TBC1 domain family member 12

Overview
NameTBC1 domain family member 12
Smed IDSMED30006334
Length (bp)2313
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TBC1 domain family member 12 (SMED30006334) t-SNE clustered cells

Violin plots show distribution of expression levels for TBC1 domain family member 12 (SMED30006334) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TBC1 domain family member 12 (SMED30006334) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TBC1 domain family member 12 (SMED30006334) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006334

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006334SMESG000071846.1 SMESG000020373.1 Contig6022newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006334SMESG000071846.1 SMESG000020373.1 Contig6022uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30006334SMESG000071846.1 SMESG000020373.1 dd_Smed_v4_7827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006334SMESG000071846.1 SMESG000020373.1 dd_Smed_v4_7827_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006334SMESG000071846.1 SMESG000020373.1 dd_Smed_v4_7827_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Match: TBC1D14 (TBC1 domain family member 14 [Source:HGNC Symbol;Acc:HGNC:29246])

HSP 1 Score: 271.937 bits (694), Expect = 9.391e-84
Identity = 158/413 (38.26%), Postives = 214/413 (51.82%), Query Frame = 1
Query:  811 LISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            ++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++             K+   +  T  S+VEN                 D   SA D                                     R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:    1 MVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLAR------------AKERWRSLSTGGSEVENE----------------DAGFSAAD-------------------------------------REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 345          
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Match: TBC1D14 (TBC1 domain family member 14 [Source:HGNC Symbol;Acc:HGNC:29246])

HSP 1 Score: 234.958 bits (598), Expect = 4.211e-69
Identity = 113/230 (49.13%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:  179 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 405          

HSP 2 Score: 105.145 bits (261), Expect = 2.496e-23
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:   30 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 156          
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Match: TBC1D14 (TBC1 domain family member 14 [Source:HGNC Symbol;Acc:HGNC:29246])

HSP 1 Score: 235.343 bits (599), Expect = 1.212e-68
Identity = 113/230 (49.13%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:  231 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 457          

HSP 2 Score: 104.76 bits (260), Expect = 5.108e-23
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:   82 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 208          
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Match: TBC1D14 (TBC1 domain family member 14 [Source:HGNC Symbol;Acc:HGNC:29246])

HSP 1 Score: 238.039 bits (606), Expect = 1.913e-67
Identity = 113/230 (49.13%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:  459 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 685          

HSP 2 Score: 105.916 bits (263), Expect = 5.890e-23
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  310 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 436          
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Match: TBC1D14 (TBC1 domain family member 14 [Source:HGNC Symbol;Acc:HGNC:29246])

HSP 1 Score: 238.039 bits (606), Expect = 1.913e-67
Identity = 113/230 (49.13%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:  459 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 685          

HSP 2 Score: 105.916 bits (263), Expect = 5.890e-23
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  310 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 436          
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Match: tbc-12 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:Q21928])

HSP 1 Score: 183.726 bits (465), Expect = 3.274e-49
Identity = 89/199 (44.72%), Postives = 131/199 (65.83%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDV--NIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVL 1950
            ++  +  I LD +RTF +L +FQ  GP++D L +LL AYA  RPDIGYVQ M+F+AA+L++ M+   AFI FAN+L+     AF+ L + + T Y  ++   L   LP L QH    KLDV  +++L +W F +Y+++LPLD   R+WD++ RDGE  LF+A LGILR YE +LL  DF++   FLT ++P +L+ + L
Sbjct:  349 KETSVTQIHLDATRTFTSLGMFQKDGPYYDHLLKLLSAYAILRPDIGYVQSMTFIAAVLLIQMDPYPAFISFANLLDRSLQSAFFGLKQPQMTEYFIAYDRYLEQELPALHQHL--DKLDVRPDLYLIEWTFAMYAKSLPLDVTCRIWDVYFRDGEEFLFKAALGILRMYEPKLLTMDFDDCVEFLT-KLPNTLTGAEL 544          

HSP 2 Score: 104.375 bits (259), Expect = 6.927e-23
Identity = 56/158 (35.44%), Postives = 87/158 (55.06%), Query Frame = 1
Query:  703 ETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQ---EERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKV 1167
            ++ + +TT LIL +RP GLP KS +E+  H+  Y  ++   KKKE++   A K  L++K  Q   EE+      VW   ILP W   + S+  R LWW+G+P  VR ++W   I N +++TK  YD  + Q +E+I + L    K     KET  +++
Sbjct:  202 QSGVMATTGLILEERPSGLPSKSADEAAHHKQMYLDILEQAKKKEQR---AEKERLQAKAEQKRLEEQTAAHCRVWVEQILPKWEEMKDSKRCRELWWQGVPAKVRGELWFLTIGNQIEITKELYDGLMDQAEEKIAKQLAEQNKNSAERKETSVTQI 356          
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16408873:-1 gene:WBGene00020770.1 transcript:T24D11.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 100.523 bits (249), Expect = 1.587e-21
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            I+ D+ RT+P L+ F++G     LL+ ++ AY+ +  ++GY QG +F+  +L+L M  E+AF    +++E       Y    ++  + +   +  +   +P L  HF     D +++   W  T+++  +PLD A R+ D F  +G   +F   + IL+   ++LL  D E M  +   ++ E
Sbjct:  109 IQRDIPRTYPELDFFKDGERGQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRE 291          
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16417063:-1 gene:WBGene00020770.1 transcript:T24D11.1e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 100.138 bits (248), Expect = 2.024e-21
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            I+ D+ RT+P L+ F++G     LL+ ++ AY+ +  ++GY QG +F+  +L+L M  E+AF    +++E       Y    ++  + +   +  +   +P L  HF     D +++   W  T+++  +PLD A R+ D F  +G   +F   + IL+   ++LL  D E M  +   ++ E
Sbjct:  212 IQRDIPRTYPELDFFKDGERGQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRE 394          
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16417063:-1 gene:WBGene00020770.1 transcript:T24D11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 100.138 bits (248), Expect = 2.126e-21
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            I+ D+ RT+P L+ F++G     LL+ ++ AY+ +  ++GY QG +F+  +L+L M  E+AF    +++E       Y    ++  + +   +  +   +P L  HF     D +++   W  T+++  +PLD A R+ D F  +G   +F   + IL+   ++LL  D E M  +   ++ E
Sbjct:  209 IQRDIPRTYPELDFFKDGERGQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRE 391          
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16413306:-1 gene:WBGene00020770.1 transcript:T24D11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 99.7525 bits (247), Expect = 2.469e-21
Identity = 49/183 (26.78%), Postives = 94/183 (51.37%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            I+ D+ RT+P L+ F++G     LL+ ++ AY+ +  ++GY QG +F+  +L+L M  E+AF    +++E       Y    ++  + +   +  +   +P L  HF     D +++   W  T+++  +PLD A R+ D F  +G   +F   + IL+   ++LL  D E M  +   ++ E
Sbjct:  149 IQRDIPRTYPELDFFKDGERGQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRE 331          
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0073546)

HSP 1 Score: 97.8265 bits (242), Expect = 1.353e-20
Identity = 48/190 (25.26%), Postives = 93/190 (48.95%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLF-QNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASV 1947
            I+ D++RT+P +  F +  GP  + L+ ++ AY+ +  ++GY QG  F+  +L++ M  E+AF     I++       +    SE  + +   +  +   +P +  HF Q      ++   W  T+Y+  L ++ + R+ D+F  +G   +F+  L +L   +  LL  D E M  F   ++P  + A V
Sbjct:  154 IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADV 343          
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0332620)

HSP 1 Score: 97.8265 bits (242), Expect = 1.353e-20
Identity = 48/190 (25.26%), Postives = 93/190 (48.95%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLF-QNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASV 1947
            I+ D++RT+P +  F +  GP  + L+ ++ AY+ +  ++GY QG  F+  +L++ M  E+AF     I++       +    SE  + +   +  +   +P +  HF Q      ++   W  T+Y+  L ++ + R+ D+F  +G   +F+  L +L   +  LL  D E M  F   ++P  + A V
Sbjct:  154 IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADV 343          
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0300732)

HSP 1 Score: 97.8265 bits (242), Expect = 1.353e-20
Identity = 48/190 (25.26%), Postives = 93/190 (48.95%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLF-QNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASV 1947
            I+ D++RT+P +  F +  GP  + L+ ++ AY+ +  ++GY QG  F+  +L++ M  E+AF     I++       +    SE  + +   +  +   +P +  HF Q      ++   W  T+Y+  L ++ + R+ D+F  +G   +F+  L +L   +  LL  D E M  F   ++P  + A V
Sbjct:  154 IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADV 343          
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Match: GAPcenA (gene:FBgn0035879 transcript:FBtr0076605)

HSP 1 Score: 97.4413 bits (241), Expect = 2.032e-20
Identity = 60/192 (31.25%), Postives = 98/192 (51.04%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTV-YLESFKLS--LFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSAS 1944
            I+ D+ RTFP    F+  GG   D L+++  AYA +  ++GY QG+SF+AA L+L M  EDAF     ++     +    L ++ F V YL  ++L   +   LP+L +HF    ++ +++   W  T+Y+   PL     V D+F  DG   LF+  + +L   E  L   DFE +  +    +P+   +S
Sbjct:  557 IQRDIHRTFPAHKCFKEIGGSGQDALFKVSKAYAVHDSEVGYCQGLSFIAASLLLHMPEEDAFCVLVALMY---DYGLRDLYKAGFEVLYLRLYQLERLIKDQLPKLHEHFTACGIETHMYASQWFLTLYTARFPLCFVFHVLDVFLLDGLPVLFQVAVTLLSICESDLRQLDFEGILKYFRVTLPKKCRSS 745          
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0073547)

HSP 1 Score: 97.0561 bits (240), Expect = 2.053e-20
Identity = 48/190 (25.26%), Postives = 93/190 (48.95%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLF-QNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASV 1947
            I+ D++RT+P +  F +  GP  + L+ ++ AY+ +  ++GY QG  F+  +L++ M  E+AF     I++       +    SE  + +   +  +   +P +  HF Q      ++   W  T+Y+  L ++ + R+ D+F  +G   +F+  L +L   +  LL  D E M  F   ++P  + A V
Sbjct:  154 IRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADV 343          
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 314.694 bits (805), Expect = 5.625e-96
Identity = 166/424 (39.15%), Postives = 231/424 (54.48%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            STT LIL +RP  LP K   E+++H+ +Y ++++  KK+E +     K  L+ +   EE        W   ILPNW    SS+ VR LWW+G+P SVR KVW   I N L +T   YD  L++ +E+   +                                 ++PTA + + + D  +S                                 R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AFY +D S    Y  +F++    +LP+L  HF  + L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  L + DF  +A FLT ++P+ +SA  +   +  I +   N
Sbjct:  329 STTALILENRPANLPAKPEEEAQKHRQQYEEMVAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPNWQSMCSSKRVRDLWWQGLPPSVRGKVWSLAIGNELNITDELYDICLARAKEKWNAF---------------------------------VAPTAAVETESEDAGLSHA------------------------------DREASLELIKLDISRTFPNLCIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSSDIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFIHIAQFLT-RLPDYISAEEIFSSITTINMNSKN 688          
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 262.307 bits (669), Expect = 5.473e-79
Identity = 152/426 (35.68%), Postives = 222/426 (52.11%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREK-VWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIR-KHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            STT LIL +RP  LP K   E+++H+ +Y ++++  KK+E +     K  L+ +   EE        W   ILPN              W+ + +S R + +W   +P +++                       V    +  +  ++ ++ + C  R K      ++PTA + +    L                               S  D R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AFY +D S    Y  +F++    +LP+L  HF  + L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  L + DF  +A FLT ++P+ +SA  +   +  I +   N
Sbjct:   86 STTALILENRPANLPAKPEEEAQKHRQQYEEMVAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPN--------------WQSMCSSKRVRDLWWQGLPPSVR---------------------GKVWSLAIGNELNITDELYDICLARAKEKWNAFVAPTAAVETENAGL-------------------------------SHAD-REASLELIKLDISRTFPNLCIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSSDIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFIHIAQFLT-RLPDYISAEEIFSSITTINMNSKN 443          
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 261.922 bits (668), Expect = 1.084e-78
Identity = 152/426 (35.68%), Postives = 222/426 (52.11%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREK-VWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIR-KHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            STT LIL +RP  LP K   E+++H+ +Y ++++  KK+E +     K  L+ +   EE        W   ILPN              W+ + +S R + +W   +P +++                       V    +  +  ++ ++ + C  R K      ++PTA + +    L                               S  D R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AFY +D S    Y  +F++    +LP+L  HF  + L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  L + DF  +A FLT ++P+ +SA  +   +  I +   N
Sbjct:   83 STTALILENRPANLPAKPEEEAQKHRQQYEEMVAQAKKRELKDAQKRKKQLEDRCKLEESIGNAALTWSQEILPN--------------WQSMCSSKRVRDLWWQGLPPSVR---------------------GKVWSLAIGNELNITDELYDICLARAKEKWNAFVAPTAAVETENAGL-------------------------------SHAD-REASLELIKLDISRTFPNLCIFQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFYRVDHSLMLTYFAAFEVFFEENLPKLFAHFKNNNLSSDIYLIDWIFTLYSKSLPLDIACRVWDVFCRDGEEFLFRTALGILRLYEDILTHMDFIHIAQFLT-RLPDYISAEEIFSSITTINMNSKN 440          
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Match: tbc1d12b (TBC1 domain family, member 12b [Source:ZFIN;Acc:ZDB-GENE-121214-108])

HSP 1 Score: 236.884 bits (603), Expect = 1.711e-69
Identity = 116/226 (51.33%), Postives = 153/226 (67.70%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNK 2037
            R+  L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L  HF  + L  +++L DW+FT+Y+++LPLD A RVWD+FCRDGE  LFR GLGILR YE  LL  DF   A FLT ++P+      L   +   ++  SN   T  QV N LIK+K
Sbjct:  223 RESSLDLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHELMLKYFAAFEVFFEENLPRLFNHFKSYNLTPDLYLIDWIFTLYAKSLPLDVACRVWDVFCRDGEEFLFRTGLGILRLYEELLLQMDFIHSAQFLT-RLPDDTPPERLFSCIASTQMISSNRKWT--QVFNALIKDK 445          

HSP 2 Score: 120.168 bits (300), Expect = 2.490e-28
Identity = 57/145 (39.31%), Postives = 88/145 (60.69%), Query Frame = 1
Query:  682 KSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            +S++ ++E    STT LIL DRP  LP KS  E++RH+ EY+++++  KK+E ++    K  +K +  QEE       VW   ILPNW   + ++ VR LWW+G+P +VR KVW   + N L +T   Y+ FLS+ +ER + + E
Sbjct:   64 QSRRKNLEFEPLSTTALILEDRPANLPAKSEEEAQRHRQEYDEMVAEAKKRELKEAQKKKKQMKERFKQEESIANAMVVWNTEILPNWESMRGTRRVRDLWWQGLPPNVRGKVWSLAVGNELNITSDLYEIFLSRAKERWKSFRE 208          
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Match: tbc1d12a (TBC1 domain family, member 12a [Source:ZFIN;Acc:ZDB-GENE-030131-3920])

HSP 1 Score: 233.417 bits (594), Expect = 1.171e-68
Identity = 113/220 (51.36%), Postives = 151/220 (68.64%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRN 2019
            R+  L+ IKLD+SRTFP+L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L QHF  + L  + +L DW+FT+YS++LPLD A RVWD+FCRDGE ALFR GLGILR Y+  LL  DF   A FL+ ++PE+  A  L   +   ++  +N      QVRN
Sbjct:  181 RESSLDLIKLDISRTFPSLYIFQKGGPYHDILHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAAFEVFFEENLPRLFQHFQNNSLTPDFYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEALFRTGLGILRLYQDVLLQMDFIHSAQFLS-RLPENTPAHTLFSCIANTQMISNN--RRWNQVRN 397          

HSP 2 Score: 116.701 bits (291), Expect = 2.359e-27
Identity = 55/144 (38.19%), Postives = 88/144 (61.11%), Query Frame = 1
Query:  685 SKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            +++ ++E    STT LIL DRP  LP KS  ES+RH+ EY+++++  K++E ++    K  +K +  QEE       +W + +LPNW   ++++ VR LWW+G+P SVR KVW   I N L +T   Y+ FLS+ +E+   + E
Sbjct:   21 TRRKNLEFEPLSTTALILEDRPANLPAKSEEESQRHRQEYSEMVAGAKRREMKEAQKKKRQMKERYRQEENIASAMVIWNSEVLPNWESMRNTRRVRDLWWQGVPPSVRGKVWCLAIGNELNITPELYEIFLSRAKEKWRSFSE 164          
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Match: rgs4 (regulator of G-protein signaling 4 [Source:Xenbase;Acc:XB-GENE-942771])

HSP 1 Score: 235.343 bits (599), Expect = 7.122e-69
Identity = 111/210 (52.86%), Postives = 148/210 (70.48%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF  + L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL  DF  +A FLT ++PE +++  L   +  I++  SN
Sbjct:  223 REASLELIKLDISRTFPSLYIFQKGGPYHDLLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKYFAAFEVFFEENLPKLFFHFNAYSLTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGILRLYEDILLQMDFIHIAQFLT-KLPEDITSEKLFGCIAAIQMQNSN 431          

HSP 2 Score: 123.635 bits (309), Expect = 2.097e-29
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 1
Query:  676 SNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            S  ++K   E    STT LIL DRP  LP KS +E+ RH+ EY+++++  KK+E ++    K L+K +I QEE       +W   ILPNW   +S++ VR LWW+G+P S+R KVW   I N L +T   Y+ FLS+ +ER + + E
Sbjct:   63 SQSTRKKKFEFEPLSTTALILEDRPSNLPAKSVHETLRHRQEYDEMVAEAKKREVKEAQRRKKLMKERIRQEENIASAMVIWNTEILPNWDVMRSTRRVRDLWWQGLPPSIRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFSE 209          
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Match: rgs4 (regulator of G-protein signaling 4 [Source:Xenbase;Acc:XB-GENE-942771])

HSP 1 Score: 234.187 bits (596), Expect = 2.511e-68
Identity = 111/210 (52.86%), Postives = 148/210 (70.48%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF  + L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL  DF  +A FLT ++PE +++  L   +  I++  SN
Sbjct:  234 REASLELIKLDISRTFPSLYIFQKGGPYHDLLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKYFAAFEVFFEENLPKLFFHFNAYSLTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGILRLYEDILLQMDFIHIAQFLT-KLPEDITSEKLFGCIAAIQMQNSN 442          

HSP 2 Score: 123.635 bits (309), Expect = 2.688e-29
Identity = 64/149 (42.95%), Postives = 93/149 (62.42%), Query Frame = 1
Query:  670 NRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            ++S + KK   E PL STT LIL DRP  LP KS +E+ RH+ EY+++++  KK+E ++    K L+K +I QEE       +W   ILPNW   +S++ VR LWW+G+P S+R KVW   I N L +T   Y+ FLS+ +ER + + E
Sbjct:   74 SQSTRKKKFEFE-PL-STTALILEDRPSNLPAKSVHETLRHRQEYDEMVAEAKKREVKEAQRRKKLMKERIRQEENIASAMVIWNTEILPNWDVMRSTRRVRDLWWQGLPPSIRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFSE 220          
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Match: rgs4 (regulator of G-protein signaling 4 [Source:Xenbase;Acc:XB-GENE-942771])

HSP 1 Score: 234.958 bits (598), Expect = 4.566e-68
Identity = 112/217 (51.61%), Postives = 151/217 (69.59%), Query Frame = 1
Query: 1339 ASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            A + +  R+  L  IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF  + L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL  DF  +A FLT ++PE +++  L   +  I++  SN
Sbjct:  262 AGASLADREASLELIKLDISRTFPSLYIFQKGGPYHDLLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKYFAAFEVFFEENLPKLFFHFNAYSLTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGILRLYEDILLQMDFIHIAQFLT-KLPEDITSEKLFGCIAAIQMQNSN 477          

HSP 2 Score: 115.546 bits (288), Expect = 1.979e-26
Identity = 60/147 (40.82%), Postives = 85/147 (57.82%), Query Frame = 1
Query:  676 SNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            S  ++K   E    STT LIL DRP  LP KS +E+ RH+ EY+++++  KK+E ++    K L+K +I QEE       +W   ILPNW        VR LWW+G+P S+R KVW   I N L +T   Y+ FLS+ +ER + + E
Sbjct:  110 SQSTRKKKFEFEPLSTTALILEDRPSNLPAKSVHETLRHRQEYDEMVAEAKKREVKEAQRRKKLMKERIRQEENIASAMVIWNTEILPNW----DVIRVRDLWWQGLPPSIRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFSE 252          
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Match: kcng2 (potassium channel, voltage gated modifier subfamily G, member 2 [Source:Xenbase;Acc:XB-GENE-954003])

HSP 1 Score: 228.794 bits (582), Expect = 6.401e-68
Identity = 107/210 (50.95%), Postives = 147/210 (70.00%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L +IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LF   LGILR +E  L   DF  +A FLT ++PE L++  L   +  I++   N
Sbjct:  112 REASLESIKLDISRTFPNLCIFQRGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFSTALGILRLFEDILTRMDFIHIAQFLT-KLPEDLNSEDLFASIAAIQMQSRN 320          

HSP 2 Score: 63.929 bits (154), Expect = 2.597e-10
Identity = 34/96 (35.42%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  811 LISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            L+ + ++++KQ        L+ +   EE        W   ILPNW     S+ VR +WW+GIP SVR +VW   I N L +T   YD  LS+ ++R
Sbjct:    2 LVPDAQRRKKQ--------LEERCKLEESIGNAALTWNTEILPNWETMCCSRRVRDMWWQGIPPSVRGRVWSLAIGNELNITHDLYDICLSRAKDR 89          
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Match: rgs4 (regulator of G-protein signaling 4 [Source:Xenbase;Acc:XB-GENE-942771])

HSP 1 Score: 233.417 bits (594), Expect = 1.137e-67
Identity = 111/210 (52.86%), Postives = 148/210 (70.48%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF  + L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL  DF  +A FLT ++PE +++  L   +  I++  SN
Sbjct:  273 REASLELIKLDISRTFPSLYIFQKGGPYHDLLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKYFAAFEVFFEENLPKLFFHFNAYSLTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGILRLYEDILLQMDFIHIAQFLT-KLPEDITSEKLFGCIAAIQMQNSN 481          

HSP 2 Score: 123.635 bits (309), Expect = 3.578e-29
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 1
Query:  676 SNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            S  ++K   E    STT LIL DRP  LP KS +E+ RH+ EY+++++  KK+E ++    K L+K +I QEE       +W   ILPNW   +S++ VR LWW+G+P S+R KVW   I N L +T   Y+ FLS+ +ER + + E
Sbjct:  113 SQSTRKKKFEFEPLSTTALILEDRPSNLPAKSVHETLRHRQEYDEMVAEAKKREVKEAQRRKKLMKERIRQEENIASAMVIWNTEILPNWDVMRSTRRVRDLWWQGLPPSIRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFSE 259          
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Match: Tbc1d14 (TBC1 domain family, member 14 [Source:MGI Symbol;Acc:MGI:1098708])

HSP 1 Score: 231.491 bits (589), Expect = 5.609e-68
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  179 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 405          

HSP 2 Score: 103.99 bits (258), Expect = 3.638e-23
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:   30 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 156          
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Match: Tbc1d14 (TBC1 domain family, member 14 [Source:MGI Symbol;Acc:MGI:1098708])

HSP 1 Score: 231.491 bits (589), Expect = 5.609e-68
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  179 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 405          

HSP 2 Score: 103.99 bits (258), Expect = 3.638e-23
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:   30 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 156          
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Match: Tbc1d14 (TBC1 domain family, member 14 [Source:MGI Symbol;Acc:MGI:1098708])

HSP 1 Score: 234.187 bits (596), Expect = 2.477e-66
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  460 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 686          

HSP 2 Score: 105.145 bits (261), Expect = 8.008e-23
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  311 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 437          
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Match: Tbc1d14 (TBC1 domain family, member 14 [Source:MGI Symbol;Acc:MGI:1098708])

HSP 1 Score: 234.187 bits (596), Expect = 2.477e-66
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  460 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 686          

HSP 2 Score: 105.145 bits (261), Expect = 8.008e-23
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  311 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 437          
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Match: Tbc1d14 (TBC1 domain family, member 14 [Source:MGI Symbol;Acc:MGI:1098708])

HSP 1 Score: 234.187 bits (596), Expect = 2.477e-66
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  460 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 686          

HSP 2 Score: 105.145 bits (261), Expect = 8.008e-23
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  311 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 437          
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Match: sp|A6H7I8|TBC14_BOVIN (TBC1 domain family member 14 OS=Bos taurus OX=9913 GN=TBC1D14 PE=2 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 7.324e-93
Identity = 170/444 (38.29%), Postives = 233/444 (52.48%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER                             R  S G   + T D   SA D                                     R+  L  IKLD+SRTFP+L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LG+LR ++  L   DF  +A FLT ++PE L A      +  I++   N      QV   L K+   +E
Sbjct:  309 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRLEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKERW----------------------------RSFSTGGSEAETEDAGFSAAD-------------------------------------REASLELIKLDISRTFPSLCIFQQGGPYHDMLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGLLRLFQDVLTRMDFIHVAQFLT-RLPEDLPAEEFFASIASIQMQSRN--KKWAQVLTALQKDSREME 684          
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Match: sp|Q0IHY4|TBC12_XENTR (TBC1 domain family member 12 OS=Xenopus tropicalis OX=8364 GN=tbc1d12 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 8.988e-67
Identity = 117/232 (50.43%), Postives = 158/232 (68.10%), Query Frame = 1
Query: 1339 ASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKN 2034
            A + +  R+  L  IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF  + L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL  DF  +A FLT ++PE +++  L   +  I++  SN   T  QV   L+K+
Sbjct:  443 AGASLADREASLELIKLDISRTFPSLYIFQKGGPYHDLLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSMMLKYFAAFEVFFEENLPKLFFHFNAYSLTPDLYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGILRLYEDILLQMDFIHIAQFLT-KLPEDITSEKLFGCIAAIQMQNSNKKWT--QVFTSLMKD 671          

HSP 2 Score: 125.176 bits (313), Expect = 2.545e-28
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 1
Query:  676 SNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            S  ++K   E    STT LIL DRP  LP KS +E+ RH+ EY+++++  KK+E ++    K L+K +I QEE       +W   ILPNW   +S++ VR LWW+G+P S+R KVW   I N L +T   Y+ FLS+ +ER + + E
Sbjct:  287 SQSTRKKKFEFEPLSTTALILEDRPSNLPAKSVHETLRHRQEYDEMVAEAKKREVKEAQRRKKLMKERIRQEENIASAMVIWNTEILPNWDVMRSTRRVRDLWWQGLPPSIRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFSE 433          
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Match: sp|Q9P2M4|TBC14_HUMAN (TBC1 domain family member 14 OS=Homo sapiens OX=9606 GN=TBC1D14 PE=1 SV=3)

HSP 1 Score: 238.039 bits (606), Expect = 9.189e-67
Identity = 113/230 (49.13%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF  MA FLT ++PE L A  L   +  I++   N      QV   L K+   +E
Sbjct:  459 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTKMDFIHMAQFLT-RLPEDLPAEELFASIATIQMQSRN--KKWAQVLTALQKDSREME 685          

HSP 2 Score: 105.916 bits (263), Expect = 2.829e-22
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  310 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCRVEESIGNAVLTWNNEILPNWETMWCSRKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 436          
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Match: sp|Q8CGA2|TBC14_MOUSE (TBC1 domain family member 14 OS=Mus musculus OX=10090 GN=Tbc1d14 PE=1 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 1.750e-65
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  460 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADEVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 686          

HSP 2 Score: 105.145 bits (261), Expect = 5.601e-22
Identity = 51/127 (40.16%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    +  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  311 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVLQAKKRELKEAQRRRKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 437          
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Match: sp|Q5CD77|TBC14_RAT (TBC1 domain family member 14 OS=Rattus norvegicus OX=10116 GN=Tbc1d14 PE=2 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 2.138e-65
Identity = 110/230 (47.83%), Postives = 153/230 (66.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            R+  L  IKLD+SRTFPNL +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI F+N+L  PC  AF+ +D      Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A R+WD+FCRDGE  LFR  LGIL+ +E  L   DF   A FLT ++PE L A  +   +  +++   N      QV + L K+   +E
Sbjct:  460 REASLELIKLDISRTFPNLCIFQQGGPYHDMLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFSNLLNKPCQMAFFRVDHGLMLTYFAAFEVFFEENLPKLFAHFKKNNLTADIYLIDWIFTLYSKSLPLDLACRIWDVFCRDGEEFLFRTALGILKLFEDILTRMDFIHSAQFLT-RLPEDLPADDVFAAISTVQMQSRN--KKWAQVLSALQKDSREME 686          

HSP 2 Score: 106.686 bits (265), Expect = 1.914e-22
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+++H+ +Y +++   KK+E ++    K  L+ +   EE        W N ILPNW     S+ VR LWW+GIP SVR KVW   I N L +T   +D  L++ +ER
Sbjct:  311 STTALILEDRPANLPAKPAEEAQKHRQQYEEMVVQAKKRELKEAQRRKKQLEERCKVEESIGNAVLTWNNEILPNWETMWCSKKVRDLWWQGIPPSVRGKVWSLAIGNELNITHELFDICLARAKER 437          
BLAST of TBC1 domain family member 12 vs. TrEMBL
Match: K1Q208 (TBC1 domain family member 14 OS=Crassostrea gigas OX=29159 GN=CGI_10021947 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 1.194e-97
Identity = 178/452 (39.38%), Postives = 260/452 (57.52%), Query Frame = 1
Query:  679 NKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADL---------RSSAYDLYIS----------ETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKL 1977
            N+ KKS IE  + STT LIL +RP  LP K   E+ RH+ +Y  +I   KKKE++     K  ++ ++ QE++  QL+  W N ILPNW   + ++  R +WW+G+PT+VR KVW+  I N L LT   Y+    + ++RI              K+T  S   +  D + H +      T D+         R   + L I           E  +   +     +  S   S +  S       R+  +  IKLD+SRTFP L +FQ GGP+HDLL+ LLGAYACYRPD+GYVQGMSF+AA+L+L M+V DAFICFAN+L  PC  AF+ +DE+    Y ++++     ++P L +HF +  +  +I+L DW+F++YS++LPLD A RVWD+FCRDGE  LFR  LGIL+ YE  L++ +F  +A FLT ++PE +S+  L + +  I +
Sbjct:  333 NRPKKSDIE--VMSTTALILENRPQNLPTKDPEEAERHRLQYEAMIEAAKKKEQRDLKMKKKHMQQQLKQEDQMLQLSKRWANDILPNWELTKRTKKTRDMWWQGLPTNVRGKVWKLAIGNDLNLTPELYEICACRAEDRI--------------KQTCDSDTASVSDCKSH-DAKRTKKTRDMWWQGLPTNVRGKVWKLAIGNDLNLTPELYEICACRAEDRIKQTCDSDTASVSDCSPEVSTSNREASVELIKLDISRTFPQLCIFQKGGPYHDLLHSLLGAYACYRPDVGYVQGMSFIAAVLLLNMDVADAFICFANLLNRPCQVAFFRIDEAMMKFYFQTYEEFFKENMPTLFRHFSKTNVTPDIYLIDWIFSLYSKSLPLDIACRVWDIFCRDGEEFLFRTALGILKLYEDILIHQEFILLAQFLT-KLPEDISSDSLFKSIELINM 766          
BLAST of TBC1 domain family member 12 vs. TrEMBL
Match: A0A0L8I5D3 (Rab-GAP TBC domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22035953mg PE=4 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 2.338e-97
Identity = 172/431 (39.91%), Postives = 241/431 (55.92%), Query Frame = 1
Query:  685 SKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKL 1977
            + ++  +  + STT LIL +RP  LP K+  E R+H+ EY Q++   KKKE++     K  L+ ++  EE+       W + +LPNW   + ++  R LWW G+P  VR KVW+  I N L +T+  ++  L++ ++RI+                          + + SNG+    T+DL SS                                 AS D+         IKLDVSRTFP   +FQ GGP+HDLL+ LLGAYACYRPD+GYVQGMSFLAA+L+L M V DAFICFAN+L  PC  AF+ +DE     Y +++   L  ++PQL  HF +  L  +I++ DW+FTI+SR+LPLD A RVWD+FCRDGE  LFR  LGIL  Y+  LL  DF  +A FLT ++PE +S+  L   ++ I+L
Sbjct:    3 AARARKDIEVMSTTALILENRPGHLPSKAPEEERKHKQEYEQMVEAAKKKEQKDIRQKKKHLQLQLKHEEQLVAAAKTWNSEVLPNWEITKQTKRARELWWSGLPPCVRGKVWKLAIGNELNITEELFEICLNRAKDRIKM-------------------------LSEESNGSS-ENTSDLPSS-------------------------------KEASVDL---------IKLDVSRTFPQFCIFQKGGPYHDLLHSLLGAYACYRPDVGYVQGMSFLAAVLLLNMEVADAFICFANLLNGPCQVAFFRVDEGMMKSYFDTYDEFLLENMPQLHHHFGRQNLTPDIYIIDWIFTIFSRSLPLDVACRVWDVFCRDGEEFLFRTALGILHLYQNLLLEMDFIHLAQFLT-KLPEDISSDQLFRSVQAIRL 366          
BLAST of TBC1 domain family member 12 vs. TrEMBL
Match: A0A2D0S860 (TBC1 domain family member 12 isoform X1 OS=Ictalurus punctatus OX=7998 GN=tbc1d12 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 1.194e-96
Identity = 180/493 (36.51%), Postives = 264/493 (53.55%), Query Frame = 1
Query:  565 ANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNS 2043
            +N    + + T + +S+ + E+K+   +       ++  + ++ ++E    STT LIL DRP  LP K   E++RH+ EY+++++  K++E ++    K  +K +  QE+       VW   +LPNW   + ++ V+ LWW+G+P +VR KVW   I N L +T   Y+ FLS+ +ER   + E                            G+ +   AD  +S  D                                     R+  L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y   F++    +LP+L  HF    L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL+ DF  MA FLT ++PE +SA  L   +    +  SN      QV + L+K+K S
Sbjct:  274 SNPGNLTSVSTPNLLSAGEYEAKAGKGAHSP----SQPAQGRRKNLEFEPLSTTALILEDRPANLPAKPEEEAQRHRQEYDEMVAEAKRRELKEAQKKKQQMKERFKQEDSIVNAMVVWNTEVLPNWDSMRGTRRVKDLWWQGLPPNVRGKVWSLAIGNELNITPELYEIFLSRAKERWRSFRE---------------------------TGSEVEAEADSGASLAD-------------------------------------RESSLDLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHELMLKYFAVFEVFFEENLPRLFSHFQSSNLTPDLYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTALGILRLYEDVLLHMDFIHMAQFLT-RLPEHVSAERLFSSIHNTHMTSSN--RKWPQVFSALMKDKES 695          
BLAST of TBC1 domain family member 12 vs. TrEMBL
Match: A0A5N5MK32 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00032520 PE=4 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 1.319e-96
Identity = 180/493 (36.51%), Postives = 263/493 (53.35%), Query Frame = 1
Query:  565 ANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNS 2043
            +N    + + T + +S+ + E+K+   +    L      + ++ ++E    STT LIL DRP  LP K   E++RH+ EY+++++  K++E ++    K  +K +  QE+       VW   +LPNW   + ++ V+ LWW+G+P +VR KVW   I N L +T   Y+ FLS+ +ER + + E                            G+ +   AD  +S  D                                     R+  L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y   F++    +LP+L  HF    L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  LL+ DF  MA FLT ++PE + A  L   +    +  SN      QV + L+K+K S
Sbjct:  341 SNPGNLTSVSTPNLLSAGEYEAKAGKGAHSPSL----PTQGRRKNLEFEPLSTTALILEDRPANLPAKPEEEAQRHRQEYDEMVAEAKRREMKEAQKKKQQMKERFKQEDSIVNAMVVWNTEVLPNWDSMRGTRRVKDLWWQGLPPNVRGKVWSLAIGNELNITPELYEIFLSRAKERWKSFRE---------------------------TGSEVEAEADSGASLAD-------------------------------------RESSLDLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAVFEVFFEENLPRLFSHFQSSNLTPDLYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTALGILRLYEDVLLHMDFIHMAQFLT-RLPEHVPAERLFSAIHNTHMTSSN--RKWPQVFSALMKDKES 762          
BLAST of TBC1 domain family member 12 vs. TrEMBL
Match: A0A5A9PVW3 (TBC1 domain family member 12 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti018700 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.327e-96
Identity = 177/439 (40.32%), Postives = 239/439 (54.44%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKN 2034
            STT LIL DRP  LP KS  E++RH+ EY++++  +KK+E +     K  +K +  QE+       VW N ILPNW + + ++ VR LWW+G+P +VR KVW   I N L +T   YD FLS+                   +E   S  E  C++    +G  +   AD  SS                                            L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L  HF  + L  ++FL DW+FT+YS++LPLD A RVWD+FCRDGE  LFR GLGILR YE  LL  DF  +A FL+ ++PE      L   +    +   N   T  QV N L+K+
Sbjct:  364 STTALILEDRPANLPAKSEEEAQRHRQEYDEMVVEMKKRELKDAQKKKKQMKERFKQEDSIANAMLVWNNDILPNWENMRGTRRVRDLWWQGLPPNVRGKVWSLAIGNELNITSDLYDIFLSR------------------ARERWRSIRETGCELELDDSGASV---ADRESS--------------------------------------------LDVIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHELMLKYFGAFEVFFEENLPRLFNHFKSYNLTPDLFLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTGLGILRLYEEVLLQMDFIHIAQFLS-RLPEDTHPDRLFSCISNTHMLSGNRKWT--QVFNILVKD 734          
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Match: tbc1d12b (TBC1 domain family, member 12b [Source:ZFIN;Acc:ZDB-GENE-121214-108])

HSP 1 Score: 238.424 bits (607), Expect = 1.932e-70
Identity = 119/229 (51.97%), Postives = 158/229 (69.00%), Query Frame = 1
Query: 1360 RQIL---LNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNK 2037
            RQI+   L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L  HF    L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR GLGILR YE  LL  DF  +A FLT ++P+ +SA  L   +   ++  SN   T  QV + L+K+K
Sbjct:  194 RQIVKSSLDLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHELMLKYFAAFEVFFEENLPKLFSHFQSSNLTPDLYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTGLGILRLYEEVLLGMDFIHIAQFLT-RLPDDVSADRLFSCIACTQMTSSNRKWT--QVFSSLMKDK 419          

HSP 2 Score: 110.538 bits (275), Expect = 2.660e-25
Identity = 51/129 (39.53%), Postives = 79/129 (61.24%), Query Frame = 1
Query:  670 NRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLT 1056
            ++S + ++ ++E    STT LIL DRP  LP KS  E++RH+ EY+++++  KK+E ++    K  +K +  QEE       VW + ILPNW   + ++ VR LWW+G+P +VR KVW   I N L +T
Sbjct:   57 SQSAQGRRKNLEFEPLSTTALILEDRPANLPAKSEEEAQRHRQEYDEMVAEAKKREMKEAQKKKQQMKDRFRQEESIANAMVVWNSEILPNWESMRGTRRVRDLWWQGLPPNVRGKVWSLAIGNELNIT 185          
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Match: ENSAMXT00000009273.2 (TBC1 domain family member 12-like [Source:NCBI gene;Acc:103024809])

HSP 1 Score: 233.802 bits (595), Expect = 4.031e-65
Identity = 114/225 (50.67%), Postives = 152/225 (67.56%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKN 2034
            R+  L+ IKLD+ RTFP+L +FQ GGP+HDLL+ +LGAY CYRPD+GYVQGMSF+AA+LIL +   DAFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L QHF  + L  + +L DW+FT+YS++LPLD A RVWD+FCRDGE ALFR GLGILR Y+  LL  DF   A FL+ ++PE+  A  L   +    +  +N      QV + LIK+
Sbjct:  650 RESSLDLIKLDIFRTFPSLYIFQKGGPYHDLLHSVLGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQMAFFRVDHDLMLKYFAAFEVFFEENLPKLFQHFQNNSLTPDFYLIDWIFTLYSKSLPLDVACRVWDLFCRDGEEALFRTGLGILRLYQDVLLQMDFIHSAQFLS-RLPENTPAHTLFNCIANTHMISNN--RRWNQVFSALIKD 871          

HSP 2 Score: 119.783 bits (299), Expect = 1.994e-27
Identity = 55/143 (38.46%), Postives = 86/143 (60.14%), Query Frame = 1
Query:  688 KKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            ++ ++E    STT LIL DRP  LP KS  E++RH+ EYN++++  K++E ++    K  +K +  QEE       +W   +LPNW   ++++ VR LWW+G+P SVR KVW   I N L +T   Y+ FLS+ +E+   + E
Sbjct:  491 RRKNLEFEPSSTTALILEDRPANLPAKSEEEAQRHRQEYNEMVAGAKRREMKEAQRKKRQMKERYRQEENIAHAMVIWNTEVLPNWESMKNTRRVRELWWQGLPPSVRGKVWSLAIGNELNITPELYEIFLSRAKEKWRSFNE 633          
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 160.999 bits (406), Expect = 4.716e-43
Identity = 88/213 (41.31%), Postives = 120/213 (56.34%), Query Frame = 1
Query: 1339 ASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKL 1977
             SS  D R+  L  IKLD+SRTFP+L +FQ GGP+HD+L+ +LGAY CYRPD+GY+  +++ AA                                  F V+ E        +LP+L  HF  + L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  L + DF   A FLT ++PE ++   L   +  + +
Sbjct:  179 GSSHAD-REASLELIKLDISRTFPSLCIFQKGGPYHDVLHSILGAYTCYRPDVGYM--LTYFAA----------------------------------FEVFFEE-------NLPKLFAHFKSNNLTPDIYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTALGILRLYEDVLTHMDFIHNAQFLT-RLPEHINTHTLFSSISAVSM 346          

HSP 2 Score: 101.679 bits (252), Expect = 1.118e-22
Identity = 47/113 (41.59%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLT 1056
            STT LIL  RP  LP K   E+ +HQ +Y ++++  KK+E ++    K  L+ ++ QEE        W   ILPNW   +SS+ VR LWW+G+P SVR +VW   I N L +T
Sbjct:   63 STTALILEQRPPNLPAKPAEEAEKHQQQYEEMVAQAKKRELKEAQKRKKQLEDRVKQEESIGNAALCWSQEILPNWTTTRSSKRVRELWWQGVPPSVRGRVWSLAIGNDLNIT 175          
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 162.54 bits (410), Expect = 6.342e-42
Identity = 88/213 (41.31%), Postives = 120/213 (56.34%), Query Frame = 1
Query: 1339 ASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKL 1977
             SS  D R+  L  IKLD+SRTFP+L +FQ GGP+HD+L+ +LGAY CYRPD+GY+  +++ AA                                  F V+ E        +LP+L  HF  + L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LGILR YE  L + DF   A FLT ++PE ++   L   +  + +
Sbjct:  400 GSSHAD-REASLELIKLDISRTFPSLCIFQKGGPYHDVLHSILGAYTCYRPDVGYM--LTYFAA----------------------------------FEVFFEE-------NLPKLFAHFKSNNLTPDIYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEEFLFRTALGILRLYEDVLTHMDFIHNAQFLT-RLPEHINTHTLFSSISAVSM 567          

HSP 2 Score: 102.834 bits (255), Expect = 2.309e-22
Identity = 47/113 (41.59%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLT 1056
            STT LIL  RP  LP K   E+ +HQ +Y ++++  KK+E ++    K  L+ ++ QEE        W   ILPNW   +SS+ VR LWW+G+P SVR +VW   I N L +T
Sbjct:  284 STTALILEQRPPNLPAKPAEEAEKHQQQYEEMVAQAKKRELKEAQKRKKQLEDRVKQEESIGNAALCWSQEILPNWTTTRSSKRVRELWWQGVPPSVRGRVWSLAIGNDLNIT 396          
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Match: tbc1d10ab (TBC1 domain family, member 10Ab [Source:ZFIN;Acc:ZDB-GENE-081105-145])

HSP 1 Score: 108.612 bits (270), Expect = 5.882e-25
Identity = 67/222 (30.18%), Postives = 114/222 (51.35%), Query Frame = 1
Query: 1372 LNTIKLDVSRTFPNLNLF-QNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAFYALDESEFTVYLESFKLS---LFTHL----PQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCY-----EMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNF 1992
            ++ I+ D+ R FP   +F   GG     L+++L AY+ YRP+ GY Q  + +AA+L++ M  E+AF C   I E  LP +          ++  LE+ +L    LF  L    P   +H  +HK+D  +++ +W   ++SR LP  + LRVWDMF  +G   +FR GL +L+C      ++++    +E M   L    P  +    L+ E+ E+ + + + 
Sbjct:   52 VDVIEKDLHRQFPFHEMFVARGGHGQQDLFRVLKAYSLYRPEEGYCQAQAPIAAVLLMHMPAEEAFWCLVQICEKYLPGY----------YSAGLEAIQLDGEILFALLKRVSPVAHRHLKKHKIDPILYMTEWFMCVFSRTLPWASVLRVWDMFFCEGVKIVFRVGLVLLKCMLGSQEKLKVCQGQYETME-LLRAIEPRYMQEGFLIREILELPVSERDI 262          
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Match: tbc1d12b (TBC1 domain family, member 12b [Source:ZFIN;Acc:ZDB-GENE-121214-108])

HSP 1 Score: 264.233 bits (674), Expect = 2.033e-80
Identity = 174/487 (35.73%), Postives = 246/487 (50.51%), Query Frame = 1
Query:  622 KESKSNFISQISQLVFNRSNKSKKSSI-ETPLK--------STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTL--KLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            KES      +I Q    R  KS+K++  +TP +        STT LIL  RP  LP K   E +RHQ+ Y +++S  KK+E ++    K L++ +  +E+       VW   ILPNW    +S+ VR L             W   IP ++  K+      N L+   E  E +L    +K                  R +S+    S   D+  +  D                                     R+  L  I LD+SRTFP+L +FQ  GP+HD+L  +LGAY CYRPD+GYVQGMSFLAA+L+L ++V DAFI FAN+L  PC  AF+ +D      Y E+F+L    +LP+L  HF    L  +++L DW+FT+YS+ALPLD A RVWD+FCRDGE  LFR  LGILR Y+  LL++DF + A FLT ++P++++A  L   +  I +   N      QV + L K++   E
Sbjct:   40 KESPQKDPKKIQQDYEARIAKSEKAATGQTPSRKDLDFEPLSTTALILEQRPAHLPAKPVEEMQRHQELYAEMVSQAKKREAREAQRQKQLMQERCKKEDSIISTLAVWNTEILPNWEQTCNSRKVRDL-------------WWQGIPPSIRGKIWSLAIGNELNITPELYEIFLSRAKEK-----------------WRSYSDSGSDSENGDVGCNGAD-------------------------------------RESSLELISLDISRTFPSLCIFQKRGPYHDILQSVLGAYTCYRPDVGYVQGMSFLAAVLLLNLDVADAFITFANLLNKPCQMAFFRVDHPLMLKYFEAFELFFEENLPRLFSHFKTSNLTPDLYLIDWIFTLYSKALPLDVACRVWDVFCRDGEEFLFRTALGILRLYQDVLLSTDFLQGAQFLT-RLPDNIAAQPLFAAIGTINM--QNKHGKWSQVFSALQKDRRDSE 456          
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Match: tbc1d12b (TBC1 domain family, member 12b [Source:ZFIN;Acc:ZDB-GENE-121214-108])

HSP 1 Score: 262.692 bits (670), Expect = 5.001e-80
Identity = 173/487 (35.52%), Postives = 246/487 (50.51%), Query Frame = 1
Query:  622 KESKSNFISQISQLVFNRSNKSKKSSI-ETPLK--------STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTL--KLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVE 2049
            KES      +I Q    R  KS+K++  +TP +        STT LIL  RP  LP K   E +RHQ+ Y +++S  KK+E ++    K L++ +  +E+       VW   ILPNW    +S+ VR              +W   IP ++  K+      N L+   E  E +L    +K                  R +S+    S   D+  +  D                                     R+  L  I LD+SRTFP+L +FQ  GP+HD+L  +LGAY CYRPD+GYVQGMSFLAA+L+L ++V DAFI FAN+L  PC  AF+ +D      Y E+F+L    +LP+L  HF    L  +++L DW+FT+YS+ALPLD A RVWD+FCRDGE  LFR  LGILR Y+  LL++DF + A FLT ++P++++A  L   +  I +   N      QV + L K++   E
Sbjct:   30 KESPQKDPKKIQQDYEARIAKSEKAATGQTPSRKDLDFEPLSTTALILEQRPAHLPAKPVEEMQRHQELYAEMVSQAKKREAREAQRQKQLMQERCKKEDSIISTLAVWNTEILPNWEQTCNSRKVRD-------------LWWQGIPPSIRGKIWSLAIGNELNITPELYEIFLSRAKEK-----------------WRSYSDSGSDSENGDVGCNGAD-------------------------------------RESSLELISLDISRTFPSLCIFQKRGPYHDILQSVLGAYTCYRPDVGYVQGMSFLAAVLLLNLDVADAFITFANLLNKPCQMAFFRVDHPLMLKYFEAFELFFEENLPRLFSHFKTSNLTPDLYLIDWIFTLYSKALPLDVACRVWDVFCRDGEEFLFRTALGILRLYQDVLLSTDFLQGAQFLT-RLPDNIAAQPLFAAIGTINM--QNKHGKWSQVFSALQKDRRDSE 446          
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Match: tbc1d14 (TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB-GENE-030131-6136])

HSP 1 Score: 231.106 bits (588), Expect = 2.772e-70
Identity = 111/210 (52.86%), Postives = 144/210 (68.57%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+L+L M+  DAFI FAN+L  PC  AF+ +D      Y  +F++     LPQL  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  L IL  Y+  LL+ DF  MA  LT ++PE L AS L   +  I+L   N
Sbjct:   39 REASLELIKLDISRTFPTLCIFQKGGPYHDVLHSVLGAYTCYRPDVGYVQGMSFIAAVLLLNMDTADAFIAFANLLNRPCQMAFFRVDHGLMLAYFAAFEVFFEETLPQLFSHFKKNNLTPDIYLIDWIFTLYSKSLPLDVACRVWDIFCRDGEEFLFRTALAILHLYDDVLLHMDFIHMAQLLT-RLPEDLQASELFSSISAIQLQSRN 247          
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Match: tbc1d12b (TBC1 domain family, member 12b [Source:ZFIN;Acc:ZDB-GENE-121214-108])

HSP 1 Score: 205.297 bits (521), Expect = 1.936e-61
Identity = 105/194 (54.12%), Postives = 139/194 (71.65%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCD---WLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPES 1932
            R+  L  I LD+SRTFP+L +FQ  GP+HD+L  +LGAY CYRPD+GYVQGMSFLAA+L+L ++V DAFI FAN+L  PC  AF+ +D      Y E+F+L    +LP+L  HF    L  +++L D   W+FT+YS+ALPLD A RVWD+FCRDGE  LFR  LGILR Y+  LL++DF + A FLT ++P++
Sbjct:   33 RESSLELISLDISRTFPSLCIFQKRGPYHDILQSVLGAYTCYRPDVGYVQGMSFLAAVLLLNLDVADAFITFANLLNKPCQMAFFRVDHPLMLKYFEAFELFFEENLPRLFSHFKTSNLTPDLYLIDWYYWIFTLYSKALPLDVACRVWDVFCRDGEEFLFRTALGILRLYQDVLLSTDFLQGAQFLT-RLPDN 225          
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002477.1 (pep scaffold:Pmarinus_7.0:GL478770:27892:36885:-1 gene:ENSPMAG00000002257.1 transcript:ENSPMAT00000002477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 9.522e-41
Identity = 110/328 (33.54%), Postives = 157/328 (47.87%), Query Frame = 1
Query:  961 SQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISP--------TADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQ 1920
            S+ VR LWWEGIP SVR  VW+H I N L +T   Y+ FL+       RY              +S K++     +K   G  ++P        T D+ S+  DL+I +                +NI  ++ +       R +L        +R   N+     GGP+HD L  +LGAYA YRPD+GY    S+LAA+L+L M+  +AF+  ANIL  PC  AF     ++   YL +F +    +LP L  HF +  L  +++L DW+  + +  LPL+ A R  D++ RDGE   FRA LG L      LL  D E  A  L  +
Sbjct:   11 SRKVRSLWWEGIPPSVRGWVWQHSIGNQLNITPELYEIFLA-------RY-----GFHFRGINALSQKLQG----KKIRLGASVAPGNPQLEAMTLDILSTFPDLHIFQK-------------EISNIFPSRENCPPAGHERTVL--------ARNLQNIPQVSQGGPYHDSLRNVLGAYATYRPDVGYAPMTSWLAAMLLLYMDAVEAFVVLANILNQPCMLAFALPRPNQVKRYLATFDVFFEENLPGLFAHFKKIGLLPDVYLGDWVLVLLAHVLPLECACRARDVWFRDGEEFAFRAALGRLSLLADSLLTLDKEGAAALLLAR 301          
BLAST of TBC1 domain family member 12 vs. Ensembl Yeast
Match: MDR1 (Cytoplasmic GTPase-activating protein; activates Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function [Source:SGD;Acc:S000003332])

HSP 1 Score: 82.8037 bits (203), Expect = 1.006e-16
Identity = 48/183 (26.23%), Postives = 95/183 (51.91%), Query Frame = 1
Query: 1372 LNTIKLDVSRTFPNLNLFQNG-GPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILEL--PCHHA--FYA--LDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEM 1899
            ++ I+ D+ R+ P  + +Q   G     L  +L AY+   PD+GY Q M+ + A  ++ M+ E AF C  N+ ++  P +++   Y   LD+  F  ++E         +P L ++  QH + +++    W  +++  ++PL+ A+R+ D+F  +G   LF+  L +L+     +L +D + M
Sbjct:  286 IDEIEKDLKRSLPEYSAYQTEEGIQR--LRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFMSEEQAFWCLCNLCDIYVPGYYSKTMYGTLLDQRVFESFVED-------RMPVLWEYILQHDIQLSVVSLPWFLSLFFTSMPLEYAVRIMDIFFMNGSITLFQVALAVLKINADDILQADDDGM 459          
BLAST of TBC1 domain family member 12 vs. Ensembl Yeast
Match: GYP5 (GTPase-activating protein (GAP) for yeast Rab family members; involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; GYP5 has a paralog, GYL1, that arose from the whole genome duplication [Source:SGD;Acc:S000006170])

HSP 1 Score: 70.8626 bits (172), Expect = 4.869e-13
Identity = 41/160 (25.62%), Postives = 75/160 (46.88%), Query Frame = 1
Query: 1453 LYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYAL---DESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQM 1923
            LY+++  Y+ Y PD+GY QGM F+AA L++  N E+    F  ++ L  ++    L         + L  F   L  H P L     +  +   ++   W  T ++   PL+  LR++D+   +G   L +  + ++   E  L+   F+E+  FL  ++
Sbjct:  508 LYKVIKVYSVYDPDVGYTQGMGFIAAPLLI--NCENEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLVKLRFDELLDFLKDEL 665          
BLAST of TBC1 domain family member 12 vs. Ensembl Yeast
Match: MSB4 (GTPase-activating protein of the Ras superfamily; acts primarily on Sec4p, localizes to the bud site and bud tip; msb3 msb4 double mutation causes defects in secretion and actin organization; similar to the TBC-domain Tre2 oncogene; MSB4 has a paralog, MSB3, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null mutant [Source:SGD;Acc:S000005472])

HSP 1 Score: 69.707 bits (169), Expect = 7.240e-13
Identity = 58/207 (28.02%), Postives = 90/207 (43.48%), Query Frame = 1
Query: 1372 LNTIKLDVSRTFP-NLNL----FQNGGPHH-DLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNI-------------FLC----------DWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEM 1899
            +  I+ D+ RTFP N++     FQNG P     L ++L A++ Y   IGY Q M+FL  +L+L M  E AF     I    LP     Y  D     V      L +  +LP++  H     ++ N              +LC           W  + +   +P++T LR+WD    +    LF+  LGIL+  E + L S  +++
Sbjct:  191 MEAIERDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFMEEEKAFWMLVIITGKYLP---GVYESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNGNGSTDQISGPASGEEYLCRLPTLTLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVALGILKLSESEFLESKSQKL 394          
BLAST of TBC1 domain family member 12 vs. Ensembl Yeast
Match: MSB3 (Rab GTPase-activating protein; regulates endocytosis via inactivation of Vps21p at endosomes and vacuole fusion via inactivation of Ypt7p at vacuoles; also acts on Ypt52p and Sec4p; localizes to plasma membrane, sites of polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; similar to TBC-domain Tre2 oncogene; MSB3 has a paralog, MSB4, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null [Source:SGD;Acc:S000005237])

HSP 1 Score: 53.5286 bits (127), Expect = 9.105e-8
Identity = 53/203 (26.11%), Postives = 92/203 (45.32%), Query Frame = 1
Query: 1372 LNTIKLDVSRTFPNLNLFQN------GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAF----YALDESEFTVYLESFKLSLFTHL-PQLAQHFFQHK------------LDVNIFL----------CDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQL 1875
            L+ I+ D++RTFP+   FQ+      G P    L ++L A++ Y P IGY Q M+FLA +L+L ++ E AF     I    LP  H        +D+    + ++ +   +++++ P +  H   +K            +  N FL            W  + +   +P++T LR+WD    +    LF+  L +L+  E  L
Sbjct:  273 LDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVIITSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDL 475          
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Match: EDO36872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHD4])

HSP 1 Score: 244.202 bits (622), Expect = 2.407e-73
Identity = 148/433 (34.18%), Postives = 221/433 (51.04%), Query Frame = 1
Query:  688 KKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREK-VWRHCIPNTL--KLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKL 1977
            K++S   P  STT LI  +RP  LP KS  E ++H+  Y  +++  KKKE +     +  +K K  QE+       VW + ILPN              WE +  S + K +W   +P ++  K+ K    N L    E  + +     +K + T+       E+                A+L ++ Y + +                            SS+  +  I+L     DVSRTFP+L +FQ GGP HD+L+ +LGAY CYRPD+GYVQGMSF+AA+L+L +   DAFI FAN+L  PC  AF+ +D      Y  +F++ L   L +L +HF       +++L DW+FT++S++LPLD A RVWD+FCRDG+  LFR  LGIL+ Y+  LL  DF  +  FLT ++P+ +  + L + +  I L
Sbjct:   43 KRNSAAVP-SSTTALIFENRPSNLPAKSAAEEKKHRQMYEAMVAEAKKKELRDKKRQEKEMKQKSKQEKVISSAACVWTSEILPN--------------WESMKHSRKAKELWWQGLPPSVRGKIWKLAIGNDLQITYELFDIFQSHAYEKLMVTRNNRKKNKESGS-------------VAELPTNDYPMSV---------------------------VSSEHKVELIML-----DVSRTFPSLCIFQEGGPFHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLLLNLEPPDAFISFANLLNKPCQLAFFRVDHPMMKAYFATFEILLSEFLNKLHEHFHHESFSPDMYLIDWIFTLFSKSLPLDVACRVWDVFCRDGDDFLFRTALGILKFYQDDLLEMDFIHLGQFLT-KLPDDIPVNNLFDSISSINL 414          
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Match: EDO34649 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS6])

HSP 1 Score: 105.916 bits (263), Expect = 3.948e-24
Identity = 54/184 (29.35%), Postives = 93/184 (50.54%), Query Frame = 1
Query: 1381 IKLDVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            IK D++RTFP+ + F++  G     L+ ++ AY+ Y  ++GY QG +F+  +L++ M  E+AF  F  +++       +    +E  + +   +  L   LP+L  HF        ++   W  T+++   PL+ A RV DMF  +G   LFR    IL   + +LL  D E M  +   +MP+
Sbjct:   61 IKRDIARTFPDHSFFKDKDGIGQGTLFNVIKAYSIYDKEVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRMREIFKPTMAELGLCMFQLENLLQESLPELYAHFQAQGFHTAMYASSWFLTLFASVFPLNAAFRVMDMFISEGRDGLFRIIFAILSMGQEELLERDMEGMLKYFQKEMPD 244          
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Match: EDO39400 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA57])

HSP 1 Score: 95.9005 bits (237), Expect = 1.167e-21
Identity = 54/164 (32.93%), Postives = 84/164 (51.22%), Query Frame = 1
Query: 1375 NTIKLDVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILR 1857
            NTI+ D+ R FP    F + GG     L+++L AY+ Y    GY Q M+ + A+L++ M  E+AF C   I    LP    +Y        +    F   L   +P +++H  QH +D  +++ +W   + +R LP  T LRVWDMF  +G   LFR  + I++
Sbjct:  130 NTIEKDLCRVFPYHEQFTDTGGQGQKDLFRVLKAYSLYDSHTGYCQAMAPVVAVLLMHMTAEEAFWCLVMICSKYLP---GYYGPKLEAIQLDGAIFGGLLSKTVPHISKHMKQHHIDPLMYMTEWYMCLLARNLPFATVLRVWDMFFCEGIKVLFRTTIAIMK 290          
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Match: EDO34047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQE4])

HSP 1 Score: 88.5817 bits (218), Expect = 2.350e-19
Identity = 53/188 (28.19%), Postives = 90/188 (47.87%), Query Frame = 1
Query: 1354 DIRQILLNTIKLDVSRTFP-NLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNS-DFEEMAGFL 1911
            ++  I+ N+I  D+ RTFP N+    +       L  +L AYA + P IGY QG++++A +L+L++  E+        + +     +YA D     V  E     +   LP L  H     L  +IF   W   +Y   LP++T LR+WD    +G   L R  + +L  ++ +LL + DF ++   +
Sbjct:   92 ELDDIVRNSILTDIDRTFPENIYFGSSSDSLKQKLKNILVAYAVHNPKIGYCQGLNYIAGLLLLIIKTEEPAFWLLEAMMMKRLPDYYAKDMMGLQVEQEVLSELVKIKLPTLHHHIESIGLSYSIFSTKWFICLYIDVLPVETVLRIWDSLFYEGSKILLRVAITLLALHQDKLLAAKDFPQLCNVM 279          
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Match: EDO34083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQA7])

HSP 1 Score: 92.4337 bits (228), Expect = 2.734e-19
Identity = 54/187 (28.88%), Postives = 95/187 (50.80%), Query Frame = 1
Query: 1390 DVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDE---SEFTV-YLESFKLSLFTH--LPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPE 1929
            D+ RTFP  + F++ GG   + LY++  AY+ Y  ++GY QG+SF  A+L+L M  E AF     I+      + Y L E   ++F + +L+ ++L       +P L  HF  + ++ +++   W  T+++   PL     + D+   +G   +F+  L +L+     LL  DFE +  F    MP+
Sbjct:  443 DIHRTFPAHDYFKDSGGEGQEALYKISKAYSVYDEEVGYCQGLSFFIAVLLLHMPEEQAFAVLVKIM------SAYGLREVFRNDFQLLHLKFYQLERMIEDSMPDLFSHFQHNNVEAHMYASQWFLTMFTARFPLPMVYSIMDLILCEGTHVIFQVALALLKDARKDLLQMDFEGILKFFRVSMPK 623          
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Match: tbc1d14 (TBC1 domain family member 14 [Source:NCBI gene;Acc:101164257])

HSP 1 Score: 234.572 bits (597), Expect = 1.051e-66
Identity = 107/210 (50.95%), Postives = 146/210 (69.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LG+LR Y+  L   DF  MA FLT ++P+ + A  L + +  + +   N
Sbjct:  434 RESSLELIKLDISRTFPQLCIFQQGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFFRVDHSLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGVLRLYQDVLTCMDFIHMAQFLT-RLPDLIPAEELFQHIAAVHMSSRN 642          

HSP 2 Score: 90.5077 bits (223), Expect = 2.074e-18
Identity = 47/127 (37.01%), Postives = 68/127 (53.54%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQER 1098
            STT LIL DRP  LP K   E+ +H+ +Y ++++  KK+E ++    K  L+ +   EE       +W   IL   F  Q S   R LWW+GIP SVR KVW   + N L +T   Y   L++ +E+
Sbjct:  290 STTALILEDRPANLPAKPAEEALKHRQQYEEMVAQAKKRELKEAQRRKKKLEDRCKHEENIGTAAQIWNQEILICRFFNQIS---RDLWWQGIPPSVRGKVWSLAVGNELNITHELYSICLARAREK 413          
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Match: tbc1d14 (TBC1 domain family member 14 [Source:NCBI gene;Acc:101164257])

HSP 1 Score: 234.958 bits (598), Expect = 1.438e-66
Identity = 107/210 (50.95%), Postives = 146/210 (69.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LG+LR Y+  L   DF  MA FLT ++P+ + A  L + +  + +   N
Sbjct:  479 RESSLELIKLDISRTFPQLCIFQQGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFFRVDHSLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGVLRLYQDVLTCMDFIHMAQFLT-RLPDLIPAEELFQHIAAVHMSSRN 687          

HSP 2 Score: 105.916 bits (263), Expect = 4.269e-23
Identity = 56/158 (35.44%), Postives = 83/158 (52.53%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRK 1191
            STT LIL DRP  LP K   E+ +H+ +Y ++++  KK+E ++    K  L+ +   EE       +W   ILPNW    +S+ VR LWW+GIP SVR KVW   + N L +T   Y   L++ +E+      P    E P     SS  E++ ++ K
Sbjct:  331 STTALILEDRPANLPAKPAEEALKHRQQYEEMVAQAKKRELKEAQRRKKKLEDRCKHEENIGTAAQIWNQEILPNWSTMCTSRRVRDLWWQGIPPSVRGKVWSLAVGNELNITHELYSICLARAREKWRTTAAPSTDPE-PEDALGSSDRESSLELIK 487          
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Match: tbc1d14 (TBC1 domain family member 14 [Source:NCBI gene;Acc:101164257])

HSP 1 Score: 234.958 bits (598), Expect = 1.438e-66
Identity = 107/210 (50.95%), Postives = 146/210 (69.52%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSN 1989
            R+  L  IKLD+SRTFP L +FQ GGP+HD+L+ +LGAY CYRPD+GYVQGMSF+AA+LIL ++  DAFI FAN+L  PC  AF+ +D S    Y  +F++    +LP+L  HF ++ L  +I+L DW+FT+YS++LPLD A RVWD+FCRDGE  LFR  LG+LR Y+  L   DF  MA FLT ++P+ + A  L + +  + +   N
Sbjct:  479 RESSLELIKLDISRTFPQLCIFQQGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLDTADAFIAFANLLNKPCQMAFFRVDHSLMLTYFAAFEVFFEENLPKLFAHFKKNNLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTALGVLRLYQDVLTCMDFIHMAQFLT-RLPDLIPAEELFQHIAAVHMSSRN 687          

HSP 2 Score: 105.916 bits (263), Expect = 4.269e-23
Identity = 56/158 (35.44%), Postives = 83/158 (52.53%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRK 1191
            STT LIL DRP  LP K   E+ +H+ +Y ++++  KK+E ++    K  L+ +   EE       +W   ILPNW    +S+ VR LWW+GIP SVR KVW   + N L +T   Y   L++ +E+      P    E P     SS  E++ ++ K
Sbjct:  331 STTALILEDRPANLPAKPAEEALKHRQQYEEMVAQAKKRELKEAQRRKKKLEDRCKHEENIGTAAQIWNQEILPNWSTMCTSRRVRDLWWQGIPPSVRGKVWSLAVGNELNITHELYSICLARAREKWRTTAAPSTDPE-PEDALGSSDRESSLELIK 487          
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Match: ENSORLT00000002561.2 (TBC1 domain family member 12 [Source:NCBI gene;Acc:101160259])

HSP 1 Score: 235.728 bits (600), Expect = 5.775e-66
Identity = 115/227 (50.66%), Postives = 153/227 (67.40%), Query Frame = 1
Query: 1360 RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKN 2040
            R+  L+ IKLD+SRTFP+L +FQ GGP+HDLL+ +LGAY CYRPDIGYVQGMSF+AA+LIL +   +AFI FAN+L  PC  AF+ +D      Y  +F++    +LP+L  HF    L  +++L DW+FT+YS++LPLD A RVWD+FCRDGE +LFR GLGILR YE  LL  DF  +A FL+ ++P+ L A  L   M    +   N      QV + L+K+ N
Sbjct:  611 RESSLDLIKLDISRTFPSLFIFQKGGPYHDLLHSVLGAYTCYRPDIGYVQGMSFIAAVLILNLEEAEAFITFANLLNKPCQMAFFRVDHDLMLKYFAAFEIFFEENLPRLFGHFQTSSLTPDLYLIDWIFTLYSKSLPLDVACRVWDVFCRDGEESLFRTGLGILRLYEEVLLQMDFIHIAQFLS-RLPDDLQAHTLFSAMANTHMISRN--RRWAQVFSALMKDGN 834          

HSP 2 Score: 115.546 bits (288), Expect = 5.196e-26
Identity = 54/133 (40.60%), Postives = 81/133 (60.90%), Query Frame = 1
Query:  718 STTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLE 1116
            STT LIL DRP  LP KST E++RH+ EY ++++  K++E ++    K  +K +  QE+       VW   ILP+W   ++++ VR LWW+G+P SVR +VW   I N L +T   Y+ FLS+ +E+   Y E
Sbjct:  461 STTALILEDRPSNLPAKSTEETQRHKLEYEEMVAGAKRREMKEAQRKKRQMKERHRQEDSISNAMVVWNTEILPHWDSMKATRRVRELWWQGLPPSVRGRVWSLAIGNELNITPELYEIFLSRAKEKWRSYSE 593          
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Match: tbc1d10b (TBC1 domain family member 10B [Source:NCBI gene;Acc:101168543])

HSP 1 Score: 104.375 bits (259), Expect = 1.522e-22
Identity = 70/208 (33.65%), Postives = 105/208 (50.48%), Query Frame = 1
Query: 1372 LNTIKLDVSRTFPNLNLFQ-NGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNS--DFEEMAGF------LTGQMPESLSASVLVEEM 1962
            L+ I+ D+ R FP   +F   GG     LY++L AY  YRPD GY Q  + +AA+L++ M  E AF C   I E  LP    +Y+       +  E F   L    P   +H  + K+D  +++ +W   I+SR LP  + LRVWDMF  +G   +FR GL +L+    Q+L S     E+ G       L    P+++   +LV+E+
Sbjct:  378 LDIIEKDLHRQFPFHEMFAARGGHGQQDLYRILKAYTVYRPDEGYCQAQAPVAAVLLMHMPAEQAFWCLVQICEKYLP---GYYSAGLEAIQLDGEIFFSLLRRTCPMAYRHLKKFKIDPILYMTEWFMCIFSRTLPWSSVLRVWDMFFCEGVKIVFRVGLVLLK----QMLGSVDKLRELQGMYETMERLRNISPDTIREDLLVQEV 578          
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Match: SMESG000020373.1 (SMESG000020373.1)

HSP 1 Score: 1219.53 bits (3154), Expect = 0.000e+0
Identity = 631/634 (99.53%), Postives = 634/634 (100.00%), Query Frame = 1
Query:  160 MTEKYPYLNSVIFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCXXXXXXXXXXXXXXXXXPHNLSNADNANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK 2061
            MTEKYPYLNSV+FDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCSSISSLSSLTSNTDLSIPHNLSNADNANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADL+SSAYDLYISETVSIHNKRSSSISSYSTNISSNK+SASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK
Sbjct:    1 MTEKYPYLNSVVFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCSSISSLSSLTSNTDLSIPHNLSNADNANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLKSSAYDLYISETVSIHNKRSSSISSYSTNISSNKHSASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK 634          
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Match: SMESG000071846.1 (SMESG000071846.1)

HSP 1 Score: 1212.98 bits (3137), Expect = 0.000e+0
Identity = 631/634 (99.53%), Postives = 632/634 (99.68%), Query Frame = 1
Query:  160 MTEKYPYLNSVIFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCXXXXXXXXXXXXXXXXXPHNLSNADNANSNGTSDIKTNDRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK 2061
            MTEKYPYLNSVIFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCSSISSLSSLTSNTDLSIPHNLSNADNANSNGTSDIKTN+RISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVSIHNKRSSSISSYSTNISSNKNSASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLY SNFSSTIEQVRNRLIKNKN VEILDK
Sbjct:    1 MTEKYPYLNSVIFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQDVDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFISSFPNHVFNCSSISSLSSLTSNTDLSIPHNLSNADNANSNGTSDIKTNNRISSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGLPPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQLTHVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTKTHYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVSIHNKRSSSISSYSTNISSNKNSASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYPSNFSSTIEQVRNRLIKNKNPVEILDK 634          
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Match: SMESG000071846.1 (SMESG000071846.1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 323/325 (99.38%), Postives = 323/325 (99.38%), Query Frame = 1
Query: 1087 MQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVXXXXXXXXXXXXXXXXXXXXXXXASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK 2061
            MQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVSIHNKRSSSISSYSTNISSNKNSASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLY SNFSSTIEQVRNRLIKNKN VEILDK
Sbjct:    1 MQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTHISPTADLRSSAYDLYISETVSIHNKRSSSISSYSTNISSNKNSASSDVDIRQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEEMREIKLYPSNFSSTIEQVRNRLIKNKNPVEILDK 325          
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Match: SMESG000003946.1 (SMESG000003946.1)

HSP 1 Score: 102.834 bits (255), Expect = 2.814e-22
Identity = 51/187 (27.27%), Postives = 96/187 (51.34%), Query Frame = 1
Query: 1378 TIKLDVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESL 1935
             I+ D++RT+P  +LF++  G   + L+ ++ AY+ +  ++GY QG  F+  +L++ M  EDAF+   +++        Y  + SE  + +      +   LP+LA HF  H     ++   W  T+++ +  ++ + RV D+F  +G   +F+  L  L  ++ +LL  D E M  FL    P+ L
Sbjct:  145 AIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQL 331          
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Match: SMESG000075615.1 (SMESG000075615.1)

HSP 1 Score: 89.3521 bits (220), Expect = 3.612e-18
Identity = 51/165 (30.91%), Postives = 84/165 (50.91%), Query Frame = 1
Query: 1369 LLNTIKLDVSRTFPN-LNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILE--LPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGIL 1854
            ++  I+ D+ R FPN  N  Q GG   + L  +L  Y+   P+ GY QGM+ LAA L++VM  EDAF  F  I +  +P    +Y     +  +  ++    L      +  +   +++D   ++ DW   IY R LP  + L+V DMF  +G++ LF+  L ++
Sbjct:  384 IVEQIRKDIHRQFPNHENFMQKGGLGQESLSTVLTVYSIRHPETGYCQGMAPLAAALLMVMPEEDAFWTFDKICDSYIP---GYYDDGLKQIQIDAKALNALLKKESSSVYNYLNVNQIDPICYMIDWFMCIYIRTLPWPSVLQVMDMFLCEGKSILFKVALVLV 545          
The following BLAST results are available for this feature:
BLAST of TBC1 domain family member 12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBC1D149.391e-8438.26TBC1 domain family member 14 [Source:HGNC Symbol;A... [more]
TBC1D144.211e-6949.13TBC1 domain family member 14 [Source:HGNC Symbol;A... [more]
TBC1D141.212e-6849.13TBC1 domain family member 14 [Source:HGNC Symbol;A... [more]
TBC1D141.913e-6749.13TBC1 domain family member 14 [Source:HGNC Symbol;A... [more]
TBC1D141.913e-6749.13TBC1 domain family member 14 [Source:HGNC Symbol;A... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc-123.274e-4944.72TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
eat-171.587e-2126.78pep chromosome:WBcel235:X:16399210:16408873:-1 gen... [more]
eat-172.024e-2126.78pep chromosome:WBcel235:X:16399210:16417063:-1 gen... [more]
eat-172.126e-2126.78pep chromosome:WBcel235:X:16399210:16417063:-1 gen... [more]
eat-172.469e-2126.78pep chromosome:WBcel235:X:16399210:16413306:-1 gen... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Evi51.353e-2025.26gene:FBgn0262740 transcript:FBtr0073546[more]
Evi51.353e-2025.26gene:FBgn0262740 transcript:FBtr0332620[more]
Evi51.353e-2025.26gene:FBgn0262740 transcript:FBtr0300732[more]
GAPcenA2.032e-2031.25gene:FBgn0035879 transcript:FBtr0076605[more]
Evi52.053e-2025.26gene:FBgn0262740 transcript:FBtr0073547[more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d145.625e-9639.15TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d145.473e-7935.68TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d141.084e-7835.68TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d12b1.711e-6951.33TBC1 domain family, member 12b [Source:ZFIN;Acc:ZD... [more]
tbc1d12a1.171e-6851.36TBC1 domain family, member 12a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs47.122e-6952.86regulator of G-protein signaling 4 [Source:Xenbase... [more]
rgs42.511e-6852.86regulator of G-protein signaling 4 [Source:Xenbase... [more]
rgs44.566e-6851.61regulator of G-protein signaling 4 [Source:Xenbase... [more]
kcng26.401e-6850.95potassium channel, voltage gated modifier subfamil... [more]
rgs41.137e-6752.86regulator of G-protein signaling 4 [Source:Xenbase... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbc1d145.609e-6847.83TBC1 domain family, member 14 [Source:MGI Symbol;A... [more]
Tbc1d145.609e-6847.83TBC1 domain family, member 14 [Source:MGI Symbol;A... [more]
Tbc1d142.477e-6647.83TBC1 domain family, member 14 [Source:MGI Symbol;A... [more]
Tbc1d142.477e-6647.83TBC1 domain family, member 14 [Source:MGI Symbol;A... [more]
Tbc1d142.477e-6647.83TBC1 domain family, member 14 [Source:MGI Symbol;A... [more]
back to top
BLAST of TBC1 domain family member 12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H7I8|TBC14_BOVIN7.324e-9338.29TBC1 domain family member 14 OS=Bos taurus OX=9913... [more]
sp|Q0IHY4|TBC12_XENTR8.988e-6750.43TBC1 domain family member 12 OS=Xenopus tropicalis... [more]
sp|Q9P2M4|TBC14_HUMAN9.189e-6749.13TBC1 domain family member 14 OS=Homo sapiens OX=96... [more]
sp|Q8CGA2|TBC14_MOUSE1.750e-6547.83TBC1 domain family member 14 OS=Mus musculus OX=10... [more]
sp|Q5CD77|TBC14_RAT2.138e-6547.83TBC1 domain family member 14 OS=Rattus norvegicus ... [more]
back to top
BLAST of TBC1 domain family member 12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q2081.194e-9739.38TBC1 domain family member 14 OS=Crassostrea gigas ... [more]
A0A0L8I5D32.338e-9739.91Rab-GAP TBC domain-containing protein OS=Octopus b... [more]
A0A2D0S8601.194e-9636.51TBC1 domain family member 12 isoform X1 OS=Ictalur... [more]
A0A5N5MK321.319e-9636.51Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A5A9PVW31.327e-9640.32TBC1 domain family member 12 OS=Triplophysa tibeta... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d12b1.932e-7051.97TBC1 domain family, member 12b [Source:ZFIN;Acc:ZD... [more]
ENSAMXT00000009273.24.031e-6550.67TBC1 domain family member 12-like [Source:NCBI gen... [more]
tbc1d144.716e-4341.31TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d146.342e-4241.31TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d10ab5.882e-2530.18TBC1 domain family, member 10Ab [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d12b2.033e-8035.73TBC1 domain family, member 12b [Source:ZFIN;Acc:ZD... [more]
tbc1d12b5.001e-8035.52TBC1 domain family, member 12b [Source:ZFIN;Acc:ZD... [more]
tbc1d142.772e-7052.86TBC1 domain family, member 14 [Source:ZFIN;Acc:ZDB... [more]
tbc1d12b1.936e-6154.12TBC1 domain family, member 12b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000002477.19.522e-4133.54pep scaffold:Pmarinus_7.0:GL478770:27892:36885:-1 ... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MDR11.006e-1626.23Cytoplasmic GTPase-activating protein; activates Y... [more]
GYP54.869e-1325.63GTPase-activating protein (GAP) for yeast Rab fami... [more]
MSB47.240e-1328.02GTPase-activating protein of the Ras superfamily; ... [more]
MSB39.105e-826.11Rab GTPase-activating protein; regulates endocytos... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368722.407e-7334.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346493.948e-2429.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394001.167e-2132.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340472.350e-1928.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340832.734e-1928.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbc1d141.051e-6650.95TBC1 domain family member 14 [Source:NCBI gene;Acc... [more]
tbc1d141.438e-6650.95TBC1 domain family member 14 [Source:NCBI gene;Acc... [more]
tbc1d141.438e-6650.95TBC1 domain family member 14 [Source:NCBI gene;Acc... [more]
ENSORLT00000002561.25.775e-6650.66TBC1 domain family member 12 [Source:NCBI gene;Acc... [more]
tbc1d10b1.522e-2233.65TBC1 domain family member 10B [Source:NCBI gene;Ac... [more]
back to top
BLAST of TBC1 domain family member 12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020373.10.000e+099.53SMESG000020373.1[more]
SMESG000071846.10.000e+099.53SMESG000071846.1[more]
SMESG000071846.10.000e+099.38SMESG000071846.1[more]
SMESG000003946.12.814e-2227.27SMESG000003946.1[more]
SMESG000075615.13.612e-1830.91SMESG000075615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006334 ID=SMED30006334|Name=TBC1 domain family member 12|organism=Schmidtea mediterranea sexual|type=transcript|length=2313bp
AAACAAACAAATTTAAATTTTATATTTTCCTAAAATTTTGTAAAAATTTG
AATTAAATTTTTGGTTGTTCAAAATTTGTTAATTTATATAATTTGTATAT
TTTATAACTTTAAGTTTTGGAAATAAATTGTTATTTTTCAAGTCATATGA
TATTTATTCATGACTGAAAAATACCCCTACTTGAATTCCGTAATTTTTGA
TAGCCCTAAATTACCAAATGGAACTGTTATAAATAACTCACCTATTCAAG
CTACTGAAACAAATAGTTTCAGTAGTTCTGTCTACAACATTGATGATCAA
TTTCAAGATGTAGATCTAAGTGGATTTTCAGAAAATAGTTCAGAATCTCC
TATAACTAGTGAGAAGTATTCATGGAGATTAGGTACTGATTCTATGGAAA
TGCTATCTGATAACAGTGATTTAACACCGACTGCACCCTCATCAGATCAG
TTCATTTCTTCATTTCCGAATCACGTGTTTAATTGTTCATCAATTTCTAG
TTTGTCTTCTTTAACTAGCAACACAGATCTTTCAATTCCGCACAATCTCT
CTAATGCCGATAATGCCAATTCTAATGGAACAAGTGACATAAAAACAAAT
GATAGAATCTCTTCAAACGACAAAGAAAGTAAAAGTAATTTTATTTCACA
AATTAGCCAACTGGTTTTCAACCGTTCTAATAAATCCAAAAAGTCATCAA
TTGAAACTCCGCTAAAATCTACAACTTGCCTCATATTGAATGACAGACCG
ATAGGACTTCCGCCGAAATCAACAAATGAATCCAGACGCCACCAGGATGA
GTACAATCAATTGATTTCCAATATTAAAAAGAAAGAAAAACAACAAAATC
ATGCTAATAAAGCTCTTCTTAAATCTAAAATTAATCAAGAAGAAAGACAA
TATCAATTGACTCATGTGTGGCGTAATTTTATTCTTCCGAATTGGTTTCA
TCAGCAGTCATCACAATATGTTCGTCATTTGTGGTGGGAGGGTATTCCTA
CATCGGTCAGGGAAAAGGTTTGGCGGCATTGCATTCCAAATACTCTAAAA
TTAACCAAAACTCATTACGATAATTTTTTATCTCAAATGCAGGAGCGCAT
TGAGAGATATCTTGAACCGGTTCCCAAAAAAGAATTACCAACCAAAGAAA
CTGTCTCATCAAAGGTCGAAAATGCTTGTGATATTCGTAAGCATTCCAAT
GGGACGCATATTAGTCCGACAGCTGATTTGAGATCTTCGGCATATGATTT
GTATATTTCAGAAACCGTCAGCATCCACAATAAGCGATCTTCTTCCATCA
GTAGTTATTCAACCAATATTAGTTCCAATAAGAATTCGGCTTCTTCAGAT
GTTGATATACGGCAGATTTTATTGAATACTATTAAACTGGATGTATCTCG
AACTTTTCCCAATTTGAATCTTTTTCAAAATGGGGGTCCACATCATGATT
TACTTTACCAGTTGCTCGGAGCTTACGCTTGTTATCGGCCAGATATTGGC
TATGTACAGGGGATGTCATTTCTTGCAGCAATTCTAATCCTTGTAATGAA
TGTTGAAGATGCATTTATTTGTTTTGCCAATATACTCGAATTACCCTGCC
ATCATGCTTTCTATGCTTTAGATGAAAGTGAGTTTACTGTTTATTTGGAA
TCATTCAAGCTTTCGTTATTTACCCATTTGCCACAACTAGCTCAACATTT
CTTTCAACACAAACTTGATGTCAATATCTTTCTTTGTGATTGGTTATTCA
CCATATACAGCCGGGCTTTACCGTTAGATACAGCATTAAGAGTATGGGAT
ATGTTTTGTAGAGACGGAGAAGCAGCCTTGTTCCGAGCAGGTTTGGGTAT
TCTTCGTTGTTATGAAATGCAATTGCTCAACAGTGACTTTGAAGAAATGG
CAGGTTTTCTTACAGGTCAAATGCCAGAATCACTATCTGCCTCAGTTTTG
GTAGAAGAAATGAGAGAAATCAAATTATATCAGTCAAATTTTTCATCAAC
CATAGAACAAGTTCGAAATAGATTAATTAAAAATAAAAATTCAGTTGAAA
TTTTGGACAAATAATTCTTTAAATGATAACTTCAGGCTTTTTATTGTTGA
GATTACTTCTTTGAGATATTTTATTTGTTTTTATATTGACGGAGAAATGT
AAATTAACCACGTCTGTTGTTCTGAAAAGTCTCGTGCAAAGAAAAACCAA
AAATAAACCTTCAGAACTTTCAATAGGCAGTGCTTGTCTTGTTATTTGTC
TCATTTGAACGTGATCATTTTTGCGTTTCATTTTTTATTACTGCCAAATA
TTGGGCTTTAATT
back to top

protein sequence of SMED30006334-orf-1

>SMED30006334-orf-1 ID=SMED30006334-orf-1|Name=SMED30006334-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=635bp
MTEKYPYLNSVIFDSPKLPNGTVINNSPIQATETNSFSSSVYNIDDQFQD
VDLSGFSENSSESPITSEKYSWRLGTDSMEMLSDNSDLTPTAPSSDQFIS
SFPNHVFNCSSISSLSSLTSNTDLSIPHNLSNADNANSNGTSDIKTNDRI
SSNDKESKSNFISQISQLVFNRSNKSKKSSIETPLKSTTCLILNDRPIGL
PPKSTNESRRHQDEYNQLISNIKKKEKQQNHANKALLKSKINQEERQYQL
THVWRNFILPNWFHQQSSQYVRHLWWEGIPTSVREKVWRHCIPNTLKLTK
THYDNFLSQMQERIERYLEPVPKKELPTKETVSSKVENACDIRKHSNGTH
ISPTADLRSSAYDLYISETVSIHNKRSSSISSYSTNISSNKNSASSDVDI
RQILLNTIKLDVSRTFPNLNLFQNGGPHHDLLYQLLGAYACYRPDIGYVQ
GMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFK
LSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFC
RDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESLSASVLVEE
MREIKLYQSNFSSTIEQVRNRLIKNKNSVEILDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR035969Rab-GTPase_TBC_sf
IPR000195Rab-GTPase-TBC_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 208..235
NoneNo IPR availableGENE3DG3DSA:1.10.10.750coord: 229..294
e-value: 1.1E-13
score: 52.9
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 478..630
e-value: 5.0E-38
score: 132.2
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 357..477
e-value: 1.5E-34
score: 120.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..147
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 395..610
NoneNo IPR availablePANTHERPTHR22957:SF467TBC1 DOMAIN FAMILY MEMBER 12coord: 395..610
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 173..324
NoneNo IPR availablePANTHERPTHR22957:SF467TBC1 DOMAIN FAMILY MEMBER 12coord: 173..324
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 275..576
e-value: 7.9E-44
score: 161.6
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 380..573
e-value: 6.7E-44
score: 150.1
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 278..553
score: 30.962
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 495..603
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 252..513