Sodium/potassium-transporting ATPase subunit beta-1

Overview
NameSodium/potassium-transporting ATPase subunit beta-1
Smed IDSMED30006312
Length (bp)1015
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit beta-1 (SMED30006312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-1 (SMED30006312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006312SMESG000022447.1 SMESG000022444.1 SmedASXL_008059SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30006312SMESG000022447.1 SMESG000022444.1 dd_Smed_v4_12062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006312SMESG000022447.1 SMESG000022444.1 dd_Smed_v6_12062_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 72.0182 bits (175), Expect = 1.891e-13
Identity = 63/273 (23.08%), Postives = 118/273 (43.22%), Query Frame = 1
Query:  166 FAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-----DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCW----AIVNNIIINK 945
            F Y  ++ VI L +  L   ++ Y   + +           +++P   ++ RP + S    +   +  T+  YV  L  ++Q Y   ++    +DC     +I     D  K +C+F    L N        +G+  GQPC+L+++NRI G+ P+ GD             +K+ C+ V   D+ +I S+ YY E ++                     +R  YYPY  +L+   Y  P + + F ++ +N  + VQC      ++N++I ++
Sbjct:  114 FFYASLAAVITLCMYTLFLTISPYIPTFTE-----------RVKPP-GVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDP------------VKVSCK-VQRGDENDIRSISYYPESASF-------------------DLR--YYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDR 340          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 71.633 bits (174), Expect = 2.204e-13
Identity = 63/273 (23.08%), Postives = 118/273 (43.22%), Query Frame = 1
Query:  166 FAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-----DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCW----AIVNNIIINK 945
            F Y  ++ VI L +  L   ++ Y   + +           +++P   ++ RP + S    +   +  T+  YV  L  ++Q Y   ++    +DC     +I     D  K +C+F    L N        +G+  GQPC+L+++NRI G+ P+ GD             +K+ C+ V   D+ +I S+ YY E ++                     +R  YYPY  +L+   Y  P + + F ++ +N  + VQC      ++N++I ++
Sbjct:  118 FFYASLAAVITLCMYTLFLTISPYIPTFTE-----------RVKPP-GVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGD------------PVKVSCK-VQRGDENDIRSISYYPESASF-------------------DLR--YYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDR 344          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 71.2478 bits (173), Expect = 2.386e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 1
Query:  193 IWLG-LGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLL--DC------THNVAYIDHPKFS---CKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIK-------IKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQL---SYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            I++G + +++  ++ +   Y+D     G   + ++Q +  I  RP+   S           Y +YV ++  +++ Y+   +R  ++  DC             +H +     C+F L+ LGN        YG+ +G+PC++I+LNR+ G+ P    +   N +   +P +K       ++C G  D DK+ +G++ Y+     L  + GF P Q              YYPY  +L    Y  P + V+F  L  +  I ++C A   NI  +++D
Sbjct:   49 IFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKT-EISFRPNDPKS-----------YEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKP----KPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF----GLGNSPGF-PLQ--------------YYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 71.2478 bits (173), Expect = 2.386e-13
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 1
Query:  193 IWLG-LGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLL--DC------THNVAYIDHPKFS---CKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIK-------IKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQL---SYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            I++G + +++  ++ +   Y+D     G   + ++Q +  I  RP+   S           Y +YV ++  +++ Y+   +R  ++  DC             +H +     C+F L+ LGN        YG+ +G+PC++I+LNR+ G+ P    +   N +   +P +K       ++C G  D DK+ +G++ Y+     L  + GF P Q              YYPY  +L    Y  P + V+F  L  +  I ++C A   NI  +++D
Sbjct:   49 IFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKT-EISFRPNDPKS-----------YEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKP----KPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF----GLGNSPGF-PLQ--------------YYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 70.8626 bits (172), Expect = 2.963e-13
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query:  283 LLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-----DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCW----AIVNNIIINK 945
            L +   S  ++ RP + S    +   +  T+  YV  L  ++Q Y   ++    +DC     +I     D  K +C+F    L N        +G+  GQPC+L+++NRI G+ P+ GD             +K+ C+ V   D+ +I S+ YY E ++                     +R  YYPY  +L+   Y  P + + F ++ +N  + VQC      ++N++I ++
Sbjct:  102 LARTGQSWRVMIRPFAHSLNFNFNVSEPDTWQHYVISLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGD------------PVKVSCK-VQRGDENDIRSISYYPESASF-------------------DLR--YYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDR 301          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 111.694 bits (278), Expect = 4.784e-28
Identity = 80/300 (26.67%), Postives = 139/300 (46.33%), Query Frame = 1
Query:  133 NGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYR----DVPPLSGDQSLLKLQPSLSILP----RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPK----FSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            NG ++    K +  ++V  +I+    +  F L    +  +     VP   G  +++ + P +   P    RPDS  ++IKY  R + +Y +Y+  +  Y+  Y+ +   +R  +C    +  D  K      C+F L + + GC+  + +G+  G+PCV+I LNR+ GW P D+ +  V    ++ +   +I I C G T+ D+E+IG + Y             +P            I   YYPY     YQ P   VKF+ + RN +++V+C A   NI  +     G + FE +V+
Sbjct:   38 NGTVMGRTGKSWFQIIVFYIIFYAF-LAAFWLTCLTIFMKTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDS--TLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETR--ECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY-------------MPSN---------GIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 111.694 bits (278), Expect = 4.784e-28
Identity = 80/300 (26.67%), Postives = 139/300 (46.33%), Query Frame = 1
Query:  133 NGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYR----DVPPLSGDQSLLKLQPSLSILP----RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPK----FSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            NG ++    K +  ++V  +I+    +  F L    +  +     VP   G  +++ + P +   P    RPDS  ++IKY  R + +Y +Y+  +  Y+  Y+ +   +R  +C    +  D  K      C+F L + + GC+  + +G+  G+PCV+I LNR+ GW P D+ +  V    ++ +   +I I C G T+ D+E+IG + Y             +P            I   YYPY     YQ P   VKF+ + RN +++V+C A   NI  +     G + FE +V+
Sbjct:   38 NGTVMGRTGKSWFQIIVFYIIFYAF-LAAFWLTCLTIFMKTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDS--TLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETR--ECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY-------------MPSN---------GIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 111.694 bits (278), Expect = 4.784e-28
Identity = 80/300 (26.67%), Postives = 139/300 (46.33%), Query Frame = 1
Query:  133 NGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYR----DVPPLSGDQSLLKLQPSLSILP----RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPK----FSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            NG ++    K +  ++V  +I+    +  F L    +  +     VP   G  +++ + P +   P    RPDS  ++IKY  R + +Y +Y+  +  Y+  Y+ +   +R  +C    +  D  K      C+F L + + GC+  + +G+  G+PCV+I LNR+ GW P D+ +  V    ++ +   +I I C G T+ D+E+IG + Y             +P            I   YYPY     YQ P   VKF+ + RN +++V+C A   NI  +     G + FE +V+
Sbjct:   38 NGTVMGRTGKSWFQIIVFYIIFYAF-LAAFWLTCLTIFMKTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDS--TLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETR--ECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY-------------MPSN---------GIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 103.219 bits (256), Expect = 3.484e-25
Identity = 73/251 (29.08%), Postives = 113/251 (45.02%), Query Frame = 1
Query:  256 VPPLSGDQSLLKLQPSLSILP--RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAY-IDHPKFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            VP   G  +++ + P +   P  + +  S++IK+  +   ++  YV  L  Y+  Y+   E        +N A   D   F C+F L L     C   +QYG+  G+PCV + LNR+ GW P ++ D  V    +  +   +I I CEG T  DKE++G + Y  E                        I   YYPY    SYQ P   VKF+ + RN +++V+C A  +NI  +     G + FE  V+
Sbjct:   65 VPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG----------------------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 293          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 103.605 bits (257), Expect = 3.674e-25
Identity = 73/251 (29.08%), Postives = 113/251 (45.02%), Query Frame = 1
Query:  256 VPPLSGDQSLLKLQPSLSILP--RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAY-IDHPKFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            VP   G  +++ + P +   P  + +  S++IK+  +   ++  YV  L  Y+  Y+   E        +N A   D   F C+F L L     C   +QYG+  G+PCV + LNR+ GW P ++ D  V    +  +   +I I CEG T  DKE++G + Y  E                        I   YYPY    SYQ P   VKF+ + RN +++V+C A  +NI  +     G + FE  V+
Sbjct:   79 VPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG----------------------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079382)

HSP 1 Score: 94.3597 bits (233), Expect = 1.228e-21
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   54 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079383)

HSP 1 Score: 94.3597 bits (233), Expect = 1.228e-21
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   54 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100381)

HSP 1 Score: 94.3597 bits (233), Expect = 1.228e-21
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   54 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100382)

HSP 1 Score: 93.9745 bits (232), Expect = 1.643e-21
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   55 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 323          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079381)

HSP 1 Score: 93.9745 bits (232), Expect = 1.643e-21
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   55 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 323          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 72.0182 bits (175), Expect = 7.244e-14
Identity = 66/266 (24.81%), Postives = 116/266 (43.61%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLDLGNIGCNMGNQ-YGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI 933
            Y+ ++ +  L + +++  L ++   Y+D   LS         P + I P+ + L   I Y      T+  YV  L  ++  Y   V+  +  +C  +  +I        + PK SC+F   +      + ++ YG+D+G+PC++I+LNR+ G +P           ++G P   + C     A K  +G   + D+   L     + P+         G     YYPY   K Q++Y  P + VKF  + RN  + V+C    NNI
Sbjct:   40 YIFLAGLFTLTMYVMLQTLDDHRPTYQDR--LS--------TPGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP----------AKDGQPPY-VTC----GAKKYKVGKDEWTDDSDKLGELAYYPPN---------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECKINSNNI 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 72.0182 bits (175), Expect = 7.244e-14
Identity = 66/266 (24.81%), Postives = 116/266 (43.61%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLDLGNIGCNMGNQ-YGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI 933
            Y+ ++ +  L + +++  L ++   Y+D   LS         P + I P+ + L   I Y      T+  YV  L  ++  Y   V+  +  +C  +  +I        + PK SC+F   +      + ++ YG+D+G+PC++I+LNR+ G +P           ++G P   + C     A K  +G   + D+   L     + P+         G     YYPY   K Q++Y  P + VKF  + RN  + V+C    NNI
Sbjct:   40 YIFLAGLFTLTMYVMLQTLDDHRPTYQDR--LS--------TPGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDTVQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP----------AKDGQPPY-VTC----GAKKYKVGKDEWTDDSDKLGELAYYPPN---------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECKINSNNI 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 67.781 bits (164), Expect = 1.232e-12
Identity = 70/286 (24.48%), Postives = 117/286 (40.91%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFS-LDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI--IINKEDGTGYIRFEFLVD 987
            Y  ++ V  L + +++  L +Y   ++D              P + I P+ ++L   I Y      ++  YV  L ++++ Y    +     DCT +   I        ++PK SC+F+   L +        YG+ DG+PC+LI+LNR+ G  P           Q+ + T   K E     D E+IG + Y            F P+         G     YYPY   K Q++Y  P + VKF  +  N  + V+C    N I     ++   G + F+  V+
Sbjct:   11 YTFLAGVFCLTMYVMLLTLDDYQPTWQD----------RLATPGMMIRPKGEALE--IVYSRENTESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKP-------GKDGQSPYVTCGAKKE-----DAESIGEIAY------------FPPN---------GTFNLMYYPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKINSNTITEFSERDKFAGRVSFKLRVN 251          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b1a (ATPase Na+/K+ transporting subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-001127-3])

HSP 1 Score: 68.1662 bits (165), Expect = 1.477e-12
Identity = 78/307 (25.41%), Postives = 124/307 (40.39%), Query Frame = 1
Query:  121 RKLLNGRLIAHILKRFAYLLVSNVIWLGLGI-----LMFALANYAVLYRD-VPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVER--SRLLDCTHNVA-YIDHPKF--------SCKFSLD-LGNIGCNMGNQ---YGFDDGQPCVLIRLNRIYGWIP------DFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQL---SYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            +K   GR     LK F + ++      G+ I     ++  L+NY   Y+D V P           P LS  PRPD     I Y      TY  YV+ + A+++ Y + ++   ++  DC      Y D  +         +C+F  + LG        +   YGFDDGQPC++++LNRI  ++P      D   E V    Q     I I C    + +   +G + Y+   +         P Q              YYPY  +L    Y  P + +KF  +  +V + V+C     NI  +++D
Sbjct:   20 KKEFLGRTGCSWLKIFIFYVIFYGCLAGIFIGTIQAMLLTLSNYKPTYQDRVAP-----------PGLSHSPRPDKAE--ISYNINDESTYMPYVNHIDAFLKAYNQDIQEDNTKFEDCGDKPEFYTDRGELESDNGVRKACRFRREWLGECSGQKDEKQKNYGFDDGQPCLIVKLNRIVNFMPRPPASNDSIPEAVRPKLQGN--VIPIHCSSKREEEANLLGQIKYFGVGNG-------FPLQ--------------YYPYYGKLLQPQYLQPLVAIKFYNITTDVDVRVECKVYGENIDYSEKD 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 67.781 bits (164), Expect = 1.844e-12
Identity = 70/286 (24.48%), Postives = 117/286 (40.91%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFS-LDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI--IINKEDGTGYIRFEFLVD 987
            Y  ++ V  L + +++  L +Y   ++D              P + I P+ ++L   I Y      ++  YV  L ++++ Y    +     DCT +   I        ++PK SC+F+   L +        YG+ DG+PC+LI+LNR+ G  P           Q+ + T   K E     D E+IG + Y            F P+         G     YYPY   K Q++Y  P + VKF  +  N  + V+C    N I     ++   G + F+  V+
Sbjct:   44 YTFLAGVFCLTMYVMLLTLDDYQPTWQD----------RLATPGMMIRPKGEALE--IVYSRENTESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKP-------GKDGQSPYVTCGAKKE-----DAESIGEIAY------------FPPN---------GTFNLMYYPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECKINSNTITEFSERDKFAGRVSFKLRVN 284          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 75.8702 bits (185), Expect = 5.573e-15
Identity = 73/273 (26.74%), Postives = 113/273 (41.39%), Query Frame = 1
Query:  217 MFALANYAVLYR--DVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNV--------AYIDHPKFSCKF-SLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIIN--KEDGTGYIRFEFLVD 987
            MFAL+ Y +L    +  P   D+      P L I P+ D+L   I Y      ++A YV  L + +  Y   V+  +   C   V           ++PK +C+F    LG+        YG+  G PC+LI++N+I  + P     L + S       I I C G T    + +GS  YY   +         P          G +   Y+PY   + Q +Y  P + VKF  L  N  + VQC A   NI  N  ++  +G + F+  ++
Sbjct:   54 MFALSMYVMLQTIDEYTPKYWDR---LTSPGLMIRPKTDTLE--IVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVIPSLSNTS-------ITINCTGTTANMDQMLGSRTYYPSSN---------PSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQCRANAVNINTNDSQDKFSGRVSFKLHIN 305          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 73.559 bits (179), Expect = 3.831e-14
Identity = 67/253 (26.48%), Postives = 112/253 (44.27%), Query Frame = 1
Query:  217 MFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI----DHP-KFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKE 948
            MFAL  Y +L    P +   +  +   P L+I P+ ++L     +   +R T++SY   L  ++++Y    ++ + L CT    ++    DH  + +C+FS  L  N        +GF  G+PC+LI++NRI G+              +G P I + CE V  AD   +G + +Y  +                      +    YYPY  +L+   Y  P I ++F  +KRN  + VQC     +II + E
Sbjct:   88 MFALCMYGLLATISPYVPTYRERV-FPPGLTIRPQANAL--YFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY-----------QAGSGIP-IYVTCE-VLKADMSYLGPISFYPSD----------------------KFDLMYYPYYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHE 302          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 73.559 bits (179), Expect = 4.059e-14
Identity = 67/253 (26.48%), Postives = 112/253 (44.27%), Query Frame = 1
Query:  217 MFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI----DHP-KFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKE 948
            MFAL  Y +L    P +   +  +   P L+I P+ ++L     +   +R T++SY   L  ++++Y    ++ + L CT    ++    DH  + +C+FS  L  N        +GF  G+PC+LI++NRI G+              +G P I + CE V  AD   +G + +Y  +                      +    YYPY  +L+   Y  P I ++F  +KRN  + VQC     +II + E
Sbjct:   87 MFALCMYGLLATISPYVPTYRERV-FPPGLTIRPQANAL--YFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY-----------QAGSGIP-IYVTCE-VLKADMSYLGPISFYPSD----------------------KFDLMYYPYYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHE 301          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 73.1738 bits (178), Expect = 4.430e-14
Identity = 67/253 (26.48%), Postives = 112/253 (44.27%), Query Frame = 1
Query:  217 MFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI----DHP-KFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKE 948
            MFAL  Y +L    P +   +  +   P L+I P+ ++L     +   +R T++SY   L  ++++Y    ++ + L CT    ++    DH  + +C+FS  L  N        +GF  G+PC+LI++NRI G+              +G P I + CE V  AD   +G + +Y  +                      +    YYPY  +L+   Y  P I ++F  +KRN  + VQC     +II + E
Sbjct:   84 MFALCMYGLLATISPYVPTYRERV-FPPGLTIRPQANAL--YFAFNSSERSTWSSYAESLNTFLEDYNDETQKEKNLVCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY-----------QAGSGIP-IYVTCE-VLKADMSYLGPISFYPSD----------------------KFDLMYYPYYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHE 298          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Match: tpst2 (tyrosylprotein sulfotransferase 2 [Source:Xenbase;Acc:XB-GENE-962493])

HSP 1 Score: 61.6178 bits (148), Expect = 3.366e-10
Identity = 74/271 (27.31%), Postives = 111/271 (40.96%), Query Frame = 1
Query:  193 IWLG-LGILMFALANYAVLYRD-VPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERS-RLLDC-THNVAYIDH--------PKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGW--IPDFGDELVDNSTQNGFP-TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKK--QLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            I++G + +L+  ++ Y   Y+D V P           P L+ +P+  ++ + I +      +Y  YV  +  +I  Y    + S +  DC T    Y +          K SC F    L N        +GF +G+PCV+++LNRI  +  +P   + L    T N  P  I I C+G  D D  NI  + YY                  G     G   NYY  Y K  Q  Y  P I V+F  L  N  I ++C A   NI  + +D
Sbjct:   50 IFIGTIQVLLLTISEYEPKYQDRVAP-----------PGLTQVPK--AVKTEINFSPNDPDSYNDYVQSMEKFISKYSNENQVSDKFEDCGTMPGQYRERGGLNKDGGQKKSCVFRRQWLQNCSGIDDQTFGFAEGKPCVIVKLNRIVAFKPVPPQNNSLPPEMTANYNPYVIPIHCQGKRDEDIPNIREVKYY------------------GMGGFAGFPLNYYPYYGKLLQPEYLQPLIAVQFTNLTFNTEIRIECKAYGENIDYHDKD 289          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 77.411 bits (189), Expect = 1.722e-15
Identity = 69/292 (23.63%), Postives = 128/292 (43.84%), Query Frame = 1
Query:  109 RSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-----DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCW----AIVNNIIINK 945
            R  + +    R +  ++  F Y  ++ VI L + +L  A++ Y   + +           +++P   ++ RP + S    +   +  T+  YV  L  ++Q Y   ++    +DC     +I     D  K +C+F    L N        +G+  GQPC+L+++NRI G+ P+FGD             +K+ C+ V   D+ +I S+ YY E ++                     +R  YYPY  +L+   Y  P + + F ++ +N  + VQC      IVN++I ++
Sbjct:   98 RMSLARTGQSRSLILVIYFFFYASLAAVITLFIYMLFLAISPYMPTFTE-----------QVKPP-GVMIRPFAHSLNFNFNVSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGD------------PVKVSCK-VQKGDENDIRSINYYPESASF-------------------DLR--YYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDR 343          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 77.0258 bits (188), Expect = 2.709e-15
Identity = 67/273 (24.54%), Postives = 121/273 (44.32%), Query Frame = 1
Query:  166 FAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-----DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLS---YQIPFIWVKFNELKRNVVIMVQCW----AIVNNIIINK 945
            F Y  ++ VI L + +L  A++ Y   + +           +++P   ++ RP + S    +   +  T+  YV  L  ++Q Y   ++    +DC     +I     D  K +C+F    L N        +G+  GQPC+L+++NRI G+ P+FGD             +K+ C+ V   D+ +I S+ YY E ++                     +R  YYPY  +L+   Y  P + + F ++ +N  + VQC      IVN++I ++
Sbjct:  113 FFYASLAAVITLFIYMLFLAISPYMPTFTE-----------QVKPP-GVMIRPFAHSLNFNFNVSEPETWQRYVISLNGFLQGYNDSLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGD------------PVKVSCK-VQKGDENDIRSINYYPESASF-------------------DLR--YYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVINDR 339          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 69.3218 bits (168), Expect = 6.733e-13
Identity = 61/253 (24.11%), Postives = 112/253 (44.27%), Query Frame = 1
Query:  280 SLLKLQPSLSILPRPDSLSSI-------IKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLL--DCTH------NVAYIDHPKFS---CKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFP--------TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKK--QLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            ++ +L+P+      P  L+ I       I ++     +Y +YV ++  +++ Y+   ++  ++  DC +          I+H +     C+F LD LGN      + YG+ +G+PC++I+LNR+ G+ P    +   N +   +P         + ++C G  D DK+ +G++ Y+                  G    YG    YY  Y K  Q  Y  P + V+F  L  +  I V+C A   NI  +++D
Sbjct:   60 TISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKP----KPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYF------------------GMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKD 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp4b (ATPase, H+/K+ exchanging, beta polypeptide [Source:MGI Symbol;Acc:MGI:88114])

HSP 1 Score: 67.3958 bits (163), Expect = 2.680e-12
Identity = 69/300 (23.00%), Postives = 130/300 (43.33%), Query Frame = 1
Query:  133 NGRLIAHILKRFAYLLVSNVIWLGLGILM---FALANYAVLYRDVPPLSGD-QSLLKLQPSLSILPRPDSLSS---IIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCT-------HNVAYIDHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEF 978
             G+++     R+ ++   ++ + G  ++M   FAL  Y VL + + P + D Q  LK  P +++  RPD        I Y   +  ++A   H L +++  Y    ++  + +CT        + A  +H KFSCKF+ D L N        +GF++G+PC +I++NRI  ++P          + N  P  ++ C    D  K          +++   + E + P+         G    +Y+PY   K Q  Y  P +  K   + +N+ + + C  + +++  N        + EF
Sbjct:   26 TGQMLGRTPARWVWI---SLYYAGFYVVMTGLFALCIY-VLMQTIDPYTPDYQDQLK-SPGVTL--RPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSI-NCTSEKYFFQESFAAPNHTKFSCKFTADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKFLP----------SNNTAP--RVDCTFQDDPQKPR--------KDTEPLQVEYYPPN---------GTFSLHYFPYYGKKAQPHYSNPLVAAKLLNVPKNMQVSIVCKILADHVTFNNPHDPYEGKVEF 288          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Match: Atp1b2 (ATPase, Na+/K+ transporting, beta 2 polypeptide [Source:MGI Symbol;Acc:MGI:88109])

HSP 1 Score: 67.3958 bits (163), Expect = 2.763e-12
Identity = 64/275 (23.27%), Postives = 112/275 (40.73%), Query Frame = 1
Query:  166 FAYLLVSNVIWLGLGILMFALANYAVL--YRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAY-------IDHPKFSCKFS-LDLGNI-GCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKE 948
            +A++L+  +++ G    MF+L  + +L    D  P   D+      P L I P+ ++L  I+        ++  +V  L  +++ Y   ++  +   C     Y       +++PK +C+F+   LG+  G      YG+  GQPCV I++NR+             N       ++ + C G  D D EN+G    +                        G I   Y+PY   K  ++Y  P + VKF  +  NV + V+C     NI  + E
Sbjct:   37 WAFILLFYLVFYGFLTAMFSLTMWVMLQTVSDHTPKYQDRLAT---PGLMIRPKTENLDVIVNIS--DTESWGQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVI------------NFYAGANQSMNVTCVGKRDEDAENLGHFVMFPAN---------------------GSIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDE 273          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 6.086e-27
Identity = 80/300 (26.67%), Postives = 139/300 (46.33%), Query Frame = 1
Query:  133 NGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYR----DVPPLSGDQSLLKLQPSLSILP----RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPK----FSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            NG ++    K +  ++V  +I+    +  F L    +  +     VP   G  +++ + P +   P    RPDS  ++IKY  R + +Y +Y+  +  Y+  Y+ +   +R  +C    +  D  K      C+F L + + GC+  + +G+  G+PCV+I LNR+ GW P D+ +  V    ++ +   +I I C G T+ D+E+IG + Y             +P            I   YYPY     YQ P   VKF+ + RN +++V+C A   NI  +     G + FE +V+
Sbjct:   38 NGTVMGRTGKSWFQIIVFYIIFYAF-LAAFWLTCLTIFMKTLDPKVPRFYGKGTIIGVNPGVGYQPWLKERPDS--TLIKYNLRDQKSYKAYLEQMKTYLTKYDSNATETR--ECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTY-------------MPSN---------GIDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 4.673e-24
Identity = 73/251 (29.08%), Postives = 113/251 (45.02%), Query Frame = 1
Query:  256 VPPLSGDQSLLKLQPSLSILP--RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAY-IDHPKFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            VP   G  +++ + P +   P  + +  S++IK+  +   ++  YV  L  Y+  Y+   E        +N A   D   F C+F L L     C   +QYG+  G+PCV + LNR+ GW P ++ D  V    +  +   +I I CEG T  DKE++G + Y  E                        I   YYPY    SYQ P   VKF+ + RN +++V+C A  +NI  +     G + FE  V+
Sbjct:   79 VPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFPCRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG----------------------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|A8X4W9|AT1B3_CAEBR (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis briggsae OX=6238 GN=nkb-3 PE=3 SV=3)

HSP 1 Score: 101.679 bits (252), Expect = 2.667e-23
Identity = 71/251 (28.29%), Postives = 112/251 (44.62%), Query Frame = 1
Query:  256 VPPLSGDQSLLKLQPSLSILP--RPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVE-RSRLLDCTHNVAYIDHPKFSCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-DFGDELVDNSTQNGFPT--IKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            VP   G  +++ + P +   P  + +  S++IK+  +   ++  YV  L  Y   Y    + R    + ++     D     C+F L L     C   +QYGF  G+PCV++ LNR+ GW P D+    V    ++ + +  I I CEG T  DKE++G + Y  E                        I   YYPY    SYQ P   VKF+ + RN +++V+C A  +NI  +     G + FE  V+
Sbjct:   88 VPRFYGKGTIIGVNPGVGYQPWLKENPDSTLIKFNLQDSKSWEPYVKQLDGYFSRYNNTNDTRECGAEDSNEALQTDPDSLPCRFDLGLFEKANCGAKDQYGFKSGKPCVVVSLNRLIGWRPVDYDGNSVPEEIKSRYKSGSITINCEGATPFDKEHLGKVKYIPEAG----------------------IDGRYYPYVFLPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDVSTRIGMVYFELFVE 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|Q24048|ATPB2_DROME (Sodium/potassium-transporting ATPase subunit beta-2 OS=Drosophila melanogaster OX=7227 GN=nrv2 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.647e-20
Identity = 74/293 (25.26%), Postives = 124/293 (42.32%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRP---DSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIG-CNMGNQYGFDDGQPCVLIRLNRIYGWIPDF---GDEL--------------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+    V+   + I M+A   +  L   +P  + D+SL+   P L   P P   +  S++I Y+  +   Y  +   L  ++  Y+            +N  Y   P       +D+     C   N Y +    PC+ ++LN+IYGWIP++    ++L              V+ +      TI + CEG   AD+ENIG++ Y      +R   G                  Y+YPY+    Y  P + V F   KR ++I V+C A   NII ++++  G + +E L+D
Sbjct:   55 YVAFYGVLAALVAICMWAF--FQTLDPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYL----PIRGFPG------------------YFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 323          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Match: sp|P25169|AT1B1_ARTSF (Sodium/potassium-transporting ATPase subunit beta OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 6.236e-18
Identity = 79/338 (23.37%), Postives = 135/338 (39.94%), Query Frame = 1
Query:   49 PKASLIGMKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFA---LANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSL---SSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKF--SCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIP-----------DFGDEL------VDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            P    +G    E   Q+   +  V      + +      +A + +  VI+  L    FA   +  Y  L   +P      SL+   P L   P P      S++I+++   +  +  +VH L  +++ YE      +      N  +   P+   +C F+++L    C   N +G++ G+PCVLI+L   +GW P           D   +L      ++   +     + + CEG T  DKE IG++ Y    +  R   GF                 YYYPY     Y  P + ++F  L+    + V+C A  NNI  +++   G + FE  +D
Sbjct:    6 PDEQFVGSGPKETKWQS--FKGFVWNSETSQFMGRTAGSWAKITIFYVIFYTLLAGFFAGMLMIFYQTLDFKIPKWQNKDSLIGANPGLGFRPMPPEAQVDSTLIQFKHGIKGDWQYWVHSLTEFLEPYETLTSSGQEFT---NCDFDKPPQEGKACNFNVELLGDHCTKENNFGYELGKPCVLIKLTD-FGWRPEVYNSSAEVPEDMPADLKSYIKDIETGNKTHMNMVWLSCEGETANDKEKIGTITY----TPFR---GF---------------PAYYYPYLNVPGYLTPVVALQFGSLQNGQAVNVECKAWANNISRDRQRRLGSVHFEIRMD 315          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A1S8X5A7 (Sodium / potassium ATPase beta chain OS=Opisthorchis viverrini OX=6198 GN=X801_02222 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 7.444e-51
Identity = 96/283 (33.92%), Postives = 159/283 (56.18%), Query Frame = 1
Query:  142 LIAHILKRFAYLL-VSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            ++  I  R AY L +  ++ +   + ++ L  +A+L  D P ++G  +LL+L P L+++P P+  ++++  +     +Y+S V ++ A++ +Y+ H       DC     Y+ H +  C++SLD G   CN+ N +GF  GQPC  ++LNRIYGW+PD    +           +++KCEG+T+ D   +G +CYYD +S L+R  G   D E  C  +YG     YYP+  Q  YQ P ++V+F   KR VVI ++C+AI  N+ +N E   G + F+ LVD
Sbjct:   43 ILKSIFTRMAYTLCIYTIVIIFFFVYVYILFYFAILL-DHPRITGYSNLLQLNPGLAVVPNPNVRTTLVHIRVSDPVSYSSMVDEMTAFLTHYQTHTVGGMFTDCEKKQGYV-HFRRVCRYSLDAGG-PCNLKNGFGFFRGQPCFAVKLNRIYGWLPDISMNVTG---------VQVKCEGLTETDAAYLGKVCYYDMDS-LQRHHGLHRDAEW-CDRDYGIFNQMYYPFLNQGHYQSPIVFVQFRNPKRYVVIWIKCYAIAKNVHVNLEQNEGSMVFQLLVD 311          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A074Z9B5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_11482 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.867e-50
Identity = 98/285 (34.39%), Postives = 156/285 (54.74%), Query Frame = 1
Query:  142 LIAHILKRFAYLLVSNVIWLGLGILMFA---LANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            ++  I  R AY L    I+  + I  FA   +  Y  +  D P ++G  +LL+L P L+++P P+  ++++  +     +Y+S V ++ A++ +Y+ H       DC     Y+ H +  C++SLD G   CN+ N +GF  GQPC  ++LNRIYGW+PD    +           +++KCEG+T+ D   +G +CYYD +S L+R  G   D E  C  +YG     YYP+  Q  YQ P ++V+F   KR VVI ++C+AI  N+ +N E   G + F+ LVD
Sbjct:   43 ILKSIFTRMAYTLC---IYTTVIIFFFAYVYILFYFAILPDHPRITGYSNLLQLNPGLAVVPNPNVRTTLVHVRVSDPVSYSSMVDEMTAFLTHYQTHTVGGMFTDCEKKQGYV-HFRRVCRYSLDAGG-PCNLKNGFGFFRGQPCFAVKLNRIYGWLPDISMNVTG---------VQVKCEGLTETDAAYLGKVCYYDMDS-LQRHHGLHRDAEW-CDRDYGIFNQMYYPFLNQGHYQSPIVFVQFRNPKRYVVIWIKCYAIAKNVHVNLEQNEGSMVFQLLVD 311          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: H2KQR5 (Sodium/potassium-transporting ATPase subunit beta-1 OS=Clonorchis sinensis OX=79923 GN=nkb-1 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.125e-49
Identity = 95/283 (33.57%), Postives = 156/283 (55.12%), Query Frame = 1
Query:  142 LIAHILKRFAYLL-VSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            ++  I  R AY L +   + +   + M+ L  + +L  D P ++G  +LL+L P ++I+P P   ++++  +     +Y+S V ++ A + +Y+ H        C     Y+ H +  C++SLD G   CN+ N +GF  GQPC +++LNRIYGW+PD    +           +++KCEG+T+ D   +G +CYYD +S L+R +G   D E  C  +YG     YYP+  Q  YQ P ++V+F   KR VVI ++C+AI  N+ +N E   G + F+ LVD
Sbjct:   43 ILKSIFTRMAYTLCIYTAVIILFFVYMYVLFYFTIL-PDHPRITGYSNLLQLNPGIAIVPNPSVRTTLVHVRVSDPVSYSSMVDEMTALLTHYQTHTAGGMFTACEKKRGYV-HFRRVCRYSLDAGG-PCNLKNGFGFFRGQPCFVVKLNRIYGWLPDISTNVTG---------VQVKCEGLTETDAAYLGKVCYYDMDS-LQRHDGLHRDAEW-CDRDYGIFNQMYYPFLNQGHYQSPIVFVQFRNPKRYVVIWIKCYAIAKNVHVNLEQNEGSMVFQLLVD 311          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A4S2LHE1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007149 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.925e-49
Identity = 94/283 (33.22%), Postives = 153/283 (54.06%), Query Frame = 1
Query:  142 LIAHILKRFAYLL-VSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            ++  I  R AY L +  V+ +   + M+ L  + +L  D P ++G  +LL+L P +S++P P   ++++  +     +Y+S V ++ A++ +Y+ H        C     Y+ H +  C++SLD G   CN+ N +GF  GQPC  ++LNRIYGW+PD    +           +++KCEG+T+ D   +G +CYYD +S  R  E  L      C  +YG     YYP+  Q  YQ P ++V+F   KR VVI ++C+AI  N+ +N E   G + F+ LVD
Sbjct:   43 ILKSIFTRMAYTLCIYTVVIILFFVYMYVLFYFTIL-PDHPRITGYSNLLQLNPGISVVPNPSVRTTLVHVRVSDPVSYSSMVDEMTAFLTHYQTHTVGGMFTACEKKRGYV-HFRRVCRYSLDAGG-PCNLKNGFGFFRGQPCFAVKLNRIYGWLPDISMNVTG---------VQVKCEGLTETDAAYLGKVCYYDMDSLQRHHE--LHRDAEWCDRDYGIFNQMYYPFLNQGHYQSPIVFVQFRNPKRYVVIWIKCYAIAKNVRVNLEQNEGSMVFQLLVD 311          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Match: A0A5J4NXR5 (Sodium/potassium-transporting ATPase subunit beta OS=Paragonimus westermani OX=34504 GN=DEA37_0002497 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.428e-47
Identity = 87/272 (31.99%), Postives = 150/272 (55.15%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            Y+L S  + L +      L  Y  +  + P L+G  S+LKL P +S++P P  L+S++  +     +Y++ V ++ A++ +Y+ H+       C   + ++  P+ SC+++LD G   CNM + +G+  GQPC  ++LNRIYGW+P      + N+T      +++KCEG+T+ D   +G +CYYD +S   R  G L  Q   C   +G   + +YP+  Q +YQ P ++V F   KR VVI ++C+A   NI +N     G + F+ +++
Sbjct:    3 YILCSYSVLLLIFTAYMRLLFYFTVRLNAPRLTGQSSMLKLNPGISVIPNPSVLTSLVHIRVSNPASYSALVDEMAAFLTHYQTHIAGGVFAHCEPVLGFVS-PRVSCRYNLDAGG-PCNMKSGFGYFRGQPCFAVKLNRIYGWLPS----PLANAT-----GVRLKCEGLTETDAAYLGKVCYYDMDSL--RYHGPLKHQSEWCDRNFGVFNSMFYPFLNQANYQSPVVFVHFISPKRYVVIWIKCYAEARNIQVNLNRNEGSVVFQIMIE 261          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 69.707 bits (169), Expect = 2.986e-13
Identity = 74/322 (22.98%), Postives = 128/322 (39.75%), Query Frame = 1
Query:   70 MKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYR--DVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI--IINKEDGTGYIRFEFLVD 987
            M + E  K++   R          L+      +  +L+  +++      MF L  Y +L    D  P   D+      P L I P+  S+   I+Y  +   ++  YV  L +++  Y+   +      CT +  +I        ++PK SC+F+   LG+        YG+ DG+PC+ I+LNR+ G +P           Q+ + T   K E     D E +G + Y+   ++                         YYPY   K Q++Y  P + VKF  L  N  + V+C    N I     ++   G + F+  ++
Sbjct:    1 MAKEEDKKKSGEWREFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGMFCLTMYVMLLTLDDYKPTWQDRLA---TPGLMIRPKGSSME--IQYSKQNTESWDKYVKTLNSFLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKPCIFIKLNRVIGMLP-------GKDGQSPYVTCGAKRE-----DSELLGDMAYFPSNASFNLM---------------------YYPYYGKKAQVNYSQPLVAVKFLNLTLNTDVNVECKINSNTISDFSERDKFAGRVSFKLRIE 284          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 69.3218 bits (168), Expect = 5.653e-13
Identity = 78/322 (24.22%), Postives = 131/322 (40.68%), Query Frame = 1
Query:  103 LLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGIL-----------MFALANYAVLYR--DVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLDLGNIGCNMGNQY-GFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNII-INKEDG-TGYIRFEFLVD 987
            L R VV KLL G+    +     YL ++    LGL  L           MF L  Y +L    D  P   D+      P L I P+ + +  I  Y      ++ ++V  L +++  Y   V+  +   C  +  +         ++PK SC+F   +      + ++Y G+D+G+PC++I+LNR+ G +P    +              I C    D D + +G + Y+                        G     Y+PY   K Q++Y  P + +KF  +  N  I V+C  I NNI  +N+ D   G + F+  ++
Sbjct:   21 LQRLVVIKLLPGQAARTV----PYLFLNQHGLLGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDNKPTYQDRLA---TPGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQ-----------APSISCAPKID-DTDKMGEVAYFPRN---------------------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNIPNLNERDKFAGRVSFKLRIN 300          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 67.781 bits (164), Expect = 1.795e-12
Identity = 66/287 (23.00%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLDLGNIGCNMGNQY-GFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKI-KCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNII-INKEDG-TGYIRFEFLVD 987
            Y+ ++ +  L + +++  L +    Y+D              P L I P+ + +  I  Y      ++ ++V  L +++  Y   V+  +   C  +  +         ++PK SC+F   +      + ++Y G+D+G+PC++I+LNR+ G +P  G +    S        KI K E + D DK  +G + Y+                        G     Y+PY   K Q++Y  P + +KF  +  N  I V+C  I NNI  +N+ D   G + F+  ++
Sbjct:   41 YIFLAGMFILTMYVMLLTLDDNKPTYQD----------RLATPGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLP--GKDGQAPSISCAPKKYKIGKDEWIDDTDK--MGEVAYFPRN---------------------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNIPNLNERDKFAGRVSFKLRIN 290          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 65.855 bits (159), Expect = 7.884e-12
Identity = 61/286 (21.33%), Postives = 118/286 (41.26%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI--------DHPKFSCKFSLDLGNIGCNMGNQY-GFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNII-INKEDG-TGYIRFEFLVD 987
            Y+ ++ +  L + +++  L +    Y+D              P L I P+ + +  I  Y      ++ ++V  L +++  Y   V+  +   C  +  +         ++PK SC+F   +      + ++Y G+D+G+PC++I+LNR+ G +P    +              I C    D D + +G + Y+                        G     Y+PY   K Q++Y  P + +KF  +  N  I V+C  I NNI  +N+ D   G + F+  ++
Sbjct:   41 YIFLAGMFILTMYVMLLTLDDNKPTYQD----------RLATPGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYNDSVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLPGKDGQ-----------APSISCAPKID-DTDKMGEVAYFPRN---------------------GTFNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKIIANNIPNLNERDKFAGRVSFKLRIN 281          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:103031172])

HSP 1 Score: 59.6918 bits (143), Expect = 8.333e-10
Identity = 62/280 (22.14%), Postives = 108/280 (38.57%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRD-VPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLL--DCTHNVAYIDH---------PKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPD--FGDELVDNSTQNGFP--TIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQL---SYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            Y  ++ +    +  L+  L+NY   ++D + P           P L+  PR D   S + +      TY  Y   +  +++ Y    +R ++   DC        H          + +C+F    LG        ++GF +G+PC++++LNRI  + P     +E +    Q+      I I C    + D+  +G + YY          G  P Q              YYPY  +L    Y  P + V+F  L  N  + ++C     NI  + +D
Sbjct:   42 YGFLAGIFIGTIQALLLTLSNYKPTWQDRIAP-----------PGLTHTPRSDK--SELSFSVNDVETYLKYTKSMREFLEAYNEETQRDQMKFEDCGDQPQEYKHRGDLESDIGARKACRFQRTFLGPCSGIEDKEFGFSEGKPCLIVKLNRIVNFKPKPPLTNESIPEEAQHKIQRNVIPIYCHNKREEDEGKLGEVKYYG-------IGGGFPLQ--------------YYPYYGKLLHPQYLQPLVAVQFVNLTMNYELRIECKVFGENIHYSDKD 287          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Nematostella
Match: EDO32320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE8])

HSP 1 Score: 59.3066 bits (142), Expect = 4.846e-10
Identity = 63/264 (23.86%), Postives = 110/264 (41.67%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSR------LLDCTHNVAYIDHPKFSCKFSLDLGNIG-C---NMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNI 933
            YL ++      L I +  L + A    D P L+     +  +P L+ +P     + I  Y   K  +Y+S+V D+ +++  Y R    ++        + T         K  C+F  DL N+G C     G +YGFD G PC  +R+N+++ ++P+           +G   IK++C+   D+ K N+  +  Y EE+                          +YPY+ + ++  P I V+ N         V+C A+  NI
Sbjct:   55 YLCLAGFFAAMLSIFLSTLPDRA----DGPKLT---QYIAGKPVLNPVPS----NKIEGYDPNKASSYSSHVSDINSFLNQYVRQGGANKDQFAPDFCNGTSGEPRPKDAKKQCRF--DLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNFVPE---------PNSGLSYIKVECD-AKDSSKNNL--IKVYPEENPGWPVS--------------------FYPYRMEDNWLAPVIAVQVNTTS---TTEVRCRALGKNI 270          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 64.3142 bits (155), Expect = 2.096e-11
Identity = 63/273 (23.08%), Postives = 115/273 (42.12%), Query Frame = 1
Query:  217 MFALANYAVLYR--DVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAY--------IDHPKFSCKFSLDLGNIGCNMGNQY-GFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIII--NKEDGTGYIRFEFLVD 987
            +FAL  Y +L    D  P   D+      P + I P  D    I+ Y  +   ++  Y   L  ++  Y   ++  +  +CT +  +         ++PK SC+F+  +      + ++Y G+ +GQPC++I++NR+ G +P    +           T  + C    D D + +G L Y            F P+         G     YYPY   K Q++Y  P + VKF  +  N  + ++C    NNI +  +++   G + F+  ++
Sbjct:   46 LFALTMYIMLQTLDDHKPTWQDRLAT---PGMVIRPNTDETFEIV-YNIQNTESWDMYAQALDKFLAPYNDTLQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQ-----------TPSVTCAAKRD-DSDKLGELVY------------FPPN---------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKINANNIPLGGDRDKFAGRVSFKLRIN 281          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 60.8474 bits (146), Expect = 3.551e-10
Identity = 64/270 (23.70%), Postives = 113/270 (41.85%), Query Frame = 1
Query:  217 MFALANYAVLYR--DVPPLSGDQSLLKLQPSLSILPRPDSLSSII-----KYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQY-GFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIII--NKEDGTGYIRFEFLVD 987
            +FAL  Y +L    D  P   D+      P + I P  D    I+        W   Y  A   +D     +N+E   ++    + + +V   ++PK SC+F+  +      + ++Y G+ +GQPC++I++NR+ G +P    +           T  + C    D D + +G L Y            F P+         G     YYPY   K Q++Y  P + VKF  +  N  + ++C    NNI +  +++   G + F+  ++
Sbjct:   46 LFALTMYIMLQTLDDHKPTWQDRLAT---PGMVIRPNTDETFEIVYNIQNTESWDIFYIKADSYNDTLQAQKNHECTPDQYFQQEDSGDVK--NNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPGKDGQ-----------TPSVTCAAKRD-DSDKLGELVY------------FPPN---------GTFNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKINANNIPLGGDRDKFAGRVSFKLRIN 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:101166353])

HSP 1 Score: 59.6918 bits (143), Expect = 9.714e-10
Identity = 58/237 (24.47%), Postives = 97/237 (40.93%), Query Frame = 1
Query:  298 PSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYE--RHVERSRLLDCTHNVA-YIDHPKF--------SCKFSLDL-GNIGCNMGNQYGFDDGQPCVLIRLNRIYGW---IPDFGDELVDNSTQNGFPT-IKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPY---KKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            P LS  P+ D     + Y  +   TY  +   L  ++  Y+  + ++ S+  +C    A Y +            +C+FS  L G         +GF DG+PCV+++LNRI  +    P   D + + +     P  I + C    + D + IG + YY          G  P Q              YYPY   +    Y  P + V+F  L +N+ + ++C    +NI  N++D
Sbjct:   73 PGLSHTPKLDKAE--VSYSIKGIETYLPFTKTLREFVSQYDDSKQLDASKFENCPAEPADYKERGTLDDNAGVRKACRFSRTLLGPCSGLEDETFGFKDGKPCVIVKLNRIVNFRPRPPSSNDSIPEEAWPKVQPNLIPLFCTNKREEDADKIGEIKYYG-------INGGFPLQ--------------YYPYYGKRLHPHYLQPLVAVQFTNLTQNMELRIECKVFGDNIDYNEKD 286          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b1a (sodium/potassium-transporting ATPase subunit beta-233 [Source:NCBI gene;Acc:101164636])

HSP 1 Score: 58.151 bits (139), Expect = 3.379e-9
Identity = 75/299 (25.08%), Postives = 115/299 (38.46%), Query Frame = 1
Query:  136 GRLIAHILKRFAYLLVSNVIWLGLGI-----LMFALANYAVLYRD-VPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYE--RHVERSRLLDCTHN---------VAYIDHPKFSCKFSLD-LGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPD-------FGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQL--SYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKED 951
            GR      K F + L+      G+ I     L+  L+NY   Y+D V P           P LS  PR D   S I ++     T+  YV  +   +  Y+  R   + +   C  N         +      + SC+F    LG+      N YGF +G+PC++++LNRI  + P          + L   S  N  P   + C+     D   IG + Y+          GF     GG     G    YY  Y KQL  +Y  P + ++F  L     + + C    +NI  +++D
Sbjct:   26 GRTGCSWFKIFMFYLIFYGCLAGIFIGTIQALLLTLSNYKPTYQDRVAP-----------PGLSHTPRSDK--SEISFKMSDNSTFKKYVDSMNELLLKYDEDRQTAQGKYESCGENPDTYKEQGGLEEGSGQRTSCRFLRKWLGDCSGLTDNTYGFKEGKPCLIVKLNRIVFFRPKGPSNNSTLPEALQGKSYNNLIP---VYCKNKRPEDASKIGEIKYF----------GF-----GG-----GFPLQYYPYYGKQLHPNYLQPLVAIQFTNLTIGEDLRIDCRVFGDNIAYSEKD 288          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:101157248])

HSP 1 Score: 56.225 bits (134), Expect = 9.942e-9
Identity = 43/168 (25.60%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  172 YLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYI-DHP----KFSCKFSLDLGNIGCNMGN-QYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFP 657
            Y  ++ +  L + +L+F L +Y   YRD  P  G            ++ RP+SL   I +       YA YV  L  +++ Y    +     +C     Y+ D P    + +C F   L +    + +  YG+ +G+PCV++++NRI G  PD G+  ++ + +   P
Sbjct:   48 YCFLAGLFALTMWVLLFTLDDYVPKYRDRVPYPG------------LVIRPNSLD--ISFNKSDPLKYAQYVQHLEKFLERYNDSAQEKNE-NCISGEFYLQDGPISMVRRACPFRRALLSFCSGLSDTNYGYQEGKPCVILKMNRIIGLKPD-GEPYINCTVKKDHP 199          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000022447.1 (SMESG000022447.1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 304/306 (99.35%), Postives = 305/306 (99.67%), Query Frame = 1
Query:   70 MKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            MKQNEKAKQTVLLRSVV+KLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGY RFEFLVD
Sbjct:    1 MKQNEKAKQTVLLRSVVKKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYSRFEFLVD 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000022444.1 (SMESG000022444.1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 304/306 (99.35%), Postives = 305/306 (99.67%), Query Frame = 1
Query:   70 MKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            MKQNEKAKQTVLLRSVV+KLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGY RFEFLVD
Sbjct:    1 MKQNEKAKQTVLLRSVVKKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYSRFEFLVD 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000022450.1 (SMESG000022450.1)

HSP 1 Score: 442.58 bits (1137), Expect = 4.461e-157
Identity = 200/306 (65.36%), Postives = 250/306 (81.70%), Query Frame = 1
Query:   70 MKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            M+Q    K    L    R ++NG+    +LK   +  +   + LG  ILMF LA +  LYRD PPL+G+QS L LQP LS+LPRPDSL+S+I+Y+  +R++Y SYVHDL+++IQNYERH ERSRLLDCTH+V+YIDHPKFSCKFSLD+GNIGCNMGNQYGFD+ QPC+LIRLNR+ GW+P FG++ V+ + QNG+PTIKIKCEG++D DK+N+G +CYYDEESALR+TE  LP+Q+GGCSEE+GQIRNYY+PYKKQLSYQ PF+WVKFNE++RNVV+MVQCW IV+NI +N EDGTGYIRFE L D
Sbjct:    1 MRQFFAVKPHGKLSLKFRNMVNGKYYFSVLKIILFHFIQYNLLLGFTILMFTLAIFLYLYRDFPPLTGEQSGLNLQPELSVLPRPDSLTSLIRYKIGQRHSYGSYVHDLYSFIQNYERHRERSRLLDCTHHVSYIDHPKFSCKFSLDVGNIGCNMGNQYGFDEAQPCILIRLNRVIGWMPGFGEDSVNTTNQNGYPTIKIKCEGISDFDKDNVGKICYYDEESALRKTEELLPNQDGGCSEEFGQIRNYYFPYKKQLSYQTPFVWVKFNEVRRNVVVMVQCWPIVDNIKVNSEDGTGYIRFEILAD 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000022443.1 (SMESG000022443.1)

HSP 1 Score: 333.569 bits (854), Expect = 4.735e-114
Identity = 150/284 (52.82%), Postives = 206/284 (72.54%), Query Frame = 1
Query:  136 GRLIAHILKRFAYLLVSNVIWLGLGILMFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            GRL   I+KR A+L   N+I + +G+ MF L  + VL RD PPL+G +S+L+++PSL+ILPRPDSL+S I+Y+ RKRY+Y  Y+HDL+ + Q YERH+E S L DCTH  +YI+ PK+SCKFSLD  ++GC++GN YG++D  PC+L+ LNR+ GWIP+F +   ++S+ N + TIKIKCEG+ D DKEN+G +CYYDEES +      L  ++ GC+  YGQIR YYYPY KQ++YQ PF+WVK +   RNVVIM+QCWA  N++  N  +     RFE L+D
Sbjct:   25 GRLTV-IIKRIAFLTFQNLILICIGLSMFLLCEFMVLKRDYPPLTGKRSVLQMRPSLTILPRPDSLTSTIRYRNRKRYSYGKYIHDLYGFTQTYERHLENSELTDCTHFSSYINDPKYSCKFSLDKSSLGCHIGNHYGYEDLNPCILVHLNRVIGWIPEFKENEQNHSSPNRYSTIKIKCEGIHDFDKENVGKICYYDEESGIPGNYAALQSEKNGCNSNYGQIRRYYYPYIKQINYQTPFVWVKISGTTRNVVIMIQCWAFTNDVESNINEEFPNARFEILID 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Match: SMESG000022427.1 (SMESG000022427.1)

HSP 1 Score: 317.775 bits (813), Expect = 1.227e-108
Identity = 144/257 (56.03%), Postives = 198/257 (77.04%), Query Frame = 1
Query:  217 MFALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRYTYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGNIGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKIKCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYYYPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIRFEFLVD 987
            MF LAN+AVL RD+P L G  S+L +QPSLS+LPRPDSL+S++KY+  KRY+Y SYV+DLF++ Q YERH ++S+LLDC+ NVAY+D+ +FSC+F LD+G +GCN+G  +G+ +  PC L++LNRI GW+P F  +   +S + GFPTIKIKC+GV+D+D+E+I  +CYYDEES +   +    D    C+ E+GQIR+YY+PYKKQ +YQ PF+WVK   +KR+VVIMVQCW +V+NI +N + G G +RFE LVD
Sbjct:    1 MFWLANFAVLKRDLPILIGPHSILNIQPSLSVLPRPDSLTSLVKYKTSKRYSYVSYVNDLFSFTQTYERHAQKSKLLDCSENVAYLDNMRFSCRFPLDIGFVGCNIGKTFGYGETSPCFLVKLNRIVGWVPKFSPQNFTDSDRKGFPTIKIKCDGVSDSDRESIHKICYYDEESLMNINQIGPVDL---CNYEFGQIRHYYFPYKKQENYQTPFVWVKLLSIKRHVVIMVQCWPLVDNIHVNLDRGDGSVRFEVLVD 254          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B41.891e-1323.08ATPase Na+/K+ transporting family member beta 4 [S... [more]
ATP1B42.204e-1323.08ATPase Na+/K+ transporting family member beta 4 [S... [more]
ATP1B12.386e-1323.91ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B12.386e-1323.91ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B42.963e-1324.36ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-14.784e-2826.67Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-14.784e-2826.67Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-14.784e-2826.67Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-33.484e-2529.08Probable sodium/potassium-transporting ATPase subu... [more]
nkb-33.674e-2529.08Probable sodium/potassium-transporting ATPase subu... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv21.228e-2125.26gene:FBgn0015777 transcript:FBtr0079382[more]
nrv21.228e-2125.26gene:FBgn0015777 transcript:FBtr0079383[more]
nrv21.228e-2125.26gene:FBgn0015777 transcript:FBtr0100381[more]
nrv21.643e-2125.26gene:FBgn0015777 transcript:FBtr0100382[more]
nrv21.643e-2125.26gene:FBgn0015777 transcript:FBtr0079381[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b7.244e-1424.81ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2b7.244e-1424.81ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2a1.232e-1224.48ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b1a1.477e-1225.41ATPase Na+/K+ transporting subunit beta 1a [Source... [more]
atp1b2a1.844e-1224.48ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam151a5.573e-1526.74family with sequence similarity 151 member A [Sour... [more]
ATP1B43.831e-1426.48pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B44.059e-1426.48pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
ATP1B44.430e-1426.48pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
tpst23.366e-1027.31tyrosylprotein sulfotransferase 2 [Source:Xenbase;... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1b41.722e-1523.63ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp1b42.709e-1524.54ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp1b16.733e-1324.11ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
Atp4b2.680e-1223.00ATPase, H+/K+ exchanging, beta polypeptide [Source... [more]
Atp1b22.763e-1223.27ATPase, Na+/K+ transporting, beta 2 polypeptide [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93235|AT1B1_CAEEL6.086e-2726.67Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|Q9XUY5|AT1B3_CAEEL4.673e-2429.08Probable sodium/potassium-transporting ATPase subu... [more]
sp|A8X4W9|AT1B3_CAEBR2.667e-2328.29Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q24048|ATPB2_DROME1.647e-2025.26Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|P25169|AT1B1_ARTSF6.236e-1823.37Sodium/potassium-transporting ATPase subunit beta ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8X5A77.444e-5133.92Sodium / potassium ATPase beta chain OS=Opisthorch... [more]
A0A074Z9B51.867e-5034.39Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KQR51.125e-4933.57Sodium/potassium-transporting ATPase subunit beta-... [more]
A0A4S2LHE13.925e-4933.22Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NXR58.428e-4731.99Sodium/potassium-transporting ATPase subunit beta ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2a2.986e-1322.98sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b5.653e-1324.22sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b1.795e-1223.00sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b7.884e-1221.33sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1b8.333e-1022.14sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323204.846e-1023.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b2.096e-1123.08ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b2b3.551e-1023.70ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b1b9.714e-1024.47sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1a3.379e-925.08sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3a9.942e-925.60ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022447.10.000e+099.35SMESG000022447.1[more]
SMESG000022444.10.000e+099.35SMESG000022444.1[more]
SMESG000022450.14.461e-15765.36SMESG000022450.1[more]
SMESG000022443.14.735e-11452.82SMESG000022443.1[more]
SMESG000022427.11.227e-10856.03SMESG000022427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006312 ID=SMED30006312|Name=Sodium/potassium-transporting ATPase subunit beta-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1015bp
AAAAAAACTCACTTTTTTGTGTTTTACTCTTATCGCTAAAACTCTTTTCC
AAAAGCTTCGTTGATTGGTATGAAACAAAATGAAAAAGCTAAACAAACCG
TACTCTTGAGATCAGTTGTGAGGAAGCTATTAAATGGCCGATTAATTGCA
CATATTTTGAAAAGGTTTGCTTACTTATTGGTGTCCAATGTCATTTGGTT
GGGATTAGGCATCCTTATGTTTGCACTGGCAAACTATGCAGTATTATACC
GGGATGTTCCACCTCTTTCGGGGGATCAATCTTTGTTGAAATTGCAGCCG
AGTTTGTCAATATTACCCCGGCCGGATTCTTTGTCGTCGATCATAAAATA
TCAGTGGAGGAAACGTTATACTTATGCAAGTTATGTGCATGATCTATTTG
CATATATTCAAAATTATGAGAGACATGTCGAACGATCAAGACTGCTAGAC
TGTACTCATAATGTTGCATATATAGATCATCCAAAATTTTCTTGCAAGTT
TTCTCTTGATTTAGGAAATATAGGATGCAATATGGGAAACCAGTATGGTT
TTGACGATGGTCAGCCATGTGTCTTGATTCGTTTGAATAGAATTTACGGT
TGGATTCCGGATTTCGGAGATGAATTGGTTGATAATTCCACACAAAATGG
GTTTCCTACAATCAAAATCAAGTGCGAAGGAGTAACCGATGCAGATAAGG
AAAATATAGGCTCGCTATGCTATTATGATGAAGAATCTGCACTTAGACGA
ACAGAAGGATTCCTTCCAGATCAAGAAGGAGGATGCAGTGAAGAATATGG
GCAAATAAGAAATTATTATTATCCATATAAAAAACAATTGAGCTACCAAA
TTCCATTCATATGGGTGAAATTTAATGAACTGAAAAGAAACGTTGTAATC
ATGGTCCAGTGTTGGGCTATTGTGAACAATATCATTATAAATAAAGAAGA
TGGGACAGGATATATTCGTTTCGAATTCCTAGTAGACTAATTATAAACAT
TTATTGATAGTAAAC
back to top

protein sequence of SMED30006312-orf-1

>SMED30006312-orf-1 ID=SMED30006312-orf-1|Name=SMED30006312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MKQNEKAKQTVLLRSVVRKLLNGRLIAHILKRFAYLLVSNVIWLGLGILM
FALANYAVLYRDVPPLSGDQSLLKLQPSLSILPRPDSLSSIIKYQWRKRY
TYASYVHDLFAYIQNYERHVERSRLLDCTHNVAYIDHPKFSCKFSLDLGN
IGCNMGNQYGFDDGQPCVLIRLNRIYGWIPDFGDELVDNSTQNGFPTIKI
KCEGVTDADKENIGSLCYYDEESALRRTEGFLPDQEGGCSEEYGQIRNYY
YPYKKQLSYQIPFIWVKFNELKRNVVIMVQCWAIVNNIIINKEDGTGYIR
FEFLVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006813potassium ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 58..296
e-value: 1.2E-36
score: 126.3
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 245..303
coord: 45..222
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 2..306
e-value: 1.7E-48
score: 167.5
NoneNo IPR availableTMHMMTMhelixcoord: 36..58