIQYLIYKMETLEAFVVRQACD
LLEGLIPRKDEKDSSQISRIHYERLYIFSVMWSIGALLEIEDRGKLEAYI
RSNNNIKLDLPKIEKDSEDTMFDYMVSENGEWVHWNSKVEEYIYPKDSTP
EYGSILVPNVDNVRTDFLMNTVASQEKAVLLIGEQGTAKTVMINKYLSSK
NPEYHMFKSLNFSSATVPFMFQRTIESFVDKRMGSTYGPPAGRKMTVFID
DINMPVINEWGDQIANEIVRQLLEVKGFYNLEKPGDFTNIVDMQFMAAMI
HPGGGRNDIPQRLKRQFCIFNCTLPSNSSIDKIFSIIGTGHYCKERGFND
EVRQLVQNLIPITRRLWILTKGKMLPTPAKFHYVFNLRDLSRIWQGMINT
QGDVITNAKTLLGLWKHECCRVISDRFVQVEDISWFVKTLKRCLSEDLSE
DIVSQSQVFETDAWFMDFMRDAKEATGEEPDDTDFDMPKVYEPIASFDQL
KDRLKMFEGLYNESIRGAGMDMVFFTDAMTHLLKISRIIRTPRGNALLVG
VGGSGKQTLTKLASYIAGYKIFQITLTRSYNISNLLEDLKFLYRTAGQQG
KGITFLFTDQEIKDEGFLEYMNNVLSSGVVSNLFARDEMDEICQELIPIM
KKEYPRRPPTNDNLQEYFLSRTKQNLHVVLCFSPIGEKFRNRALKFPGLI
SGCTMDWFQRWPKDALIAVAGHYLSSFEIVCAPIVKKELIISMGVVHDGV
AENCVDYFQRFRRQTHVTPKSYLSFLTGYKSIYKEKFDHYSNLAQRMDSG
LQKLIEAQESVAELKEVLAEKEKELAIANREAEEVLKTVTVQKNAANEVK
NKVQVVKDKAQSIVEEIERDKKIAESKLEAAEPALREAEDALNTIKPADI
ATVRKLGRPPHLIMRIMDCVLIFFQRRLDTMAGDPERNSPKPSWGESMKL
MSNNQFLNNLINFPKDTINEETVELISPYLEMEDYTIDVARRVCGNVAGL
LSWTRAMMSFFEINKEVLPLKDNLTKQQVRYEKSMEDLNAAQSVLDEKQK
ELGKVQAIYDEALRKKQTLLDDAETCRRKMTAAAELIEGLAGEKLRWTNQ
SSEFKAQIDRLVGDVLSATAFLSYCGPFNQEFRNILNTSWQKELRTRKIP
FSTSLNIIDMLTDPTILGEWSLQGLPNDELSVQNGIIVTKASRYPLLIDP
QGQGKIWIKNREAQKELQVTSLNHKYFRQHLEDSLSLGRPLLIEDIGEEL
DPALDNVLEKNFIKQGSTFKVKVGDKEVDVMKGFELYITTKLPNPSYTPE
IFARTSIIDFTVTMKGLEDQLLGLVIQTEKQELEAQRLQLMEDVQGNKKK
MKELEDNLLFRLTSTKGSLVDDEDLIKVLKTTKVTSAEVSQKLIIASDTE
IKINSAREEYRPVATRGSILYFLIVEMSLVNIMYQTSLRQFLGLFDLSMS
RSQKSPVTQKRIQNIIECMTYEVWKYAVRGLYESDKITFTLLMALKMDMR
AGKIKIEEFHTFIKGGASLDMNVVQPKPKAWITDMTWLNLVELSNLHQFS
AVLDQVSRNEKQWRQWFDKEAPEEEVIPDGYNTNLDTFRRLLLVRCWCPD
RTLSQAKKYIQDSLGEKFAEGFILDADKVFEESVPRTPMVGLLSMGSDPT
PTIEMLAKKHKVECRAISMGQGQEIHSRRLMANFLVTGGWVLLQNCHLSL
DYMEELMDQMIETEVIHDDFRLWVTTEIHPKFPISFLQMSIKFTNEPPQG
IKAGIKRTYTSFNQDFLDISNMMQWRPMVYAVAYLHTCVQERRKFGPLGW
NIPYEYNTADLNASLQFVQNHLDDMDIKKGMSWKTICYMLGEIQYGGRVT
DDYDKRLLNTFCRRWFNDDMFNPKFRFFKDHSIPAVSKLNEYIDIINELP
NYDSPEMFGLHSNADITYQSKTAQSILDCILNIQPKDASAGGGETRESVV
YRMCDDMLGKLPSDYVSFEVMERLQIMGILQPMNIFLRQEVDRMQKVIAK
VRTTLIDLKLAIDGTIIMNEDLRDALDSMYDARIPSSWSKVSWESSTLGF
WFTELIERNSQFSTWLFKGRPNCFWMTGFFNVQGFLTAMRQEVTRAHKGW
ALDTVVLWNDVTKHMQDEINQPPSEGVYVYGLYLEGAGWDRRNSKLIESK
SKVLFEPLPVILIQAIDISKEGEISRDLLKNMYQCPVYKKPRRTDLTFIA
SVYLRCPPTKQADHWTLRAVALLCDIK*
back to top

protein sequence of SMED30006343-orf-2

>SMED30006343-orf-2 ID=SMED30006343-orf-2|Name=SMED30006343-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=182bp
SVNGYYDILWGDVDIEKISNELTEFQNRCRKLPKGLKDWPAFEDLRKTID
DFNSMVPLLELMTNPAMKPRHWQRMSDLTSHHFDVESDGFALRNILEAPL
LKFKEEIEDICISAVKEKDIEAKLKAVKAEWSAHELHFGTFKNRGELLLR
GDHTSTTCRSRKTSRIWYQNCRIPVKSSSNG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035706AAA_9
IPR042228Dynein_2_C
IPR043160Dynein_C_barrel
IPR041466Dynein_AAA5_ext
IPR042222Dynein_2_N
IPR035699AAA_6
IPR041589DNAH3_AAA_lid_1
IPR042219AAA_lid_11_sf
IPR041658AAA_lid_11
IPR043157Dynein_AAA1S
IPR041228Dynein_C
IPR026983DHC_fam
IPR003593AAA+_ATPase
IPR004273Dynein_heavy_D6_P-loop
IPR011704ATPase_dyneun-rel_AAA
IPR013602Dynein_heavy_dom-2
IPR027417P-loop_NTPase
IPR024743Dynein_HC_stalk
IPR024317Dynein_heavy_chain_D4_dom
IPR013518K_chnl_inward-rec_Kir_cyto
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0003341cilium movement
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0008150biological_process
GO:0021670lateral ventricle development
GO:0030317flagellated sperm motility
GO:0036158outer dynein arm assembly
GO:0060271cilium morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005575cellular_component
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005858axonemal dynein complex
GO:0005874microtubule
GO:0005929cilium
GO:0005930axoneme
GO:0036157outer dynein arm
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0016887ATPase activity
GO:0000166nucleotide binding
GO:0003774motor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 2130..2157
NoneNo IPR availableCOILSCoilCoilcoord: 1821..1865
NoneNo IPR availableCOILSCoilCoilcoord: 1646..1677
NoneNo IPR availableCOILSCoilCoilcoord: 1604..1638
NoneNo IPR availableGENE3DG3DSA:1.20.920.30coord: 1126..1341
e-value: 1.9E-193
score: 645.8
NoneNo IPR availablePFAMPF12775AAA_7coord: 946..1125
e-value: 2.5E-63
score: 212.9
NoneNo IPR availableGENE3DG3DSA:1.10.8.1220coord: 2210..2300
e-value: 2.0E-12
score: 49.1
NoneNo IPR availableGENE3DG3DSA:1.10.472.130coord: 838..939
e-value: 7.1E-7
score: 30.8
NoneNo IPR availableGENE3DG3DSA:1.20.920.20coord: 1569..1921
e-value: 4.0E-103
score: 346.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 610..837
e-value: 3.6E-78
score: 264.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.11510coord: 1961..2129
e-value: 4.2E-63
score: 213.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 347..498
e-value: 8.3E-67
score: 225.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 955..1507
e-value: 1.9E-193
score: 645.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2423..2545
e-value: 4.3E-33
score: 115.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.1120coord: 202..346
e-value: 1.2E-40
score: 141.1
NoneNo IPR availableGENE3DG3DSA:1.20.1270.280coord: 2719..2881
e-value: 2.4E-15
score: 58.7
NoneNo IPR availablePANTHERPTHR10676:SF365coord: 2..3027
NoneNo IPR availableCDDcd06503ATP-synt_Fo_bcoord: 1593..1693
e-value: 4.69309E-6
score: 46.2767
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 644..773
e-value: 18.0
score: 1.2
coord: 365..501
e-value: 0.45
score: 17.1
coord: 975..1172
e-value: 2.2
score: 10.2
IPR035706Dynein heavy chain, ATP-binding dynein motor regionPFAMPF12781AAA_9coord: 1969..2189
e-value: 2.6E-86
score: 288.3
IPR042228Dynein heavy chain, domain 2, C-terminalGENE3DG3DSA:3.20.180.20coord: 103..200
e-value: 3.2E-24
score: 87.1
IPR043160Dynein heavy chain, C-terminal domain, barrel regionGENE3DG3DSA:3.10.490.20coord: 2883..3026
e-value: 1.3E-11
score: 46.5
IPR041466Dynein heavy chain, AAA 5 extension domainPFAMPF17852Dynein_AAA_lidcoord: 816..936
e-value: 8.1E-19
score: 68.0
IPR042222Dynein heavy chain, domain 2, N-terminalGENE3DG3DSA:1.20.140.100coord: 1..101
e-value: 1.3E-35
score: 124.4
IPR024317Dynein heavy chain, AAA module D4PFAMPF12780AAA_8coord: 1320..1582
e-value: 7.8E-91
score: 304.0
IPR035699Dynein heavy chain, hydrolytic ATP-binding dynein motor regionPFAMPF12774AAA_6coord: 332..659
e-value: 2.2E-142
score: 473.9
IPR041589Dynein heavy chain 3, AAA+ lid domainPFAMPF17857AAA_lid_1coord: 1173..1240
e-value: 2.3E-15
score: 56.6
IPR042219Dynein heavy chain AAA lid domain superfamilyGENE3DG3DSA:1.10.8.720coord: 2546..2711
e-value: 2.9E-55
score: 188.6
IPR041658Dynein heavy chain AAA lid domainPFAMPF18198AAA_lid_11coord: 2552..2714
e-value: 4.7E-53
score: 179.4
IPR004273Dynein heavy chain region D6 P-loop domainPFAMPF03028Dynein_heavycoord: 2435..2551
e-value: 2.8E-38
score: 130.6
IPR043157Dynein heavy chain, AAA1 domain, small subdomainGENE3DG3DSA:1.10.8.710coord: 499..606
e-value: 1.7E-32
score: 114.1
IPR041228Dynein heavy chain, C-terminal domainPFAMPF18199Dynein_Ccoord: 2721..3024
e-value: 2.9E-92
score: 309.2
IPR013602Dynein heavy chain, domain-2PFAMPF08393DHC_N2coord: 3..197
e-value: 4.0E-69
score: 233.6
IPR024743Dynein heavy chain, coiled coil stalkPFAMPF12777MTcoord: 1596..1939
e-value: 2.1E-44
score: 152.0
IPR026983Dynein heavy chainPANTHERPTHR10676DYNEIN HEAVY CHAIN FAMILY PROTEINcoord: 2..3027
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1318..1590
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 976..1240
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 579..783
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 349..562