NAD kinase-like Protein

Overview
NameNAD kinase-like Protein
Smed IDSMED30006308
Length (bp)1282
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NAD kinase-like Protein (SMED30006308) t-SNE clustered cells

Violin plots show distribution of expression levels for NAD kinase-like Protein (SMED30006308) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NAD kinase-like Protein (SMED30006308) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NAD kinase-like Protein (SMED30006308) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006308

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006308SMESG000031598.1 SMESG000029643.1 dd_Smed_v4_8020_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006308SMESG000031598.1 SMESG000029643.1 dd_Smed_v4_8020_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NAD kinase-like Protein vs. Ensembl Human
Match: NADK (NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831])

HSP 1 Score: 185.652 bits (470), Expect = 1.027e-53
Identity = 134/347 (38.62%), Postives = 212/347 (61.10%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W+K P ++L+I+K ++  ++   F +L  +L+ +E  IV++E + ++D    I +  +   + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E F+  +   ++G+   +LR+RL   +       KT + NG  E N +  A               LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++ 
Sbjct:   65 RLTWNKSPKSVLVIKK-MRDASLLQPFKELCTHLM-EENMIVYVEKKVLED--PAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGE-NGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHF 404          
BLAST of NAD kinase-like Protein vs. Ensembl Human
Match: NADK (NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831])

HSP 1 Score: 186.037 bits (471), Expect = 1.664e-53
Identity = 134/347 (38.62%), Postives = 212/347 (61.10%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W+K P ++L+I+K ++  ++   F +L  +L+ +E  IV++E + ++D    I +  +   + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E F+  +   ++G+   +LR+RL   +       KT + NG  E N +  A               LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++ 
Sbjct:   97 RLTWNKSPKSVLVIKK-MRDASLLQPFKELCTHLM-EENMIVYVEKKVLED--PAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGE-NGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHF 436          
BLAST of NAD kinase-like Protein vs. Ensembl Human
Match: NADK (NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831])

HSP 1 Score: 186.037 bits (471), Expect = 1.664e-53
Identity = 134/347 (38.62%), Postives = 212/347 (61.10%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W+K P ++L+I+K ++  ++   F +L  +L+ +E  IV++E + ++D    I +  +   + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E F+  +   ++G+   +LR+RL   +       KT + NG  E N +  A               LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++ 
Sbjct:   97 RLTWNKSPKSVLVIKK-MRDASLLQPFKELCTHLM-EENMIVYVEKKVLED--PAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGE-NGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHF 436          
BLAST of NAD kinase-like Protein vs. Ensembl Human
Match: NADK (NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831])

HSP 1 Score: 173.326 bits (438), Expect = 1.181e-47
Identity = 135/387 (34.88%), Postives = 213/387 (55.04%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLK----------------------------------------QEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSD---VEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W+K P ++L+I+K ++  ++   F +L  +L++                                        QE  IV++E + ++D    I +  +   + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E F+  +   ++G+   +LR+RL   +       KT + NG  E N +  A               LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++ 
Sbjct:  201 RLTWNKSPKSVLVIKK-MRDASLLQPFKELCTHLMEARGAGGKGAWGAHGVGGASIHITAPRVGSAGGMSRLALCFQENMIVYVEKKVLED--PAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGE-NGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHF 581          
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Match: CG33156 (gene:FBgn0053156 transcript:FBtr0087681)

HSP 1 Score: 188.734 bits (478), Expect = 1.509e-55
Identity = 132/339 (38.94%), Postives = 209/339 (61.65%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCI----QDINYDNKTGISNGKPECNPAN---IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            RL+W K P  +L+I+K +   ++   F+ L+ +LL+++  +V++E   ++D+  ++  +   K +  K+  F    D     ID I+ LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F+E L + L+G     LR+RL  C+     D  ++ KT  ++   E  PA    + LN++VIDRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+ AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + P+++  T+ +SFDG NR   +     + +T S +PV  +C  DQ+ DWF  L   L+WN +     L
Sbjct:   17 RLTWYKPPLTVLVIKK-VSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDV--QLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRL-RCVMHRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESR-NTSWVSFDGRNRQ-ELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCL 349          
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Match: CG33156 (gene:FBgn0053156 transcript:FBtr0087682)

HSP 1 Score: 189.504 bits (480), Expect = 5.018e-55
Identity = 132/339 (38.94%), Postives = 209/339 (61.65%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCI----QDINYDNKTGISNGKPECNPAN---IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            RL+W K P  +L+I+K +   ++   F+ L+ +LL+++  +V++E   ++D+  ++  +   K +  K+  F    D     ID I+ LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F+E L + L+G     LR+RL  C+     D  ++ KT  ++   E  PA    + LN++VIDRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+ AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + P+++  T+ +SFDG NR   +     + +T S +PV  +C  DQ+ DWF  L   L+WN +     L
Sbjct:   96 RLTWYKPPLTVLVIKK-VSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDV--QLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRL-RCVMHRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESR-NTSWVSFDGRNRQ-ELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCL 428          
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Match: CG33156 (gene:FBgn0053156 transcript:FBtr0113450)

HSP 1 Score: 189.119 bits (479), Expect = 6.424e-55
Identity = 132/339 (38.94%), Postives = 209/339 (61.65%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCI----QDINYDNKTGISNGKPECNPAN---IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            RL+W K P  +L+I+K +   ++   F+ L+ +LL+++  +V++E   ++D+  ++  +   K +  K+  F    D     ID I+ LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F+E L + L+G     LR+RL  C+     D  ++ KT  ++   E  PA    + LN++VIDRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+ AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + P+++  T+ +SFDG NR   +     + +T S +PV  +C  DQ+ DWF  L   L+WN +     L
Sbjct:   92 RLTWYKPPLTVLVIKK-VSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDV--QLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRL-RCVMHRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESR-NTSWVSFDGRNRQ-ELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCL 424          
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Match: CG33156 (gene:FBgn0053156 transcript:FBtr0087684)

HSP 1 Score: 187.963 bits (476), Expect = 1.914e-54
Identity = 132/339 (38.94%), Postives = 209/339 (61.65%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCI----QDINYDNKTGISNGKPECNPAN---IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            RL+W K P  +L+I+K +   ++   F+ L+ +LL+++  +V++E   ++D+  ++  +   K +  K+  F    D     ID I+ LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F+E L + L+G     LR+RL  C+     D  ++ KT  ++   E  PA    + LN++VIDRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+ AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + P+++  T+ +SFDG NR   +     + +T S +PV  +C  DQ+ DWF  L   L+WN +     L
Sbjct:   95 RLTWYKPPLTVLVIKK-VSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDV--QLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRL-RCVMHRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESR-NTSWVSFDGRNRQ-ELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCL 427          
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Match: CG33156 (gene:FBgn0053156 transcript:FBtr0087683)

HSP 1 Score: 188.348 bits (477), Expect = 2.503e-54
Identity = 132/339 (38.94%), Postives = 209/339 (61.65%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCI----QDINYDNKTGISNGKPECNPAN---IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            RL+W K P  +L+I+K +   ++   F+ L+ +LL+++  +V++E   ++D+  ++  +   K +  K+  F    D     ID I+ LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F+E L + L+G     LR+RL  C+     D  ++ KT  ++   E  PA    + LN++VIDRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+ AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + P+++  T+ +SFDG NR   +     + +T S +PV  +C  DQ+ DWF  L   L+WN +     L
Sbjct:  132 RLTWYKPPLTVLVIKK-VSDASVLAPFVYLVDWLLQEKNMVVWVESAVLEDV--QLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRL-RCVMHRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPESR-NTSWVSFDGRNRQ-ELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKRQKCL 464          
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Match: nadkb (NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433])

HSP 1 Score: 184.496 bits (467), Expect = 7.778e-53
Identity = 127/352 (36.08%), Postives = 198/352 (56.25%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXK---ASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL--------------CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENS 1175
            RL+W K P N+L+IRK ++ E +   F +L  +L++++  +V++E + + D    + +  +   +  ++  F    D   D I  +   G       AS  F+   PP+MAF+LG+LGF+ PF  E FK  +    +G+   ILR+RL               F  Q+        ISN   +       LN++V+DRG S+++ ++ + +D  ++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A++VTPI   SLS RPI++P G++L + + PDA+  TA +SFDG  R   I     + IT S FPV S+C  D + DWF  L  CL+WN +K ++ L  + +S
Sbjct:  121 RLTWSKPPLNVLVIRK-IRDETLLEPFKELCRFLVEEKHLMVYVEKKVVDD--GSLMSDESFSAICNQLCTFREGYDDISDCIDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESFKTEVDKVFEGNAAIILRSRLKVKVVKGMFQRNEQLFTTQENGVVPHNHISNEAGKITLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPHSLSFRPIVVPAGVELMITLSPDAR-NTAWVSFDGRKRQ-EIQHGDSIKITTSCFPVPSICCHDLVYDWFDSLAQCLHWNVRKKQTRLTDASDS 467          
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Match: nadkb (NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433])

HSP 1 Score: 184.496 bits (467), Expect = 7.778e-53
Identity = 127/352 (36.08%), Postives = 198/352 (56.25%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXK---ASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL--------------CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENS 1175
            RL+W K P N+L+IRK ++ E +   F +L  +L++++  +V++E + + D    + +  +   +  ++  F    D   D I  +   G       AS  F+   PP+MAF+LG+LGF+ PF  E FK  +    +G+   ILR+RL               F  Q+        ISN   +       LN++V+DRG S+++ ++ + +D  ++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A++VTPI   SLS RPI++P G++L + + PDA+  TA +SFDG  R   I     + IT S FPV S+C  D + DWF  L  CL+WN +K ++ L  + +S
Sbjct:  121 RLTWSKPPLNVLVIRK-IRDETLLEPFKELCRFLVEEKHLMVYVEKKVVDD--GSLMSDESFSAICNQLCTFREGYDDISDCIDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESFKTEVDKVFEGNAAIILRSRLKVKVVKGMFQRNEQLFTTQENGVVPHNHISNEAGKITLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPHSLSFRPIVVPAGVELMITLSPDAR-NTAWVSFDGRKRQ-EIQHGDSIKITTSCFPVPSICCHDLVYDWFDSLAQCLHWNVRKKQTRLTDASDS 467          
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Match: nadka (NAD kinase a [Source:ZFIN;Acc:ZDB-GENE-050417-39])

HSP 1 Score: 156.377 bits (394), Expect = 4.620e-45
Identity = 84/208 (40.38%), Postives = 133/208 (63.94%), Query Frame = 3
Query:  576 GSIPCILRNRLCFCI------QDINYDNKTGISNGKPECNPANI---ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSE 1169
            G+   +LR+RL   +      +    +N   ++NG  E N   +    LN++VIDRG S+++ ++ + +D +++T + GDG+++STPTGSTAY++AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ +  DA+  TA +S DG  R   I+    + IT S FP+ S+C  D + DWF+ L  CL+WN +K +S+L   E
Sbjct:    2 GNAALVLRSRLQVTVVKAVREKGPAEENSLKLTNGDAEPNHKTMQYQVLNEVVIDRGPSSYLSNVDLFLDGHLITTVQGDGVLVSTPTGSTAYAVAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSQDAR-NTAWVSLDGRRRQ-EIACGDSITITTSCFPLPSICFRDPVNDWFESLAQCLHWNVRKKQSHLCLEE 207          
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Match: nadkb (NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433])

HSP 1 Score: 110.923 bits (276), Expect = 1.266e-27
Identity = 84/254 (33.07%), Postives = 138/254 (54.33%), Query Frame = 3
Query:  117 AYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXX---XXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL--------------CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAY 827
             Y  +FP+     +  +  RL+W K P N+L+IRK ++ E +   F +L  +L++++  +V++E + + D    + +  +   +  ++  F    D   D   +II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E FK  +    +G+   ILR+RL               F  Q+        ISN   +       LN++V+DRG S+++ ++ + +D  ++T + GDG+I+STPTGSTAY
Sbjct:    3 TYSVDFPRRHI--QDPASQRLTWSKPPLNVLVIRK-IRDETLLEPFKELCRFLVEEKHLMVYVEKKVVDD--GSLMSDESFSAICNQLCTFREGYDDISDCIDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESFKTEVDKVFEGNAAIILRSRLKVKVVKGMFQRNEQLFTTQENGVVPHNHISNEAGKITLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAY 251          
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Match: nadkb (NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433])

HSP 1 Score: 76.2554 bits (186), Expect = 1.880e-15
Identity = 66/207 (31.88%), Postives = 108/207 (52.17%), Query Frame = 3
Query:  165 SGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXX---XXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL--------------CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHI 734
            +  RL+W K P N+L+IRK ++ E +   F +L  +L++++  +V++E + + D    + +  +   +  ++  F    D   D   +II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E FK  +    +G+   ILR+RL               F  Q+        ISN   +       LN++V+DRG S+++
Sbjct:   20 ASQRLTWSKPPLNVLVIRK-IRDETLLEPFKELCRFLVEEKHLMVYVEKKVVDD--GSLMSDESFSAICNQLCTFREGYDDISDCIDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESFKTEVDKVFEGNAAIILRSRLKVKVVKGMFQRNEQLFTTQENGVVPHNHISNEAGKITLQLQVLNEVVVDRGPSSYL 223          
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Match: nadk (NAD kinase [Source:NCBI gene;Acc:448246])

HSP 1 Score: 191.045 bits (484), Expect = 3.599e-56
Identity = 135/350 (38.57%), Postives = 214/350 (61.14%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNG--------KPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENSD 1178
            L+W+K P ++L+I+K ++  ++   F +L  +L +++  IV++E + ++D    I        + KK   F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF+ + F+  +   ++G+   +LR+RL   +   + + KT + NG        K E  P        LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + PDA+  TA +SFDG  R   IS    + IT S +PV S+C  D + DWF  L  CL+WN +K +++    E  D
Sbjct:   23 LTWNKPPKSVLVIKK-VRDASLLKPFKELCVFLTEEKNMIVYVEKKVLED--PAIANDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQDSVPPVMAFHLGSLGFLTPFNFDNFQTQVTQVIEGNAALVLRSRLKVKVSKEHKEKKTVLQNGVEENGLIVKSEKEPIKQTKYQVLNEVVVDRGPSSYLSNVDVFLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPDAR-NTAWVSFDGRKRQ-EISHGDSISITTSCYPVPSICFRDPVNDWFDSLAECLHWNVRKKQNHFTEEEEED 367          
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Match: nadk (NAD kinase [Source:NCBI gene;Acc:448246])

HSP 1 Score: 191.43 bits (485), Expect = 6.119e-56
Identity = 135/350 (38.57%), Postives = 214/350 (61.14%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNG--------KPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENSD 1178
            L+W+K P ++L+I+K ++  ++   F +L  +L +++  IV++E + ++D    I        + KK   F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF+ + F+  +   ++G+   +LR+RL   +   + + KT + NG        K E  P        LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + PDA+  TA +SFDG  R   IS    + IT S +PV S+C  D + DWF  L  CL+WN +K +++    E  D
Sbjct:   57 LTWNKPPKSVLVIKK-VRDASLLKPFKELCVFLTEEKNMIVYVEKKVLED--PAIANDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQDSVPPVMAFHLGSLGFLTPFNFDNFQTQVTQVIEGNAALVLRSRLKVKVSKEHKEKKTVLQNGVEENGLIVKSEKEPIKQTKYQVLNEVVVDRGPSSYLSNVDVFLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPDAR-NTAWVSFDGRKRQ-EISHGDSISITTSCYPVPSICFRDPVNDWFDSLAECLHWNVRKKQNHFTEEEEED 401          
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Match: nadk (NAD kinase [Source:NCBI gene;Acc:448246])

HSP 1 Score: 191.43 bits (485), Expect = 6.295e-56
Identity = 135/350 (38.57%), Postives = 214/350 (61.14%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNG--------KPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENSD 1178
            L+W+K P ++L+I+K ++  ++   F +L  +L +++  IV++E + ++D    I        + KK   F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF+ + F+  +   ++G+   +LR+RL   +   + + KT + NG        K E  P        LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + PDA+  TA +SFDG  R   IS    + IT S +PV S+C  D + DWF  L  CL+WN +K +++    E  D
Sbjct:   56 LTWNKPPKSVLVIKK-VRDASLLKPFKELCVFLTEEKNMIVYVEKKVLED--PAIANDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQDSVPPVMAFHLGSLGFLTPFNFDNFQTQVTQVIEGNAALVLRSRLKVKVSKEHKEKKTVLQNGVEENGLIVKSEKEPIKQTKYQVLNEVVVDRGPSSYLSNVDVFLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPDAR-NTAWVSFDGRKRQ-EISHGDSISITTSCYPVPSICFRDPVNDWFDSLAECLHWNVRKKQNHFTEEEEED 400          
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Match: nadk (NAD kinase [Source:NCBI gene;Acc:448246])

HSP 1 Score: 191.815 bits (486), Expect = 9.140e-56
Identity = 135/350 (38.57%), Postives = 214/350 (61.14%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNG--------KPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENSD 1178
            L+W+K P ++L+I+K ++  ++   F +L  +L +++  IV++E + ++D    I        + KK   F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF+ + F+  +   ++G+   +LR+RL   +   + + KT + NG        K E  P        LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + PDA+  TA +SFDG  R   IS    + IT S +PV S+C  D + DWF  L  CL+WN +K +++    E  D
Sbjct:   97 LTWNKPPKSVLVIKK-VRDASLLKPFKELCVFLTEEKNMIVYVEKKVLED--PAIANDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQDSVPPVMAFHLGSLGFLTPFNFDNFQTQVTQVIEGNAALVLRSRLKVKVSKEHKEKKTVLQNGVEENGLIVKSEKEPIKQTKYQVLNEVVVDRGPSSYLSNVDVFLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPDAR-NTAWVSFDGRKRQ-EISHGDSISITTSCYPVPSICFRDPVNDWFDSLAECLHWNVRKKQNHFTEEEEED 441          
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Match: nadk (NAD kinase [Source:NCBI gene;Acc:448246])

HSP 1 Score: 187.193 bits (474), Expect = 5.353e-54
Identity = 136/351 (38.75%), Postives = 213/351 (60.68%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEK-FIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNG--------KPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSENSD 1178
            L+W+K P ++L+I+K ++  ++   F +L  +L +  K  IV++E + ++D    I        + KK   F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF+ + F+  +   ++G+   +LR+RL   +   + + KT + NG        K E  P        LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + PDA+  TA +SFDG  R   IS    + IT S +PV S+C  D + DWF  L  CL+WN +K +++    E  D
Sbjct:   98 LTWNKPPKSVLVIKK-VRDASLLKPFKELCVFLTEVSKNMIVYVEKKVLED--PAIANDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQDSVPPVMAFHLGSLGFLTPFNFDNFQTQVTQVIEGNAALVLRSRLKVKVSKEHKEKKTVLQNGVEENGLIVKSEKEPIKQTKYQVLNEVVVDRGPSSYLSNVDVFLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPDAR-NTAWVSFDGRKRQ-EISHGDSISITTSCYPVPSICFRDPVNDWFDSLAECLHWNVRKKQNHFTEEEEED 443          
BLAST of NAD kinase-like Protein vs. Ensembl Mouse
Match: Nadk (NAD kinase [Source:MGI Symbol;Acc:MGI:2183149])

HSP 1 Score: 193.356 bits (490), Expect = 2.489e-57
Identity = 136/345 (39.42%), Postives = 211/345 (61.16%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSE 1169
            RL+W+K P ++L+I+K ++  ++   F +L  YL+++   IV++E + ++D    I +      + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF+ E F+  +   ++G+   ILR+RL   +     D KT I NG  E                LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS++HP V A++VTPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++    E
Sbjct:   21 RLTWNKSPKSVLVIKK-IRDASLLQPFKELCIYLMEENNMIVYVEKKVLED--PAIVSDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFNFENFQSQVNQVIEGNAAVILRSRLKVRVVKEPRDKKTAIHNGLSENGLDTEGGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIMVTPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVCDPVSDWFESLAQCLHWNVRKKQAHFPEDE 360          
BLAST of NAD kinase-like Protein vs. Ensembl Mouse
Match: Nadk (NAD kinase [Source:MGI Symbol;Acc:MGI:2183149])

HSP 1 Score: 194.512 bits (493), Expect = 6.185e-57
Identity = 137/346 (39.60%), Postives = 213/346 (61.56%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANI----------ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSE 1169
            RL+W+K P ++L+I+K ++  ++   F +L  YL+++   IV++E + ++D    I +      + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF+ E F+  +   ++G+   ILR+RL   +     D KT I NG  E N  +            LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS++HP V A++VTPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++    E
Sbjct:   97 RLTWNKSPKSVLVIKK-IRDASLLQPFKELCIYLMEENNMIVYVEKKVLED--PAIVSDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFNFENFQSQVNQVIEGNAAVILRSRLKVRVVKEPRDKKTAIHNGLSE-NGLDTEGGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIMVTPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVCDPVSDWFESLAQCLHWNVRKKQAHFPEDE 436          
BLAST of NAD kinase-like Protein vs. Ensembl Mouse
Match: Nadk (NAD kinase [Source:MGI Symbol;Acc:MGI:2183149])

HSP 1 Score: 194.512 bits (493), Expect = 6.185e-57
Identity = 137/346 (39.60%), Postives = 213/346 (61.56%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANI----------ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSE 1169
            RL+W+K P ++L+I+K ++  ++   F +L  YL+++   IV++E + ++D    I +      + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF+ E F+  +   ++G+   ILR+RL   +     D KT I NG  E N  +            LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS++HP V A++VTPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++    E
Sbjct:   97 RLTWNKSPKSVLVIKK-IRDASLLQPFKELCIYLMEENNMIVYVEKKVLED--PAIVSDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFNFENFQSQVNQVIEGNAAVILRSRLKVRVVKEPRDKKTAIHNGLSE-NGLDTEGGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIMVTPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVCDPVSDWFESLAQCLHWNVRKKQAHFPEDE 436          
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Match: sp|P58058|NADK_MOUSE (NAD kinase OS=Mus musculus OX=10090 GN=Nadk PE=1 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 4.326e-56
Identity = 137/346 (39.60%), Postives = 213/346 (61.56%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANI----------ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLHSE 1169
            RL+W+K P ++L+I+K ++  ++   F +L  YL+++   IV++E + ++D    I +      + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF+ E F+  +   ++G+   ILR+RL   +     D KT I NG  E N  +            LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS++HP V A++VTPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++    E
Sbjct:   97 RLTWNKSPKSVLVIKK-IRDASLLQPFKELCIYLMEENNMIVYVEKKVLED--PAIVSDENFGPVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFNFENFQSQVNQVIEGNAAVILRSRLKVRVVKEPRDKKTAIHNGLSE-NGLDTEGGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMVHPNVPAIMVTPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVCDPVSDWFESLAQCLHWNVRKKQAHFPEDE 436          
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Match: sp|O95544|NADK_HUMAN (NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 7.992e-53
Identity = 134/347 (38.62%), Postives = 212/347 (61.10%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA---------------LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W+K P ++L+I+K ++  ++   F +L  +L+ +E  IV++E + ++D    I +  +   + KK   F    D    +ID II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E F+  +   ++G+   +LR+RL   +       KT + NG  E N +  A               LN++VIDRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ + P+A+  TA +SFDG  R   I     + IT S +P+ S+C  D + DWF+ L  CL+WN +K +++ 
Sbjct:   97 RLTWNKSPKSVLVIKK-MRDASLLQPFKELCTHLM-EENMIVYVEKKVLED--PAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGE-NGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLSNVDVYLDGHLITTVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKIMLSPEAR-NTAWVSFDGRKRQ-EIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQCLHWNVRKKQAHF 436          
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q53NI2|NADK2_ORYSJ (Probable NAD kinase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=Os11g0191400 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 3.236e-48
Identity = 120/328 (36.59%), Postives = 184/328 (56.10%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXX--XXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGS----IPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKK 1142
            L W   P  +LL++K L  E +E A  ++  +L  QEK  V +E     D+HD     P     + + F    +SD+   +      GGDG +L AS  F+   PP+++FNLG+LGF+   + E F++ L   + G+    +   LR RL   I            NGK         LN++V+DRG++ ++  +     N+++TK+ GDG+I++TPTGSTAYS AAG S++HP V  +L TPI   SLS RP++LP   +L++ I  DA++  A +SFDG  R   +S+   V I++S+ P+ +V K+DQ  DWF+ L  CLNWN++
Sbjct:  668 LMWKSPPKTVLLLKK-LGDELMEEA-KEVASFLHHQEKMNVLVE----PDVHDIFARIPGYG--FVQTFYTQDTSDLHERVDFVACLGGDGVILHASNLFRTSVPPVVSFNLGSLGFLTSHNFEGFRQDLRAVIHGNNTLGVYITLRMRLRCEI----------FRNGKAMPGKVFDVLNEVVVDRGSNPYLSKIECYEHNHLITKVQGDGVIVATPTGSTAYSTAAGGSMVHPNVPCMLFTPICPHSLSFRPVILPDSARLELKIPDDARS-NAWVSFDGKRRQQ-LSRGDSVQISMSQHPLPTVNKSDQTGDWFRSLIRCLNWNER 975          
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q5JK52|NADK1_ORYSJ (Probable NAD kinase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0957000 PE=2 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.489e-47
Identity = 108/328 (32.93%), Postives = 182/328 (55.49%), Query Frame = 3
Query:  177 LSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESY 1154
            L W+  P  +L I K     ++ +   +++ +L + +K  V +E +  K++  +   +  ++       +  L + V++ + +   G      A+  FK   PP++AF+LG+LGFM PF  E++++ L   L G     LRNRL C  I+D   D        + E     + LN++ IDRG S+++  L    D++ VT + GDGLIIST +GSTAYSLAAG S++HP V  +L TPI   SLS RP++LP  + L+V +  +++ Q A  SFDG +R + +S    +  ++S +PV + C  D   D+ + ++  L+WN +K++S+
Sbjct:  213 LKWESSPQTVLFITKP-NSNSVHVLCAEMVRWLKEHKKINVVVEPRVSKELLTEDSYYNFIQTWDDDEEKKMLHTKVDLIVTLGGDGTVLW--AASLFKGPVPPVVAFSLGSLGFMTPFPSEQYRDCLDNVLNGPFSITLRNRLQCHVIRDAAKD--------ELETEEPILVLNEVTIDRGISSYLTYLECYCDSSFVTCVQGDGLIISTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEYVTLRVQVPHNSRGQ-AWASFDGKDRKL-LSPGDALICSISPWPVPTACLVDSTTDFLRSIHEGLHWNLRKSQSF 527          
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Match: sp|Q56YN3|NADK1_ARATH (NAD(H) kinase 1 OS=Arabidopsis thaliana OX=3702 GN=NADK1 PE=1 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 1.378e-46
Identity = 115/366 (31.42%), Postives = 198/366 (54.10%), Query Frame = 3
Query:   90 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDK------IKTHPTLKE---LYKKV-FEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNES 1151
            M + +   E   +E     T  R      L+W+ +P  +L+I K     ++ +  + ++ +L  Q+   +++E +  +++  +      ++T    KE   L+ KV     L  D            GT+L A+  FK   PPI+ F++G+LGFM PFH E++++ L   LKG I   LR+RL C  I+D            +PE     + LN++ IDRG S+++ +L    DN+ VT + GDGLI+ST +GSTAYSLAAG S++HP V  +L TPI   SLS RP++LP  + ++V +  ++++ +A +SFDG +R   +     +  +++ +PV + C+ +   D+ + ++  L+WN +K +S
Sbjct:  178 MANDQHKKEIVSFERGNISTAERSSKQISLTWESDPQTVLIITKP-NSTSVRVLSVDMVRWLRTQKGLNIYVEPRVKEELLSESSSFNFVQTWEDDKEISLLHTKVDLLITLGGD------------GTVLWAASMFKGPVPPIVPFSMGSLGFMTPFHSEQYRDCLEAILKGPISITLRHRLQCHIIRD------KATHEYEPE--ETMLVLNEVTIDRGISSYLTNLECYCDNSFVTCVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRS-SAWVSFDGKDRKQ-LEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQS 520          
BLAST of NAD kinase-like Protein vs. TrEMBL
Match: A0A2C9KTH3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067438 PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 7.713e-70
Identity = 144/370 (38.92%), Postives = 215/370 (58.11%), Query Frame = 3
Query:  147 TFSRY---ESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKD-----------IHDKIKTHPTLKELYKKV-FEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHV-EKFKESLATALKGSIPCILRNRL-CFCI-------QDINYDNKTGISNGKPE---CNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLLHSENS 1175
            TF R     S  +L+W KEP ++L++RK L  E++ I F  L+ +L++ +  +V +E   + D           + DK+ T     +L  KV F   L  D            GTLL  S  F+   PP+MAFN+G+LGF+ PF   + FK  ++  ++GS   +LR RL C  +       QDI +     + N + E        + LN++V+DRG S+++ +L + ++   VT + GDGLIISTPTGSTAY++AAGAS+IHP+V  +L+TPI   SLS RPI++P G+++KV + PDA+  TA +SFDG +R M I +   + IT S +PV S+C TDQ+ DWF GL  CLNWN +++   L + +S
Sbjct:    3 TFRRTIPDPSNQKLNWTKEPLSVLIVRKHLD-ESVMIPFRDLLIWLVEAKNMVVLVEQSVMDDRILKDDKDFQRLQDKLSTFKEDDDLTDKVDFIICLGGD------------GTLLYVSSLFQSNVPPVMAFNMGSLGFLTPFRFSDDFKTEVSKVMQGSASLLLRYRLKCVVVRHDTEPTQDIPH-----VKNIQKEDVWTKTHKLVLNEVVVDRGPSSYLCNLELYIEGRRVTSVQGDGLIISTPTGSTAYAVAAGASMIHPSVPCILLTPICPHSLSFRPIVVPAGVEIKVMLSPDARG-TAMVSFDGRDR-MEIHQGDSLRITTSNYPVPSICATDQIEDWFDGLANCLNWNIRHQQKPLQTASS 352          
BLAST of NAD kinase-like Protein vs. TrEMBL
Match: A0A087U528 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_06244 PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.002e-68
Identity = 142/345 (41.16%), Postives = 219/345 (63.48%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNE-------SYLLHSENSD 1178
            RL+W+K P  +L+I+K   L  I+  F+ L+ +L+ ++  +VF+E   + +  D ++  P+   +  K+  F    DV   +ID II LGGDGTLL AS  F+E  PP+MAF+LG+LGF+ PF  + F+E +   L+G     LR+RL  CI  I   ++TG  + KP    + + LN++V+DRG S ++ ++ + +D   VT + GDGLI+STPTGSTAY++AAGAS+IHP+V A+++TPI   SLS RPI++P G++LK+ + PD++   A +SFDG NR   +     + +T+S +P+ S+C  DQ+ DWF  L  CL+WN + +       S L+HS +SD
Sbjct:   65 RLTWNKPPLTVLVIKKIHDLSVIQ-PFISLVKWLIFEKHMLVFVEASVLDE--DYLQLSPSYSSVKDKLCTFKEGKDVLTDKIDFIICLGGDGTLLYASSLFQESVPPVMAFHLGSLGFLTPFEFDNFEEQVTNVLEGHAALTLRSRL-RCI--IVRHSETGEKSNKPHA--SFLVLNEVVVDRGPSPYLSNIDLYLDGKHVTTVQGDGLIVSTPTGSTAYAVAAGASMIHPSVPAIMITPICPHSLSFRPIVVPAGVELKIMVSPDSR-NLAWVSFDGRNRQ-ELRHGDSLRVTMSIYPIPSICAQDQISDWFDSLAECLHWNVRKKQRQLDEYSDLVHSSSSD 399          
BLAST of NAD kinase-like Protein vs. TrEMBL
Match: A0A2C9KTE1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106067438 PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.289e-68
Identity = 141/361 (39.06%), Postives = 212/361 (58.73%), Query Frame = 3
Query:  165 SGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKD-----------IHDKIKTHPTLKELYKKV-FEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHV-EKFKESLATALKGSIPCILRNRL-CFCI-------QDINYDNKTGISNGKPE---CNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLLHSENS 1175
            S  +L+W KEP ++L++RK L  E++ I F  L+ +L++ +  +V +E   + D           + DK+ T     +L  KV F   L  D            GTLL  S  F+   PP+MAFN+G+LGF+ PF   + FK  ++  ++GS   +LR RL C  +       QDI +     + N + E        + LN++V+DRG S+++ +L + ++   VT + GDGLIISTPTGSTAY++AAGAS+IHP+V  +L+TPI   SLS RPI++P G+++KV + PDA+  TA +SFDG +R M I +   + IT S +PV S+C TDQ+ DWF GL  CLNWN +++   L + +S
Sbjct:  134 SNQKLNWTKEPLSVLIVRKHLD-ESVMIPFRDLLIWLVEAKNMVVLVEQSVMDDRILKDDKDFQRLQDKLSTFKEDDDLTDKVDFIICLGGD------------GTLLYVSSLFQSNVPPVMAFNMGSLGFLTPFRFSDDFKTEVSKVMQGSASLLLRYRLKCVVVRHDTEPTQDIPH-----VKNIQKEDVWTKTHKLVLNEVVVDRGPSSYLCNLELYIEGRRVTSVQGDGLIISTPTGSTAYAVAAGASMIHPSVPCILLTPICPHSLSFRPIVVPAGVEIKVMLSPDARG-TAMVSFDGRDR-MEIHQGDSLRITTSNYPVPSICATDQIEDWFDGLANCLNWNIRHQQKPLQTASS 474          
BLAST of NAD kinase-like Protein vs. TrEMBL
Match: A0A1S3CYP3 (NAD kinase isoform X13 OS=Diaphorina citri OX=121845 GN=LOC103507804 PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.250e-67
Identity = 142/346 (41.04%), Postives = 217/346 (62.72%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANI-ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNE-------SYLLHSENSD 1178
            RL+W K P  +L+I+K   +  ++  F++L+ +L++++  +V++E   + D    + T+P+   +  K+  F    D    +ID II LGGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  E F++ +   L+G     LR+RL  CI  I   N+    + KP   P NI  LN++VIDRG S ++ ++ + +D  ++T + GDGLI+STPTGSTAY++AAGAS+IHP+V A++VTPI   SLS RPI++P G++LK+ + PD++  TA +SFDG NR   +     + +T S +PV S+C  DQ+ DWF  L  CL+WN +         S L HS ++D
Sbjct:   17 RLTWYKPPLTVLVIKKVRDVSVLQ-PFVKLVKWLIQEKSMLVYVEQSVMDDT--LLATNPSFTVVKDKLMTFRDGKDDLTDKIDFIICLGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFEFENFEDQVTNVLEGHAALTLRSRL-RCI--IMRKNEETAKDAKP---PTNILVLNEVVIDRGPSPYLSNIDLYLDGKLITSVQGDGLIVSTPTGSTAYAVAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSPDSR-NTAWVSFDGRNRQELL-HGDSLRVTTSIYPVPSICAQDQIADWFDSLGECLHWNVRKRQKHLDELSDLTHSSSND 351          
BLAST of NAD kinase-like Protein vs. TrEMBL
Match: A0A1W4X6L1 (NAD kinase-like isoform X2 OS=Agrilus planipennis OX=224129 GN=LOC108738862 PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.814e-67
Identity = 136/337 (40.36%), Postives = 220/337 (65.28%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKD-IHDKIKTHPTLKELYKKVFEFPLSSD---VEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDINYDNKTGIS---NGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            RL+W K P  +L+I+K ++  ++   F+QL+ +L+++++ +VF+E   ++D + DK  +   +K+   K+  F    D    +ID II +GGDGTLL AS  F++  PP+MAF+LG+LGF+ PF  + F++ +   L+G+    LR+RL C  I+    D    I    N KP  N   + LN++V+DRG S ++ ++ + +D   +T + GDGLI+STPTGSTAY+L+AGAS++HP+V A++VTPI   SLS RPI++P G++LK+ I PD+++ T+ +SFDG NR   +     + +T+S +P+ S+C+ DQ+ DWF  L  CL+WN +K + +L
Sbjct:   43 RLTWYKPPLTVLVIKK-VRDVSVLSPFVQLVHWLIEEKRMVVFVEASVMEDTLLDKFSSFTAIKD---KLMTFRDGKDNLTDKIDFIICMGGDGTLLYASLLFQQSVPPVMAFHLGSLGFLTPFQFDNFQDQVNNVLEGNAALTLRSRLRCIIIRKNELDETNAIDKKDNKKPSTN--ILVLNEVVVDRGPSPYLSNIDLFIDGKHITSVQGDGLIVSTPTGSTAYALSAGASMVHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISISPDSRS-TSWVSFDGRNRQ-ELKHGDSLRVTMSIYPLPSICEQDQISDWFDSLAECLHWNVRKKQKHL 371          
BLAST of NAD kinase-like Protein vs. Ensembl Cavefish
Match: nadka (NAD kinase [Source:NCBI gene;Acc:103022722])

HSP 1 Score: 214.157 bits (544), Expect = 1.634e-64
Identity = 128/356 (35.96%), Postives = 212/356 (59.55%), Query Frame = 3
Query:  135 PKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEF-----PLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDINYDNKTG-----ISNGKPECNPANI---ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYL 1157
            PK     +  +  RL+W+K P ++L+I+K   +  ++  F +L  +L +Q+K IV++E + ++D    I    +   + K    F      +S+ V+  I +   G      AS  F+E  PP+MAF+LG+LGF+ PF+ + ++  +   ++G+   ILR+RL    +++     KT      I+NG+ E     +    LN++V+DRG S+++ ++ + +D +++T + GDG+I+STPTGSTAY++AAGAS+IHP V A+L+TPI   SLS RPI++P G++LK+ +  +A+   A +SFDG  R   I     + IT S FPV S+C  D + DWF+ L  CL+WN +K +S+L
Sbjct:   83 PKAVMHIQDPASQRLTWNKPPKSVLVIKKIQDVSLLQ-PFKELCIFLTEQKKMIVYVERKVLED--PAIANDESFVAVKKNFCTFREDFDDISNRVDFIICLGGDGTLLY--ASSLFQESVPPVMAFHLGSLGFLTPFNFDTYQSQVTQVIEGNAAIILRSRLKVKVVKESREKTKTKDKNLIITNGEAEATRKTMQYQVLNEVVVDRGPSSYLSNVDLFLDGHLITTVQGDGVIVSTPTGSTAYAVAAGASMIHPNVPAILITPICPHSLSFRPIVVPAGVELKIMLSREAR-NNAWVSFDGRKRQ-EIGHGDSITITTSCFPVPSICFRDPVNDWFESLAQCLHWNVRKKQSHL 431          
BLAST of NAD kinase-like Protein vs. Ensembl Cavefish
Match: nadkb (NAD kinase-like [Source:NCBI gene;Acc:103032176])

HSP 1 Score: 184.111 bits (466), Expect = 7.503e-54
Identity = 142/361 (39.34%), Postives = 215/361 (59.56%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKD---IHDKI-----KTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECN---PAN-------------IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN--KKNESYLLHSENSD 1178
            RL+W+K P N+L+IRK ++ E +   F +L  +L++++K +V++E + ++D   + D++     K   T +E +  +      SD  ID+II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E +K  +    +G+   +LR+RL   +    +     +S  KPE N   P N               LN++V+DRG S+++ ++ + +D  ++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A++VTPI   SLS RPI++P G++L + + PDA+  TA +SFDG  R   I     + IT S +PV S+C  D + DWF  L  CL+WN  KK       S+ SD
Sbjct:   16 RLTWNKPPLNVLVIRK-VRDEGLLEPFKELCRFLVEEKKLMVYVEKKVVEDGALVADEMFSSVRKQLCTFREGFDDI------SDC-IDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESYKTEVDKVFEGNAAIVLRSRLKVKVVKGLFQRTKQLS--KPEENGTGPQNHISPETAKITLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPHSLSFRPIVVPAGVELMITLSPDAR-NTAWVSFDGRKRQ-EIQHGDSIKITTSCYPVPSLCCHDLVYDWFDSLAQCLHWNVRKKQTRLTDASDTSD 364          
BLAST of NAD kinase-like Protein vs. Ensembl Cavefish
Match: nadkb (NAD kinase-like [Source:NCBI gene;Acc:103032176])

HSP 1 Score: 184.882 bits (468), Expect = 5.291e-53
Identity = 134/366 (36.61%), Postives = 207/366 (56.56%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKD---IHDKI-----KTHPTLKELYKKVFE-----FPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECN---PAN-------------IALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN--KKNESYLLHSENSD 1178
            RL+W+K P N+L+IRK ++ E +   F +L  +L++++K +V++E + ++D   + D++     K   T +E +  + +       L  D            GTLL AS  F+   PP+MAF+LG+LGF+ PF  E +K  +    +G+   +LR+RL   +    +     +S  KPE N   P N               LN++V+DRG S+++ ++ + +D  ++T + GDG+I+STPTGSTAY+ AAGAS+IHP V A++VTPI   SLS RPI++P G++L + + PDA+  TA +SFDG  R   I     + IT S +PV S+C  D + DWF  L  CL+WN  KK       S+ SD
Sbjct:  125 RLTWNKPPLNVLVIRK-VRDEGLLEPFKELCRFLVEEKKLMVYVEKKVVEDGALVADEMFSSVRKQLCTFREGFDDISDCIDLIICLGGD------------GTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESYKTEVDKVFEGNAAIVLRSRLKVKVVKGLFQRTKQLS--KPEENGTGPQNHISPETAKITLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPHSLSFRPIVVPAGVELMITLSPDAR-NTAWVSFDGRKRQ-EIQHGDSIKITTSCYPVPSLCCHDLVYDWFDSLAQCLHWNVRKKQTRLTDASDTSD 473          
BLAST of NAD kinase-like Protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004257.1 (pep scaffold:Pmarinus_7.0:GL480559:14136:23982:1 gene:ENSPMAG00000003891.1 transcript:ENSPMAT00000004257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.342e-13
Identity = 56/148 (37.84%), Postives = 92/148 (62.16%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRK--DLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDV---EXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRN 602
            RL+W K P ++L+I+K  D KL +    F +L  +L++++  IV+IE + ++D    ++   +   + +K+  F    D     ID+II LGGDGTLL AS  F+E  PP+MAF+LG+LGF+ PF  E F+ S++  ++G+   +LR+
Sbjct:    9 RLTWSKPPLSVLVIKKIGDAKLLDF---FRELCAFLMEEKHMIVYIEKKVLED--PLLEGLESFVPIRRKLCTFREGYDDISDRIDLIICLGGDGTLLYASSLFQESVPPVMAFHLGSLGFLTPFKFETFRPSVSQVIEGNAALVLRS 151          
BLAST of NAD kinase-like Protein vs. Ensembl Yeast
Match: YEF1 (ATP-NADH kinase; phosphorylates both NAD and NADH; homooctameric structure consisting of 60-kDa subunits; similar to Pos5p; overexpression complements certain pos5 phenotypes; YEF1 has a paralog, UTR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000767])

HSP 1 Score: 147.517 bits (371), Expect = 6.719e-40
Identity = 91/238 (38.24%), Postives = 143/238 (60.08%), Query Frame = 3
Query:  456 ASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDINYDNKTGI--SNGKPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNE 1148
            AS  F +  PPI+ F LG+LGF+  F  + FKE+L   L   +   LR RL C     +   NK  I  + G+  C    I+    LN++ IDRG +  +  L +  +++++TK+ GDGLI++TPTGSTAYSL+AG S+I P+V A+ VTPI   +LS RPI+LP  ++LKV +D +++  T+ ++FDG +R + + +   V IT S + V ++       ++F+ ++  LNWN + E
Sbjct:  198 ASSIFTKDVPPIVPFALGSLGFLTNFEFQNFKETLKHILTDEVRINLRMRLQC----KLYRRNKPEIDAATGRKICYIDFISEHHVLNEVTIDRGPAPCLSLLELYGNDSLMTKVQGDGLIVATPTGSTAYSLSAGGSLISPSVNAIAVTPICPHTLSFRPIILPDSMELKVRVDMNSRG-TSWVNFDGKDR-VELKQGDYVVITASPYSVPTI--ESSASEFFESISKNLNWNDREE 427          
BLAST of NAD kinase-like Protein vs. Ensembl Yeast
Match: UTR1 (ATP-NADH kinase; phosphorylates both NAD and NADH; active as a hexamer; enhances the activity of ferric reductase (Fre1p); UTR1 has a paralog, YEF1, that arose from the whole genome duplication [Source:SGD;Acc:S000003810])

HSP 1 Score: 134.035 bits (336), Expect = 5.860e-35
Identity = 88/250 (35.20%), Postives = 136/250 (54.40%), Query Frame = 3
Query:  459 SGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIA----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVS--RFPVISVCKTDQMVDWFQGLNTCLNWN----KKNESYLLHSENSD 1178
            S  F+   PP+M+F+LG+LGF+  F  E F+E L   +   I   LR RL  C     +  +   + GK  C    ++    LN++ IDRG S  +  L +  D +++T    DGLI +TPTGSTAYSL+AG S++ PTV A+ +TPI   +LS RPI+LP  I LKV +   ++A  A  +FDG +R + + K   + I  S   FP +         ++   ++  LNWN    +K+ +++L  +N +
Sbjct:  220 SSIFQRHVPPVMSFSLGSLGFLTNFKFEHFREDLPRIMNHKIKTNLRLRL-ECTIYRRHRPEVDPNTGKKICVVEKLSTHHILNEVTIDRGPSPFLSMLELYGDGSLMTVAQADGLIAATPTGSTAYSLSAGGSLVCPTVNAIALTPICPHALSFRPIILPESINLKVKVSMKSRA-PAWAAFDGKDR-IELQKGDFITICASPYAFPTVEASPD----EFINSISRQLNWNVREQQKSFTHILSQKNQE 462          
BLAST of NAD kinase-like Protein vs. Ensembl Yeast
Match: POS5 (Mitochondrial NADH kinase; phosphorylates NADH; also phosphorylates NAD(+) with lower specificity; required for the response to oxidative stress [Source:SGD;Acc:S000006109])

HSP 1 Score: 121.709 bits (304), Expect = 4.289e-31
Identity = 79/250 (31.60%), Postives = 125/250 (50.00%), Query Frame = 3
Query:  480 CPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLP----VGIKLKVYIDPDAKAQTAHISFDG--------NNRHMTISKSQCVYITVSRFP-------------------VISVCKTDQMVDWFQGLNTCLNWN 1136
             PP++AF LGTLGF++PF  ++ K+     +     C+ R RL   ++    D+ + I            A+NDI + RG S H+ +L I +D   +T+ + DG+ ++TPTGSTAYSL+AG SI+ P V A+L+TPI   SLS RP++LP    + IK+   ++         +S DG         +    I++   +YI  ++ P                   +  V KT+   DW +G+N  L +N
Sbjct:  165 VPPVLAFALGTLGFLSPFDFKEHKKVFQEVISSRAKCLHRTRLECHLK--KKDSNSSI---------VTHAMNDIFLHRGNSPHLTNLDIFIDGEFLTRTTADGVALATPTGSTAYSLSAGGSIVSPLVPAILMTPICPRSLSFRPLILPHSSHIRIKIGSKLNQKPVNSVVKLSVDGIPQQDLDVGDEIYVINEVGTIYIDGTQLPTTRKTENDFNNSKKPKRSGIYCVAKTEN--DWIRGINELLGFN 401          
BLAST of NAD kinase-like Protein vs. Ensembl Nematostella
Match: EDO44951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU52])

HSP 1 Score: 206.453 bits (524), Expect = 9.868e-63
Identity = 125/331 (37.76%), Postives = 197/331 (59.52%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXX--XXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLL 1160
            +L+W K  A++L+++K  +  NI   F +L  +L+++ + +V +E     +    +    +   +++K+  F    ++E  I     LGGDGTLL  S  F+E CPP++AF+LG+LGF+  F  ++F+E +   L G     LR+RL   I   + D+     N K         LN++VIDRG S ++ +L +  ++  +T + GDGLIISTPTGSTAY++AAGAS++HPTV A+L+TPI   SLS RPI+LP G+++K+ +  +++  TA  SFDG NR   +   + + IT S FPV S+   +Q+ DWF  L  CL+WN + +   L
Sbjct:   37 KLAWTKPAAHVLIVKKIFEC-NITSKFKELCAWLVEERQMVVHVEASLTDE--PAVINDDSFVNVWRKLVTFKEGENLEDQIDFIICLGGDGTLLHVSTLFQESCPPVLAFHLGSLGFLTSFRFDRFREHVTKVLDGHARLTLRSRLRCIITKYHTDSN---ENCKTPNMQRYTVLNEVVIDRGQSPYLSNLEVYCNDYHITSVQGDGLIISTPTGSTAYAVAAGASMVHPTVPAILITPICPHSLSFRPIVLPAGVEIKIVVSLESR-NTAWASFDGRNRQ-ELDLGESIRITTSVFPVPSINCVNQVTDWFTSLAECLHWNVREQQQSL 359          
BLAST of NAD kinase-like Protein vs. Ensembl Nematostella
Match: EDO29036 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4S9])

HSP 1 Score: 140.198 bits (352), Expect = 5.563e-40
Identity = 72/156 (46.15%), Postives = 103/156 (66.03%), Query Frame = 3
Query:  471 KEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGI 938
            +E CPP++AF+LG+LGF+  F  ++F+E +   L G     LR+RL   I   + D+     N K         LN++VIDRG S ++ +L +  ++  +T + GDGLIISTPTGSTAY++AAGAS++HPTV A+L+TPI   SLS RPI+LP G+
Sbjct:    9 QESCPPVLAFHLGSLGFLTSFRFDRFREHVTKVLDGHARLTLRSRLRCIITKYHTDSN---ENCKTPNMQRYTVLNEVVIDRGQSPYLSNLEVYCNDYHITSVQGDGLIISTPTGSTAYAVAAGASMVHPTVPAILITPICPHSLSFRPIVLPAGV 161          
BLAST of NAD kinase-like Protein vs. Ensembl Medaka
Match: nadka (NAD kinase [Source:NCBI gene;Acc:101169167])

HSP 1 Score: 216.853 bits (551), Expect = 1.674e-66
Identity = 126/347 (36.31%), Postives = 206/347 (59.37%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEF-----PLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTG-------ISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLLHSENSD 1178
            RL+W+K P ++L+I+K ++  ++   F +L  +L + +  IV++E + + D    I    +   + KK   F      +S+ V+  I +   G      AS  F++  PP+M F+LG+LGF+ PF  + F+  +   ++G+   ILR+RL   +   N++ K G       ++NG  +       LND+V+DRG S+++ ++ + +D +++T + GDGLI+STPTGSTAY++AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ +  DA+  TA +SFDG  R   I     + IT S FPV S+C  D + DWF+ L  CL+WN + +   L +E+ D
Sbjct:   27 RLTWNKAPKSVLVIKK-IRDASLLQPFKELCVFLTEVKDMIVYVEKKVLDD--PAISGDESFGPVTKKFCTFREDLDDISNRVDFIICLGGDGTLLY--ASSLFQDSVPPVMGFHLGSLGFLTPFQFDAFQSQVTQIIEGNAAIILRSRLKVQVFKENWEKKDGSDEKNIVLANGGVK------VLNDVVVDRGPSSYLSNVDLFLDGHLITTVQGDGLIVSTPTGSTAYAVAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKITLSQDAR-NTAWVSFDGRKRQ-EICHGDSISITTSCFPVPSICFRDPVNDWFESLGECLHWNVRKKQNHLGAEDED 360          
BLAST of NAD kinase-like Protein vs. Ensembl Medaka
Match: nadka (NAD kinase [Source:NCBI gene;Acc:101169167])

HSP 1 Score: 207.994 bits (528), Expect = 6.820e-63
Identity = 126/351 (35.90%), Postives = 202/351 (57.55%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEK-FIVFIEVQYIKDIHDKIKTHPTLKELYKKV-----FEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTG-------ISNGKPECNPANI---ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLLHSENSD 1178
            RL+W+K P ++L+I+K ++  ++   F +L  +L + E  F+    +   +      K   T +E    +     F   L  D            GTLL AS  F++  PP+M F+LG+LGF+ PF  + F+  +   ++G+   ILR+RL   +   N++ K G       ++NG  + +   +    LND+V+DRG S+++ ++ + +D +++T + GDGLI+STPTGSTAY++AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ +  DA+  TA +SFDG  R   I     + IT S FPV S+C  D + DWF+ L  CL+WN + +   L +E+ D
Sbjct:   39 RLTWNKAPKSVLVIKK-IRDASLLQPFKELCVFLTEGEGPFLDDPAISGDESFGPVTKKFCTFREDLDDISNRVDFIICLGGD------------GTLLYASSLFQDSVPPVMGFHLGSLGFLTPFQFDAFQSQVTQIIEGNAAIILRSRLKVQVFKENWEKKDGSDEKNIVLANGGVKASRPAVQYQVLNDVVVDRGPSSYLSNVDLFLDGHLITTVQGDGLIVSTPTGSTAYAVAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKITLSQDAR-NTAWVSFDGRKRQ-EICHGDSISITTSCFPVPSICFRDPVNDWFESLGECLHWNVRKKQNHLGAEDED 374          
BLAST of NAD kinase-like Protein vs. Ensembl Medaka
Match: nadka (NAD kinase [Source:NCBI gene;Acc:101169167])

HSP 1 Score: 207.608 bits (527), Expect = 8.877e-63
Identity = 122/343 (35.57%), Postives = 202/343 (58.89%), Query Frame = 3
Query:  195 PANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEF-----PLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTG-------ISNGKPECNPANI---ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNKKNESYLLHSENSD 1178
            P ++L+I+K ++  ++   F +L  +L + +  IV++E + + D    I    +   + KK   F      +S+ V+  I +   G      AS  F++  PP+M F+LG+LGF+ PF  + F+  +   ++G+   ILR+RL   +   N++ K G       ++NG  + +   +    LND+V+DRG S+++ ++ + +D +++T + GDGLI+STPTGSTAY++AAGAS+IHP V A+++TPI   SLS RPI++P G++LK+ +  DA+  TA +SFDG  R   I     + IT S FPV S+C  D + DWF+ L  CL+WN + +   L +E+ D
Sbjct:   31 PKSVLVIKK-IRDASLLQPFKELCVFLTEVKDMIVYVEKKVLDD--PAISGDESFGPVTKKFCTFREDLDDISNRVDFIICLGGDGTLLY--ASSLFQDSVPPVMGFHLGSLGFLTPFQFDAFQSQVTQIIEGNAAIILRSRLKVQVFKENWEKKDGSDEKNIVLANGGVKASRPAVQYQVLNDVVVDRGPSSYLSNVDLFLDGHLITTVQGDGLIVSTPTGSTAYAVAAGASMIHPNVPAIMITPICPHSLSFRPIVVPAGVELKITLSQDAR-NTAWVSFDGRKRQ-EICHGDSISITTSCFPVPSICFRDPVNDWFESLGECLHWNVRKKQNHLGAEDED 366          
BLAST of NAD kinase-like Protein vs. Ensembl Medaka
Match: nadkb (NAD kinase [Source:NCBI gene;Acc:101167825])

HSP 1 Score: 182.185 bits (461), Expect = 7.631e-53
Identity = 139/360 (38.61%), Postives = 216/360 (60.00%), Query Frame = 3
Query:  174 RLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIH-------DKIKTH-PTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRL-CFCIQDI---------NYDNKTGISNGKPECNPANIA-----LNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWN-KKNESYLLH-SENSD 1178
            RL+W+K P N+L+IRK ++ E++   F QL  +L+++++ +V++E +   D           I+    T +E Y  +      SD  ID+II LGGDGTLL AS  F+   PP+MAF+LG+LGF+ PF  E +K  +A   +G+    LR+RL    ++D+           ++   + +G        +      LN++V+DRG S+++ ++ + +D  ++T + GDGLI+STPTGSTAY+ AAGAS+IHP V A++VTPI   SLS RPI++P G++L + + PDA+   A +SFDG  R   I    C+ IT S +PV S+C  D + DWF+ L  CL+WN +K ++ L   S++SD
Sbjct:   32 RLTWNKPPVNVLVIRK-VRDESLVEPFKQLCSFLVEEKQMMVYVERRVADDASLSKDEAFGSIRNQLCTFREGYDDI------SDC-IDLIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFESYKIEVAKVFEGNAAITLRSRLKVKVVKDMLQTAEPPPPLQEHNGLLPHGHTNSEAGKVTLQLQVLNEVVVDRGPSSYLSNVDLYLDGRLITSVQGDGLIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPHSLSFRPIVVPAGVELMITLSPDAR-NAAWVSFDGRRRQ-EIRHGDCIKITTSCYPVPSICCHDLVYDWFESLAQCLHWNVRKRQARLADISDSSD 381          
BLAST of NAD kinase-like Protein vs. Planmine SMEST
Match: SMESG000029643.1 (SMESG000029643.1)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 334/338 (98.82%), Postives = 335/338 (99.11%), Query Frame = 3
Query:   90 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDW 1103
            MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQ   +
Sbjct:    1 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQTCAY 338          
BLAST of NAD kinase-like Protein vs. Planmine SMEST
Match: SMESG000031598.1 (SMESG000031598.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 317/335 (94.63%), Postives = 318/335 (94.93%), Query Frame = 3
Query:   90 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAAGASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQM 1094
            MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIIST                 PTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQ+
Sbjct:    1 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIIST-----------------PTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHISFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQV 318          
BLAST of NAD kinase-like Protein vs. Planmine SMEST
Match: SMESG000031598.1 (SMESG000031598.1)

HSP 1 Score: 483.026 bits (1242), Expect = 2.474e-172
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 3
Query:   90 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEXXXXXXXXXXXXXXKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLA 836
            MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLA
Sbjct:    1 MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLENIEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEFPLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHVEKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANIALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLA 249          
The following BLAST results are available for this feature:
BLAST of NAD kinase-like Protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NADK1.027e-5338.62NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831][more]
NADK1.664e-5338.62NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831][more]
NADK1.664e-5338.62NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831][more]
NADK1.181e-4734.88NAD kinase [Source:HGNC Symbol;Acc:HGNC:29831][more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG331561.509e-5538.94gene:FBgn0053156 transcript:FBtr0087681[more]
CG331565.018e-5538.94gene:FBgn0053156 transcript:FBtr0087682[more]
CG331566.424e-5538.94gene:FBgn0053156 transcript:FBtr0113450[more]
CG331561.914e-5438.94gene:FBgn0053156 transcript:FBtr0087684[more]
CG331562.503e-5438.94gene:FBgn0053156 transcript:FBtr0087683[more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nadkb7.778e-5336.08NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433][more]
nadkb7.778e-5336.08NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433][more]
nadka4.620e-4540.38NAD kinase a [Source:ZFIN;Acc:ZDB-GENE-050417-39][more]
nadkb1.266e-2733.07NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433][more]
nadkb1.880e-1531.88NAD kinase b [Source:ZFIN;Acc:ZDB-GENE-061103-433][more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nadk3.599e-5638.57NAD kinase [Source:NCBI gene;Acc:448246][more]
nadk6.119e-5638.57NAD kinase [Source:NCBI gene;Acc:448246][more]
nadk6.295e-5638.57NAD kinase [Source:NCBI gene;Acc:448246][more]
nadk9.140e-5638.57NAD kinase [Source:NCBI gene;Acc:448246][more]
nadk5.353e-5438.75NAD kinase [Source:NCBI gene;Acc:448246][more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nadk2.489e-5739.42NAD kinase [Source:MGI Symbol;Acc:MGI:2183149][more]
Nadk6.185e-5739.60NAD kinase [Source:MGI Symbol;Acc:MGI:2183149][more]
Nadk6.185e-5739.60NAD kinase [Source:MGI Symbol;Acc:MGI:2183149][more]
back to top
BLAST of NAD kinase-like Protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58058|NADK_MOUSE4.326e-5639.60NAD kinase OS=Mus musculus OX=10090 GN=Nadk PE=1 S... [more]
sp|O95544|NADK_HUMAN7.992e-5338.62NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV... [more]
sp|Q53NI2|NADK2_ORYSJ3.236e-4836.59Probable NAD kinase 2, chloroplastic OS=Oryza sati... [more]
sp|Q5JK52|NADK1_ORYSJ2.489e-4732.93Probable NAD kinase 1 OS=Oryza sativa subsp. japon... [more]
sp|Q56YN3|NADK1_ARATH1.378e-4631.42NAD(H) kinase 1 OS=Arabidopsis thaliana OX=3702 GN... [more]
back to top
BLAST of NAD kinase-like Protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KTH37.713e-7038.92Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A087U5281.002e-6841.16Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
A0A2C9KTE12.289e-6839.06Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3CYP31.250e-6741.04NAD kinase isoform X13 OS=Diaphorina citri OX=1218... [more]
A0A1W4X6L11.814e-6740.36NAD kinase-like isoform X2 OS=Agrilus planipennis ... [more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nadka1.634e-6435.96NAD kinase [Source:NCBI gene;Acc:103022722][more]
nadkb7.503e-5439.34NAD kinase-like [Source:NCBI gene;Acc:103032176][more]
nadkb5.291e-5336.61NAD kinase-like [Source:NCBI gene;Acc:103032176][more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004257.12.342e-1337.84pep scaffold:Pmarinus_7.0:GL480559:14136:23982:1 g... [more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YEF16.719e-4038.24ATP-NADH kinase; phosphorylates both NAD and NADH;... [more]
UTR15.860e-3535.20ATP-NADH kinase; phosphorylates both NAD and NADH;... [more]
POS54.289e-3131.60Mitochondrial NADH kinase; phosphorylates NADH; al... [more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO449519.868e-6337.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290365.563e-4046.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NAD kinase-like Protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nadka1.674e-6636.31NAD kinase [Source:NCBI gene;Acc:101169167][more]
nadka6.820e-6335.90NAD kinase [Source:NCBI gene;Acc:101169167][more]
nadka8.877e-6335.57NAD kinase [Source:NCBI gene;Acc:101169167][more]
nadkb7.631e-5338.61NAD kinase [Source:NCBI gene;Acc:101167825][more]
back to top
BLAST of NAD kinase-like Protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000029643.10.000e+098.82SMESG000029643.1[more]
SMESG000031598.10.000e+094.63SMESG000031598.1[more]
SMESG000031598.12.474e-172100.00SMESG000031598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006308 ID=SMED30006308|Name=NAD kinase-like Protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1282bp
TTAAAATTAAAAATATAAATTAACTTTTTAAATATGAATTGTTTAACTAC
AATAAGATAAGGTCATTTGTGAAAATTCTATTAGATAGAATGCTAAGTCG
AAAACGTTCAGGAGAAGCATACGATTATGAATTTCCTAAAAATTGCACAT
TTAGCCGTTATGAATCTGGATGGCGTTTATCGTGGGACAAGGAACCAGCT
AATATTTTATTAATTAGAAAGGATTTGAAATTAGAAAATATTGAAATTGC
TTTCATGCAACTTATCTTTTATTTGTTAAAGCAAGAAAAATTTATAGTTT
TTATAGAAGTTCAATATATTAAAGATATTCACGATAAAATTAAAACTCAT
CCAACTTTGAAAGAATTATATAAGAAAGTTTTTGAGTTTCCGTTATCGTC
CGATGTTGAAATTGATATTATTATCACATTAGGCGGTGATGGAACTTTAC
TTAAAGCATCTGGTTATTTTAAAGAGATTTGTCCCCCTATTATGGCATTT
AATTTGGGTACATTGGGTTTTATGGCACCATTCCATGTAGAAAAATTTAA
AGAATCATTAGCTACAGCTTTGAAAGGAAGTATTCCATGCATTCTTCGAA
ATCGATTGTGTTTTTGTATACAAGATATAAATTATGATAATAAAACAGGA
ATTTCAAATGGAAAGCCTGAATGTAATCCTGCTAATATTGCGCTCAATGA
CATAGTGATTGATCGAGGAGCTTCAAATCATATTTTGTCTTTAGTAATCG
CCGTTGATAATAACATTGTCACTAAAATGAGTGGAGATGGTTTGATAATC
AGTACTCCCACCGGTAGCACGGCATATTCATTAGCTGCTGGTGCTAGTAT
TATTCATCCAACAGTCCGGGCAGTTTTAGTTACACCGATTAATGCTTTCA
GTTTGAGCATGCGTCCAATTCTTTTACCAGTCGGTATAAAATTGAAAGTT
TATATTGACCCAGATGCCAAAGCTCAAACTGCTCACATATCATTTGATGG
CAACAACCGCCACATGACCATATCGAAATCCCAATGTGTCTACATTACCG
TTTCTCGGTTTCCTGTAATTTCTGTTTGTAAAACTGATCAGATGGTTGAT
TGGTTTCAAGGTCTTAATACTTGTTTGAATTGGAATAAAAAAAATGAGTC
CTATCTTCTTCACTCAGAAAACTCTGATTAATTATTTGTGTCAGAATTAA
TTTCTTTGACTATTTTTATCTCTATTTTTGTTTTCATATAAATGTGTTTT
GATATTAAATTTGTATCGAGTTTAAAAAAAAA
back to top

protein sequence of SMED30006308-orf-1

>SMED30006308-orf-1 ID=SMED30006308-orf-1|Name=SMED30006308-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MLSRKRSGEAYDYEFPKNCTFSRYESGWRLSWDKEPANILLIRKDLKLEN
IEIAFMQLIFYLLKQEKFIVFIEVQYIKDIHDKIKTHPTLKELYKKVFEF
PLSSDVEIDIIITLGGDGTLLKASGYFKEICPPIMAFNLGTLGFMAPFHV
EKFKESLATALKGSIPCILRNRLCFCIQDINYDNKTGISNGKPECNPANI
ALNDIVIDRGASNHILSLVIAVDNNIVTKMSGDGLIISTPTGSTAYSLAA
GASIIHPTVRAVLVTPINAFSLSMRPILLPVGIKLKVYIDPDAKAQTAHI
SFDGNNRHMTISKSQCVYITVSRFPVISVCKTDQMVDWFQGLNTCLNWNK
KNESYLLHSENSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017438ATP-NAD_kinase_N
IPR017437ATP-NAD_kinase_PpnK-typ_C
IPR002504NADK
IPR016064NAD/diacylglycerol_kinase_sf
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0019674NAD metabolic process
GO:0006741NADP biosynthetic process
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0003951NAD+ kinase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002504NAD kinasePFAMPF01513NAD_kinasecoord: 96..326
e-value: 1.3E-48
score: 165.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.12540coord: 29..349
e-value: 2.3E-88
score: 298.0
NoneNo IPR availablePANTHERPTHR20275FAMILY NOT NAMEDcoord: 29..353
IPR017437ATP-NAD kinase, PpnK-type, C-terminalGENE3DG3DSA:2.60.200.30coord: 172..324
e-value: 2.3E-88
score: 298.0
IPR016064NAD kinase/diacylglycerol kinase-like domain superfamilySUPERFAMILYSSF111331NAD kinase/diacylglycerol kinase-likecoord: 39..351