Surfeit locus protein 4

Overview
NameSurfeit locus protein 4
Smed IDSMED30006304
Length (bp)2562
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Surfeit locus protein 4 (SMED30006304) t-SNE clustered cells

Violin plots show distribution of expression levels for Surfeit locus protein 4 (SMED30006304) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Surfeit locus protein 4 (SMED30006304) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Surfeit locus protein 4 (SMED30006304) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006304

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30006304SMESG000041256.1 dd_Smed_v4_4665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30006304SMESG000041256.1 dd_Smed_v4_4665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006304SMESG000041256.1 dd_Smed_v4_4665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006304SMESG000041256.1 dd_Smed_v4_4665_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Match: SURF4 (surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476])

HSP 1 Score: 228.409 bits (581), Expect = 4.613e-68
Identity = 133/268 (49.63%), Postives = 184/268 (68.66%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Match: SURF4 (surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476])

HSP 1 Score: 228.409 bits (581), Expect = 4.613e-68
Identity = 133/268 (49.63%), Postives = 184/268 (68.66%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Match: SURF4 (surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476])

HSP 1 Score: 178.718 bits (452), Expect = 1.554e-50
Identity = 113/223 (50.67%), Postives = 151/223 (67.71%), Query Frame = 3
Query: 1341 QWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    4 QWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 226          
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Match: SURF4 (surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476])

HSP 1 Score: 178.718 bits (452), Expect = 1.554e-50
Identity = 113/223 (50.67%), Postives = 151/223 (67.71%), Query Frame = 3
Query: 1341 QWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    4 QWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 226          
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Match: SURF4 (surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476])

HSP 1 Score: 178.718 bits (452), Expect = 1.554e-50
Identity = 113/223 (50.67%), Postives = 151/223 (67.71%), Query Frame = 3
Query: 1341 QWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    4 QWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 226          
BLAST of Surfeit locus protein 4 vs. Ensembl Celegans
Match: sft-4 (Surfeit locus protein 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18864])

HSP 1 Score: 216.853 bits (551), Expect = 3.627e-64
Identity = 130/270 (48.15%), Postives = 177/270 (65.56%), Query Frame = 3
Query: 1203 NNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTG-INQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
              + + L+  E+ A+   RKTR +LPHIAR+CLVSTF+EDG R+  QW DQ  F+   W    FI   F++ N   Q +   +I+ R +V   C IL   VILQTI Y I  +  F+ RN+A+ G LLLLLAE+ E+  S  AG+P+ G  N+PK YMLL GR+L++ +F++L+H++  F  +++ +    LI +V+IG KTKL AI+LV WL  +N W N +W         DF+KYDFFQT SVIGGLLL++AYGPGGVS+DDYKK W
Sbjct:    8 GGQNEMLAKAEDAAEDFFRKTRTYLPHIARLCLVSTFLEDGIRMYFQWDDQKQFMQESWSCGWFIATLFVIYNFFGQFIPVLMIMLRKKVLVACGILASIVILQTIAYHILWDLKFLARNIAVGGGLLLLLAETQEEKASLFAGVPTMGDSNKPKSYMLLAGRVLLIFMFMSLMHFEMSFMQVLEIVVGFALITLVSIGYKTKLSAIVLVIWLFGLNLWLNAWWTIPSDRFYRDFMKYDFFQTMSVIGGLLLVIAYGPGGVSVDDYKKRW 277          
BLAST of Surfeit locus protein 4 vs. Ensembl Celegans
Match: sft-4 (Surfeit locus protein 4 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q18864])

HSP 1 Score: 216.853 bits (551), Expect = 3.627e-64
Identity = 130/270 (48.15%), Postives = 177/270 (65.56%), Query Frame = 3
Query: 1203 NNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTG-INQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
              + + L+  E+ A+   RKTR +LPHIAR+CLVSTF+EDG R+  QW DQ  F+   W    FI   F++ N   Q +   +I+ R +V   C IL   VILQTI Y I  +  F+ RN+A+ G LLLLLAE+ E+  S  AG+P+ G  N+PK YMLL GR+L++ +F++L+H++  F  +++ +    LI +V+IG KTKL AI+LV WL  +N W N +W         DF+KYDFFQT SVIGGLLL++AYGPGGVS+DDYKK W
Sbjct:    8 GGQNEMLAKAEDAAEDFFRKTRTYLPHIARLCLVSTFLEDGIRMYFQWDDQKQFMQESWSCGWFIATLFVIYNFFGQFIPVLMIMLRKKVLVACGILASIVILQTIAYHILWDLKFLARNIAVGGGLLLLLAETQEEKASLFAGVPTMGDSNKPKSYMLLAGRVLLIFMFMSLMHFEMSFMQVLEIVVGFALITLVSIGYKTKLSAIVLVIWLFGLNLWLNAWWTIPSDRFYRDFMKYDFFQTMSVIGGLLLVIAYGPGGVSVDDYKKRW 277          
BLAST of Surfeit locus protein 4 vs. Ensembl Celegans
Match: T02E1.7 (pep chromosome:WBcel235:I:8208712:8210703:-1 gene:WBGene00011379.1 transcript:T02E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T02E1.7)

HSP 1 Score: 127.487 bits (319), Expect = 1.734e-32
Identity = 85/266 (31.95%), Postives = 140/266 (52.63%), Query Frame = 3
Query: 1221 LSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAG---LPSTGINQPKQYMLLGG-RLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            ++  E+Y + + R TR+ LP I R+ L+STF+EDG RL+    D ++  S  W +N     F  ++ II  L GS  ++ RY+V    A+L F +  Q I Y +     ++     I + ++LL   N   K   A    LP          +LL   R+ + L+ I+++H+D  +  ++  + +  ++I V +G KT++ + +L  WL   N   N+FW   +++     ++YDFFQT S IGGLLL++  GPG  S D+ KK W
Sbjct:    7 ITRCEDYTETLARNTRKVLPTIGRLLLISTFVEDGLRLLFNTHDHVNHFSYNWGLNYHFSLFLTIVMIINLLFGSLFVMMRYKVTESSAVLGFTIFAQVILYQLYTTYHLLTRNISIVAAIMLLVAENMLRKPKPANYTQLPRDEHEIEVTSVLLAACRVCLNLMLISMVHFDMSYTRILLCIISYGMMIFVWLGFKTRMMSFMLATWLFAYNIVLNDFW---NKDAELHIIRYDFFQTLSAIGGLLLLIHTGPGEFSFDELKKKW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Fly
Match: Surf4 (gene:FBgn0019925 transcript:FBtr0083117)

HSP 1 Score: 201.445 bits (511), Expect = 1.800e-58
Identity = 117/265 (44.15%), Postives = 184/265 (69.43%), Query Frame = 3
Query: 1215 DCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            + ++  E+ A+ VI++ +  LP +AR+CL++TF EDG R+  QW++Q +++   W    F+   F+L+N++ QL G  +++ R++V+    +L F V+LQT+ Y I  +  F++RN ALIG+LLL+LAE+  + +S  AG+PS G N+PK +M L GR+L+  +FITLI ++   + +IQ +   +L+++V +G KTKL A+ILV  LT +N ++N +W     + L DFLKYDFFQT SVIGGLL+IV+ GPGGVS+D++KK W
Sbjct:    6 EYIAKTEDVAEQVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATVFVLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEARIEGRSLFAGVPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDIIGSILMVLVVLGYKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFLKYDFFQTLSVIGGLLMIVSLGPGGVSMDEHKKKW 270          
BLAST of Surfeit locus protein 4 vs. Ensembl Zebrafish
Match: surf4 (surfeit 4 [Source:NCBI gene;Acc:394102])

HSP 1 Score: 231.491 bits (589), Expect = 2.309e-69
Identity = 137/268 (51.12%), Postives = 188/268 (70.15%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D +S  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W    F+   F++IN+I Q+ G  L++ R  V   C  L   + LQT+ Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VA+G KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDMMSAAEDLADQFLRVTKQYLPHMARLCLISTFLEDGIRMWFQWSEQRDYIEATWSCGYFLATCFVIINLIGQIGGCVLVLSRNLVQYACFGLFCIIALQTVAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSDFFSILQNMVGTALIILVAVGFKTKLAALTLVVWLLAINVYFNAFWTVPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Zebrafish
Match: surf4l (surfeit 4, like [Source:ZFIN;Acc:ZDB-GENE-040718-172])

HSP 1 Score: 228.794 bits (582), Expect = 1.968e-68
Identity = 138/267 (51.69%), Postives = 185/267 (69.29%), Query Frame = 3
Query: 1209 KKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
              D +SN E+ AD  +R T+++LPHIAR+CL+STF+EDG R+  QWS+Q ++I + W    F+   F+LIN++ QL G  LI+ R  V   C  L   + LQT+ Y I  +  F+MRNLAL G LLLLLAES  + +S  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  F  ++Q L    LI++VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLLIVA GPGGVS+D+ KK+W
Sbjct:    3 PNDLMSNAEDVADQFLRVTKQYLPHIARLCLISTFLEDGIRMWFQWSEQKEYIETTWSCGFFLATLFVLINLLGQLGGCILILSRNFVQYACFGLFAIIALQTVAYSILWDPKFLMRNLALGGGLLLLLAESRSEGRSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDTSFLSILQNLVGTALIVLVAIGFKTKLAALTLVIWLLAINVYFNAFWTIPAYKPMHDFLKYDFFQTTSVIGGLLLIVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Match: surf4.2 (surfeit 4, gene 1, gene 2 [Source:NCBI gene;Acc:395004])

HSP 1 Score: 220.705 bits (561), Expect = 3.279e-65
Identity = 133/252 (52.78%), Postives = 178/252 (70.63%), Query Frame = 3
Query: 1254 IRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W    F+   F+LIN++ QL    L++ R  V   C  L   + +QTIGY I  +  F+MRNLAL G +LLLLAES  + KS  AG+P+ G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q      LII+VAIG KTKL A+ LV WL  MN ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:   22 LRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIEATWSCGYFLAALFVLINLLGQLGCCILVLSRNFVQYACFGLFGIIAMQTIGYSILWDLKFLMRNLALGGGVLLLLAESRSEGKSMFAGVPTMGESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSILQNFVGTALIILVAIGFKTKLAALTLVVWLFAMNVYFNAFWTIPAYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 273          
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Match: surf4.1 (surfeit 4, gene 1 [Source:NCBI gene;Acc:493450])

HSP 1 Score: 215.312 bits (547), Expect = 3.427e-63
Identity = 127/265 (47.92%), Postives = 178/265 (67.17%), Query Frame = 3
Query: 1215 DCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            + +   E  AD  +R T+R+LPHIA +CL+STF+EDG R+  QW++Q ++I+  W     +   F++ N+  QL G  L++ R  V   C  L+  +ILQT+ Y I  +  F+MRN+AL+G LLLLLAES  + KS  AG+P+ G   P+QYM LGGR+L++L+F+TL+H++   F + Q +  L LI++VA+G KTKL A+ LV WL  +N   N FW       L DFLKYDFFQT SV+GGLLL+VA GPGGVS+D++KK W
Sbjct:    5 NVMGAAEELADQFLRVTKRYLPHIAHLCLISTFLEDGLRMWLQWNEQREYINMSWNCGMHLATLFVIFNLCGQLAGCVLVLTRKFVPYACFGLLGIIILQTVVYNILWDAKFLMRNMALVGGLLLLLAESRSEGKSMFAGVPNMGGTSPRQYMQLGGRVLLILMFMTLLHFNASPFTIFQDIFGLALILLVAVGFKTKLAALTLVLWLLVINVVQNAFWTVPSYRPLHDFLKYDFFQTLSVMGGLLLVVALGPGGVSMDEHKKKW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Match: surf4.1 (surfeit 4, gene 1 [Source:NCBI gene;Acc:493450])

HSP 1 Score: 214.542 bits (545), Expect = 4.780e-63
Identity = 127/259 (49.03%), Postives = 176/259 (67.95%), Query Frame = 3
Query: 1233 ENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            E  AD  +R T+R+LPHIA +CL+STF+EDG R+  QW++Q ++I+  W     +   F++ N+  QL G  L++ R  V   C  L+  +ILQT+ Y I  +  F+MRN+AL+G LLLLLAES  + KS  AG+P+ G   P+QYM LGGR+L++L+F+TL+H++   F + Q +  L LI++VA+G KTKL A+ LV WL  +N   N FW       L DFLKYDFFQT SV+GGLLL+VA GPGGVS+D++KK W
Sbjct:    5 EELADQFLRVTKRYLPHIAHLCLISTFLEDGLRMWLQWNEQREYINMSWNCGMHLATLFVIFNLCGQLAGCVLVLTRKFVPYACFGLLGIIILQTVVYNILWDAKFLMRNMALVGGLLLLLAESRSEGKSMFAGVPNMGGTSPRQYMQLGGRVLLILMFMTLLHFNASPFTIFQDIFGLALILLVAVGFKTKLAALTLVLWLLVINVVQNAFWTVPSYRPLHDFLKYDFFQTLSVMGGLLLVVALGPGGVSMDEHKKKW 263          
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Match: surf4.1 (surfeit 4, gene 1 [Source:NCBI gene;Acc:493450])

HSP 1 Score: 211.846 bits (538), Expect = 5.407e-62
Identity = 125/255 (49.02%), Postives = 175/255 (68.63%), Query Frame = 3
Query: 1245 DIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            D+ +R T+R+LPHIA +CL+STF+EDG R+  QW++Q ++I+  W     +   F++ N+  QL G  L++ R  V   C  L+  +ILQT+ Y I  +  F+MRN+AL+G LLLLLAES  + KS  AG+P+ G   P+QYM LGGR+L++L+F+TL+H++   F + Q +  L LI++VA+G KTKL A+ LV WL  +N   N FW       L DFLKYDFFQT SV+GGLLL+VA GPGGVS+D++KK W
Sbjct:   10 DMFLRVTKRYLPHIAHLCLISTFLEDGLRMWLQWNEQREYINMSWNCGMHLATLFVIFNLCGQLAGCVLVLTRKFVPYACFGLLGIIILQTVVYNILWDAKFLMRNMALVGGLLLLLAESRSEGKSMFAGVPNMGGTSPRQYMQLGGRVLLILMFMTLLHFNASPFTIFQDIFGLALILLVAVGFKTKLAALTLVLWLLVINVVQNAFWTVPSYRPLHDFLKYDFFQTLSVMGGLLLVVALGPGGVSMDEHKKKW 264          
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Match: surf4.2 (surfeit 4, gene 1, gene 2 [Source:NCBI gene;Acc:395004])

HSP 1 Score: 169.859 bits (429), Expect = 6.043e-47
Identity = 103/187 (55.08%), Postives = 132/187 (70.59%), Query Frame = 3
Query: 1449 LIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            L++ R  V   C  L   + +QTIGY I  +  F+MRNLAL G +LLLLAES  + KS  AG+P+ G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q      LII+VAIG KTKL A+ LV WL  MN ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:   81 LVLSRNFVQYACFGLFGIIAMQTIGYSILWDLKFLMRNLALGGGVLLLLAESRSEGKSMFAGVPTMGESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSILQNFVGTALIILVAIGFKTKLAALTLVVWLFAMNVYFNAFWTIPAYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 267          
BLAST of Surfeit locus protein 4 vs. Ensembl Mouse
Match: Surf4 (surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445])

HSP 1 Score: 229.18 bits (583), Expect = 1.748e-68
Identity = 134/268 (50.00%), Postives = 184/268 (68.66%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF +IQ +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWSCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Mouse
Match: Surf4 (surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445])

HSP 1 Score: 73.1738 bits (178), Expect = 5.066e-15
Identity = 40/110 (36.36%), Postives = 63/110 (57.27%), Query Frame = 3
Query: 1203 NNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGI 1532
               +   S +     + +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I
Sbjct:   12 TGGRKSTSTVGGTCCLFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWSCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSI 121          
BLAST of Surfeit locus protein 4 vs. Ensembl Mouse
Match: Surf4 (surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445])

HSP 1 Score: 70.4774 bits (171), Expect = 1.621e-14
Identity = 27/58 (46.55%), Postives = 43/58 (74.14%), Query Frame = 3
Query: 1209 KKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWK 1382
            + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W 
Sbjct:    3 QNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWS 60          
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Match: sp|Q7SZQ7|SURF4_DANRE (Surfeit locus protein 4 OS=Danio rerio OX=7955 GN=surf4 PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 1.743e-68
Identity = 137/268 (51.12%), Postives = 188/268 (70.15%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D +S  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W    F+   F++IN+I Q+ G  L++ R  V   C  L   + LQT+ Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VA+G KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDMMSAAEDLADQFLRVTKQYLPHMARLCLISTFLEDGIRMWFQWSEQRDYIEATWSCGYFLATCFVIINLIGQIGGCVLVLSRNLVQYACFGLFCIIALQTVAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSDFFSILQNMVGTALIILVAVGFKTKLAALTLVVWLLAINVYFNAFWTVPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Match: sp|Q800K9|SURF4_CHICK (Surfeit locus protein 4 OS=Gallus gallus OX=9031 GN=SURF4 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 4.478e-68
Identity = 138/268 (51.49%), Postives = 185/268 (69.03%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +S  E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I   W    F+   F+ IN+  QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FFY++Q +    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDIMSTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDGTWNCGYFLASIFVFINLFGQLSGCILVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDMNFFYILQNIVGTALIILVAIGFKTKLAALTLVIWLFGINIYFNAFWTIPAYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Match: sp|O57590|SURF4_TAKRU (Surfeit locus protein 4 OS=Takifugu rubripes OX=31033 GN=surf4 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 7.250e-68
Identity = 139/268 (51.87%), Postives = 188/268 (70.15%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D ++  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QW++Q D+I + W    F+   F+L+N+I QL G  LI+ R  V   C  L   + LQT+ Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q L    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDLMNRAEDVADQFLRVTKQYLPHLARLCLISTFLEDGIRMWFQWNEQRDYIEATWSCGYFLATCFVLLNLIGQLGGCVLILSRNFVQYACFGLFGIIALQTVAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDFNFFSILQNLVGTALIILVAIGFKTKLAALTLVLWLLVINVYFNAFWTIPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Match: sp|Q64310|SURF4_MOUSE (Surfeit locus protein 4 OS=Mus musculus OX=10090 GN=Surf4 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 1.223e-67
Identity = 134/268 (50.00%), Postives = 184/268 (68.66%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF +IQ +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWSCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIIQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Match: sp|Q5R705|SURF4_PONAB (Surfeit locus protein 4 OS=Pongo abelii OX=9601 GN=SURF4 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.215e-67
Identity = 133/268 (49.63%), Postives = 184/268 (68.66%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             + D +   E++AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q D+I + W     +   F+ +N++ QL G  L++ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    L+I+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. TrEMBL
Match: A0A3R7H5Y1 (Surfeit locus protein 4 OS=Clonorchis sinensis OX=79923 GN=surf4 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.493e-101
Identity = 172/270 (63.70%), Postives = 222/270 (82.22%), Query Frame = 3
Query: 1200 RNNK-KDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            RN K K+ L  LE+ AD ++R++RR+LPH+AR+CLVSTFIEDG+RLITQWS+Q+D+I ++W + SF    F+L+NII Q +GS  ++ RY+VN+G A+LM  V++QTIGY +  +VF+MRNL+LIGSLLL+LAE+ ++ K  LAGLPS+G N P+QY+LLGGR+L++L+F+TLIH  G  FYLIQ+ ANLVLI++VAIG KTKLCA +LV WLT MNF+YN FW   +  LLWDFLKYDFFQTWSVIGGL L+VAYGPGGVS+DDYKK W
Sbjct:    3 RNTKVKEILDKLEDKADWLVRRSRRYLPHVARLCLVSTFIEDGFRLITQWSEQVDYIKAVWHVPSFFAALFILVNIILQFVGSGFVLSRYQVNAGVAVLMSTVLIQTIGYNVWTQVFLMRNLSLIGSLLLILAEAQQEAKRILAGLPSSGENAPRQYLLLGGRILIILMFVTLIHLGGSLFYLIQSAANLVLILLVAIGYKTKLCATVLVLWLTAMNFYYNQFWAVHNDSLLWDFLKYDFFQTWSVIGGLGLVVAYGPGGVSVDDYKKKW 272          
BLAST of Surfeit locus protein 4 vs. TrEMBL
Match: A0A0R3TL47 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7936 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 3.425e-97
Identity = 179/275 (65.09%), Postives = 226/275 (82.18%), Query Frame = 3
Query: 1185 MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTG-INQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            MVD + N +++ L  LE+ AD V+R++R +LPHIAR+CLVSTF+EDG+RL+TQWS+QIDFI  +W +  FI   F+L NI  Q  GSA ++ RY+V +GCAILM  V++QTIGY I  ++F+MRNL+L+GSLLLLLAE+N+  KS LAGLPS G  N+ KQY+ LGGR+LVVL+F+TLIHW G FFYLIQ++ NLVLI++VA+G KTKLCAIILV WLT MNF+YNNFW     E++WDFLKYDFFQTWSVIGGL+LIVA+GPGGVS+DDYKK+W
Sbjct:    1 MVD-VFNRREELLGKLEDVADRVVRRSRHYLPHIARLCLVSTFLEDGFRLLTQWSEQIDFIRHVWGVGKFISAIFILANIFLQFSGSASVMLRYKVRAGCAILMLTVVIQTIGYNILTRIFLMRNLSLVGSLLLLLAEANQDSKSLLAGLPSVGNENRSKQYLQLGGRILVVLMFLTLIHWSGSFFYLIQSILNLVLILLVAVGYKTKLCAIILVTWLTCMNFYYNNFWSNYTDEIMWDFLKYDFFQTWSVIGGLMLIVAHGPGGVSVDDYKKEW 274          
BLAST of Surfeit locus protein 4 vs. TrEMBL
Match: A0A4S2LEG2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007739 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 7.212e-97
Identity = 163/252 (64.68%), Postives = 210/252 (83.33%), Query Frame = 3
Query: 1251 VIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            ++R++RR+LPH+AR+CLVSTFIEDG+RLITQWS+Q+D+I ++W + SF    F+L NII Q +GS  ++ RY+VN+G A+LM  V++QTIGY +  +VF+MRNL+LIGSLLL+LAE+ ++ K  LAGLPS+G N P+QY+LLGGR+L++L+F+TLIH  G  FYLIQ+ ANLVLI++VAIG KTKLCA +LV WLT MNF+YN FW   +  LLWDFLKYDFFQTWSVIGGL L+VAYGPGGVS+DDYKK W
Sbjct:   20 LVRRSRRYLPHVARLCLVSTFIEDGFRLITQWSEQVDYIKAVWHVPSFFAALFILANIILQFVGSGFVLSRYQVNAGVAVLMSTVLIQTIGYNVWTQVFLMRNLSLIGSLLLILAEAQQEAKRILAGLPSSGENAPRQYLLLGGRILIILMFVTLIHLGGSLFYLIQSAANLVLILLVAIGYKTKLCATVLVMWLTAMNFYYNQFWAVHNDSLLWDFLKYDFFQTWSVIGGLGLVVAYGPGGVSVDDYKKKW 271          
BLAST of Surfeit locus protein 4 vs. TrEMBL
Match: A0A095C2W5 (Surfeit locus protein 4-like protein OS=Schistosoma haematobium OX=6185 GN=MS3_04308 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.913e-96
Identity = 168/268 (62.69%), Postives = 214/268 (79.85%), Query Frame = 3
Query: 1203 NNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            +  ++ L  LE++AD ++RK+RR+LPHIAR CLVSTFIEDG+RL+TQWSDQ+D+I S+W  +     FF+L+NI  Q +GSA ++ RYRV  G  ILM  V+LQTIGY I  KVF MRNL+LIGSLLLLLAE  ++ +S LAGLPS+G N  +QY+LLGGR+L++L+F+TLIH     FY+IQ+++NL+LI++VAIG KTKLCA +LV WLT MNF+YN FW   +  L+WDFLKYDFFQTWSVIGGL L+VAYGPGGVS+DDYKK W
Sbjct:    5 STNRELLDRLEDHADWLVRKSRRYLPHIARFCLVSTFIEDGFRLLTQWSDQVDYIQSVWGTHVIFAAFFILLNICLQFIGSAFVLGRYRVKIGVGILMSTVLLQTIGYNIWTKVFFMRNLSLIGSLLLLLAEVQQETRSLLAGLPSSGENTHRQYILLGGRILIILMFVTLIHLGSSIFYVIQSISNLILILLVAIGYKTKLCATVLVIWLTGMNFYYNRFWAVSNDSLMWDFLKYDFFQTWSVIGGLGLVVAYGPGGVSVDDYKKKW 272          
BLAST of Surfeit locus protein 4 vs. TrEMBL
Match: A0A183QVE2 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.971e-96
Identity = 171/276 (61.96%), Postives = 217/276 (78.62%), Query Frame = 3
Query: 1185 MVDFIR--NNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            MVD ++  +  ++ L  LE++AD +IRK+RR+LPHIAR CLVSTFIEDG+RL+TQWSDQ+D+I  +W  +     FF+L+NI  Q  GSAL++ RYRV  G  ILM  V++QTIGY I  KVF MRNL+LIGSLLLLLAE  ++ +S LAGLPS+G N  +QY+LLGGR+L++L+F+TLIH     FY+IQ++ NL+LI++VAIG KTKLCA +LV WLT MNF+YN FW   +  L+WDFLKYDFFQTWSVIGGL L+VAYGPGGVS+DDYKK W
Sbjct:    1 MVDIMQRSSTSRELLDRLEDHADWLIRKSRRYLPHIARFCLVSTFIEDGFRLLTQWSDQVDYIQGVWGTHVIFAAFFILLNICLQFTGSALVLGRYRVKIGVGILMSTVLIQTIGYNIWTKVFFMRNLSLIGSLLLLLAEVQQETRSLLAGLPSSGENAHRQYILLGGRILIILMFVTLIHLGSSIFYVIQSIGNLILILLVAIGYKTKLCATVLVIWLTGMNFYYNRFWAVSNDSLMWDFLKYDFFQTWSVIGGLGLVVAYGPGGVSVDDYKKKW 276          
BLAST of Surfeit locus protein 4 vs. Ensembl Cavefish
Match: surf4 (surfeit 4 [Source:NCBI gene;Acc:103029299])

HSP 1 Score: 227.639 bits (579), Expect = 4.323e-68
Identity = 136/268 (50.75%), Postives = 188/268 (70.15%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D +S  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QW++Q D+I + W    F+   F+L+N++ QL G  LI+ R  V   C  L   + LQT+ Y I  +  F+MRN+AL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SV+GGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDLMSTAEDVADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWNEQRDYIEATWSCGYFLATCFVLLNLLGQLGGCVLILSRNFVQYACFGLFGIIALQTVAYSILWDLKFLMRNMALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSSFFSILQNMVGTALIILVAIGFKTKLAALTLVVWLMAINVYFNAFWTVPAYKPMHDFLKYDFFQTTSVVGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Cavefish
Match: surf4l (surfeit locus protein 4 [Source:NCBI gene;Acc:103043297])

HSP 1 Score: 221.09 bits (562), Expect = 1.363e-65
Identity = 137/267 (51.31%), Postives = 183/267 (68.54%), Query Frame = 3
Query: 1209 KKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            +   +S  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QWS+Q ++I S W    F+   F+LIN++ QL G  LI+ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + +S  AG+P+   + PKQYM LGGR+L+VL+F+TL+H+D  F  ++Q L    LII+VAIG KTKL A+ LV WL  +N  +N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    3 QNSLMSTAEDVADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQKEYIESSWGCGFFLASLFVLINLLGQLGGCILILSRNFVQYACFGLFGIIGLQTIAYSILWDPKFLMRNLALGGGLLLLLAESKSEGRSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDANFLSILQNLVGTALIILVAIGFKTKLAALTLVVWLFIINVSFNAFWNIPTYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Cavefish
Match: surf4 (surfeit 4 [Source:NCBI gene;Acc:103029299])

HSP 1 Score: 216.468 bits (550), Expect = 5.206e-64
Identity = 132/256 (51.56%), Postives = 180/256 (70.31%), Query Frame = 3
Query: 1242 ADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            A   +R T+++LPH+AR+CL+STF+EDG R+  QW++Q D+I + W    F+   F+L+N++ QL G  LI+ R  V   C  L   + LQT+ Y I  +  F+MRN+AL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SV+GGLLL+VA GPGGVS+D+ KK+W
Sbjct:    8 ASRFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWNEQRDYIEATWSCGYFLATCFVLLNLLGQLGGCVLILSRNFVQYACFGLFGIIALQTVAYSILWDLKFLMRNMALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSSFFSILQNMVGTALIILVAIGFKTKLAALTLVVWLMAINVYFNAFWTVPAYKPMHDFLKYDFFQTTSVVGGLLLVVALGPGGVSMDEKKKEW 263          
BLAST of Surfeit locus protein 4 vs. Ensembl Sea Lamprey
Match: surf4l (surfeit 4, like [Source:ZFIN;Acc:ZDB-GENE-040718-172])

HSP 1 Score: 106.301 bits (264), Expect = 1.486e-26
Identity = 82/176 (46.59%), Postives = 116/176 (65.91%), Query Frame = 3
Query: 1215 DCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFF 1739
            D +S  E+ AD  +R T+ +LPH+AR+CLVSTF+EDG R+  QWS Q D+I  +W     +   F+ IN++ QL G  L++ R  V+  C  L   + LQT+ Y I  +  F+MRNLAL G LLLLLAE+    +S  AG+P+ G N PKQYM LGGR+L+ L+F+TL++++  FF
Sbjct:    6 DVMSRAEDVADQFLRVTKHYLPHLARLCLVSTFLEDGVRMWFQWSLQRDYIDRMWGAGFVLASLFVFINLVGQLSGCVLVLSRNFVSYACYGLFVIIALQTLAYNILWDAHFLMRNLALGGGLLLLLAENRSDGRSMFAGVPTMGENSPKQYMQLGGRVLLTLMFMTLLNFEASFF 181          
BLAST of Surfeit locus protein 4 vs. Ensembl Yeast
Match: ERV29 (Protein localized to COPII-coated vesicles; involved in vesicle formation and incorporation of specific secretory cargo; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003516])

HSP 1 Score: 127.102 bits (318), Expect = 1.128e-32
Identity = 93/263 (35.36%), Postives = 158/263 (60.08%), Query Frame = 3
Query: 1224 SNLENYAD-IVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGI-TNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLP--STGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKK 2000
            S +E   D  V+ K + ++P ++R  +V+TF ED +R+++QWSDQI +++       F +  FL++  +  L+G++L++ R + N    +L   VI Q + YG+ T   F++RN ++IG LL+  ++S  + K+    LP  ++  ++ K Y+L  GR+L+VL+FI    +   +F ++ T+   +  I  AIG KTK  +I+L   LT  N   NN+W+Y + +   DFLKY+F+Q  S+IGGLLL+   G G +S+D+ KK
Sbjct:   52 SRIEGLTDNAVVYKLKPYIPSLSRFFIVATFYEDSFRILSQWSDQIFYLNKWKHYPYFFVVVFLVVVTVSMLIGASLLVLRKQTNYATGVLCACVISQALVYGLFTGSSFVLRNFSVIGGLLIAFSDSIVQNKTTFGMLPELNSKNDKAKGYLLFAGRILIVLMFIAFT-FSKSWFTVVLTI---IGTICFAIGYKTKFASIMLGLILTFYNITLNNYWFYNNTKR--DFLKYEFYQNLSIIGGLLLVTNTGAGELSVDEKKK 308          
BLAST of Surfeit locus protein 4 vs. Ensembl Nematostella
Match: EDO44233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWB5])

HSP 1 Score: 204.912 bits (520), Expect = 4.360e-60
Identity = 129/275 (46.91%), Postives = 179/275 (65.09%), Query Frame = 3
Query: 1185 MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            MV    +   + +   E+ AD ++R  +  LPH+AR CL+STF EDG R+  QW +Q D+I   W   + +   F++ N++ QL G  +I+ R +V+    IL   V+LQTIGY I  +  F++RNLAL G LLL+LA+S  + KS  AG+PS G N PK Y+ L GR+L+V +F TLI +   F YL+  +A  +L+++VAIG KTKL +++LV  L+ +N   N FW +     + DFLKYDFFQT SVIGGLLL+VA GPGGVS+DDYKK W
Sbjct:    1 MVTVGGSKYSEFMHKAEDLADQILRNGKHVLPHVARFCLISTFFEDGIRMWFQWGEQRDYIDQTWHCGTVLSVLFVIYNLLAQLGGCLMILSRQKVDYAVGILASVVLLQTIGYSILWDFKFLLRNLALCGGLLLILADSRSEQKSLFAGVPSVGGNTPKTYLQLTGRVLLVFMFATLIRFQLSFSYLLLDIAGTILMVLVAIGYKTKLASLVLVILLSVLNIVLNPFWVFDSNSPMRDFLKYDFFQTMSVIGGLLLVVALGPGGVSVDDYKKKW 275          
BLAST of Surfeit locus protein 4 vs. Ensembl Medaka
Match: surf4 (surfeit 4 [Source:NCBI gene;Acc:101158292])

HSP 1 Score: 230.72 bits (587), Expect = 3.906e-69
Identity = 139/268 (51.87%), Postives = 188/268 (70.15%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGIT-NKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D ++  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QW++Q D+I + W    F+   F+L+N+I QL G  LI+ R  V   C  L   + LQTI Y I  +  F+MRNLAL G LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDFMNKAEDVADQFLRVTKQYLPHLARLCLISTFLEDGIRMWFQWNEQRDYIEATWNCGYFLATCFVLLNLIGQLGGCVLILSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSSFFSILQNIVGTALIILVAIGFKTKLAALTLVVWLMAINVYFNAFWTIPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Ensembl Medaka
Match: surf4 (surfeit 4 [Source:NCBI gene;Acc:101158292])

HSP 1 Score: 215.312 bits (547), Expect = 1.620e-63
Identity = 129/273 (47.25%), Postives = 179/273 (65.57%), Query Frame = 3
Query: 1206 NKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIM------RXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
             ++D ++  E+ AD  +R T+++LPH+AR+CL+STF+EDG R+  QW++Q D+I + W    F+   F+L+N+I QL G  LI+ R  V   C  L   + LQ     + N  F +          +   LLLLLAES  + KS  AG+PS G + PKQYM LGGR+L+VL+F+TL+H+D  FF ++Q +    LII+VAIG KTKL A+ LV WL  +N ++N FW     + + DFLKYDFFQT SVIGGLLL+VA GPGGVS+D+ KK+W
Sbjct:    2 GQEDFMNKAEDVADQFLRVTKQYLPHLARLCLISTFLEDGIRMWFQWNEQRDYIEATWNCGYFLATCFVLLNLIGQLGGCVLILSRNFVQYACFGLFGIIALQ-----VNNTFFRLYLYFPFNITIVTCGLLLLLAESRSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSSFFSILQNIVGTALIILVAIGFKTKLAALTLVVWLMAINVYFNAFWTIPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDEKKKEW 269          
BLAST of Surfeit locus protein 4 vs. Planmine SMEST
Match: SMESG000041256.1 (SMESG000041256.1)

HSP 1 Score: 464.922 bits (1195), Expect = 6.902e-159
Identity = 274/274 (100.00%), Postives = 274/274 (100.00%), Query Frame = 3
Query: 1185 MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSXXXXXXXXXXXXCQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRXXXXXXXXXXXXXXXXXKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 2006
            MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSFIIGFFLLINIICQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRNLALIGSLLLLLAESNEKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW
Sbjct:    1 MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRLITQWSDQIDFISSLWKMNSFIIGFFLLINIICQLMGSALIICRYRVNSGCAILMFDVILQTIGYGITNKVFIMRNLALIGSLLLLLAESNEKVKSYLAGLPSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMVAIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSVIGGLLLIVAYGPGGVSIDDYKKDW 274          
The following BLAST results are available for this feature:
BLAST of Surfeit locus protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SURF44.613e-6849.63surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476][more]
SURF44.613e-6849.63surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476][more]
SURF41.554e-5050.67surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476][more]
SURF41.554e-5050.67surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476][more]
SURF41.554e-5050.67surfeit 4 [Source:HGNC Symbol;Acc:HGNC:11476][more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sft-43.627e-6448.15Surfeit locus protein 4 homolog [Source:UniProtKB... [more]
sft-43.627e-6448.15Surfeit locus protein 4 homolog [Source:UniProtKB... [more]
T02E1.71.734e-3231.95pep chromosome:WBcel235:I:8208712:8210703:-1 gene:... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Surf41.800e-5844.15gene:FBgn0019925 transcript:FBtr0083117[more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
surf42.309e-6951.12surfeit 4 [Source:NCBI gene;Acc:394102][more]
surf4l1.968e-6851.69surfeit 4, like [Source:ZFIN;Acc:ZDB-GENE-040718-1... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
surf4.23.279e-6552.78surfeit 4, gene 1, gene 2 [Source:NCBI gene;Acc:39... [more]
surf4.13.427e-6347.92surfeit 4, gene 1 [Source:NCBI gene;Acc:493450][more]
surf4.14.780e-6349.03surfeit 4, gene 1 [Source:NCBI gene;Acc:493450][more]
surf4.15.407e-6249.02surfeit 4, gene 1 [Source:NCBI gene;Acc:493450][more]
surf4.26.043e-4755.08surfeit 4, gene 1, gene 2 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Surf41.748e-6850.00surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445][more]
Surf45.066e-1536.36surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445][more]
Surf41.621e-1446.55surfeit gene 4 [Source:MGI Symbol;Acc:MGI:98445][more]
back to top
BLAST of Surfeit locus protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SZQ7|SURF4_DANRE1.743e-6851.12Surfeit locus protein 4 OS=Danio rerio OX=7955 GN=... [more]
sp|Q800K9|SURF4_CHICK4.478e-6851.49Surfeit locus protein 4 OS=Gallus gallus OX=9031 G... [more]
sp|O57590|SURF4_TAKRU7.250e-6851.87Surfeit locus protein 4 OS=Takifugu rubripes OX=31... [more]
sp|Q64310|SURF4_MOUSE1.223e-6750.00Surfeit locus protein 4 OS=Mus musculus OX=10090 G... [more]
sp|Q5R705|SURF4_PONAB2.215e-6749.63Surfeit locus protein 4 OS=Pongo abelii OX=9601 GN... [more]
back to top
BLAST of Surfeit locus protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7H5Y11.493e-10163.70Surfeit locus protein 4 OS=Clonorchis sinensis OX=... [more]
A0A0R3TL473.425e-9765.09Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4S2LEG27.212e-9764.68Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A095C2W51.913e-9662.69Surfeit locus protein 4-like protein OS=Schistosom... [more]
A0A183QVE21.971e-9661.96Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
surf44.323e-6850.75surfeit 4 [Source:NCBI gene;Acc:103029299][more]
surf4l1.363e-6551.31surfeit locus protein 4 [Source:NCBI gene;Acc:1030... [more]
surf45.206e-6451.56surfeit 4 [Source:NCBI gene;Acc:103029299][more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
surf4l1.486e-2646.59surfeit 4, like [Source:ZFIN;Acc:ZDB-GENE-040718-1... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ERV291.128e-3235.36Protein localized to COPII-coated vesicles; involv... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO442334.360e-6046.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Surfeit locus protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
surf43.906e-6951.87surfeit 4 [Source:NCBI gene;Acc:101158292][more]
surf41.620e-6347.25surfeit 4 [Source:NCBI gene;Acc:101158292][more]
back to top
BLAST of Surfeit locus protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000041256.16.902e-159100.00SMESG000041256.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006304 ID=SMED30006304|Name=Surfeit locus protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2562bp
GGTACTTGATGGGCGAAATATTATCTATACACATACTATAAAAGTTTTAC
CATCAGATAACCAGATAAGAAAAATGTTGGATCAAAACAAAGAACACTGA
AAATGTGTTTAAGTTTATTATTAACAAGCACCAAGACGAATTAACTAGAA
TAACGGTTATCAACTAAAGCAAATAAAATTTGAGATAAACAAGAAAAACT
ATAAAAGAAAACAAAAAGAAAAATAAAAGCAATTACAAAGTGTATCAAGT
GCTGGGTACATGATGGTAAAAAGGAAATATGATTTGAGGCCACTTTCAAT
TGGGTTTCCCTCAGAAACATGCATAAGAGATATTACCATATGAAATCTGT
TCAAAAATAACGTAGAGCTGTATTTCAATGGATGCTTTTTAGTAAAAGGT
CGTTGCAGATTCCACATCATACTTTGCGCTTAAATCTTCATTTAGGTCAT
AGTAATATAAAATATCCATCAAATAACATATTTTTTAATAGTTTTAATCA
AAAAAACCGATCAAAAATTCCCTATTTGATACCCATCTGCATAAAAACCT
CAAAATTTTGAATTAAAAATTATCAATTAAAACAGGAAATTTTGTTGTAT
TTGAAACAGAATTTCGTATTTCTGCACACCAACTCATTTTCTTTCAAAAA
TTTCAATTTTTCTTAAGGATTTTTACCGTAAACTCGCTTTAACCGAAGAC
AAAAGGTCGAAACGATATTTGGACCCATGATATGAGAAAGAAAAGCAAAA
GCTTAGAACTGGCAGCTTGCTTAACCAAAATACACCTGAGCCAGAATGGA
TTCGGTGACGACCCTGACTTTTGGTGGACTATCAAGCCCTGTCGCAGTGC
CAACGGATGAGAGATGGGTGAATTGATGATACTGTATGTTTGTGTTAATA
AAGTAAAGATTGCGATAGAAAATACCAAGGTTATCCACAACTAATTTCGG
ATTAATTTTTATGGATTCATTGCATATATATATTTTTTAAATTAAGTTTT
GTTTTTATAACAAACGCACATTTTGACATTTATCTGTTTTTTAAAATAAT
TTTCTAATGTAGTTCCGAAATTCATTCTGTTTGAGCACGCGTGATCTAAT
TAATTAAATTTATTTTGTTTTACCATATAAACTTTAATAATCAGATTAAT
TTTAATTTTAAATTACTACGTTGCAAATTTCTTAATGGTTGATTTTATTC
GAAATAATAAAAAAGATTGTTTATCAAATTTAGAAAATTATGCAGATATA
GTAATTAGAAAGACTCGTCGATTCTTGCCTCATATTGCTCGAGTTTGTTT
AGTGTCAACATTTATTGAGGATGGTTATCGATTAATCACACAATGGAGTG
ATCAAATAGATTTTATTTCTAGTTTATGGAAAATGAATTCTTTTATTATT
GGATTTTTTTTACTAATAAATATTATTTGTCAATTAATGGGAAGTGCGTT
AATTATTTGCAGATATCGAGTTAATTCTGGCTGCGCGATCTTAATGTTTG
ATGTAATATTGCAGACAATCGGTTACGGAATTACTAACAAAGTGTTTATA
ATGCGAAATCTAGCCTTAATTGGCAGTTTGCTACTGCTGTTGGCAGAAAG
TAATGAAAAGGTGAAGTCTTACCTTGCTGGCTTACCCAGCACTGGAATTA
ATCAACCTAAACAATACATGCTATTAGGTGGGCGATTGTTGGTCGTCCTC
ATTTTTATCACTCTTATCCACTGGGATGGGGGATTTTTCTATTTGATTCA
AACACTAGCCAATCTGGTACTGATAATCATGGTGGCCATTGGATTAAAAA
CCAAATTATGCGCAATTATTCTCGTGTTTTGGCTGACAACAATGAACTTT
TGGTACAACAATTTCTGGTATTATATCGACAGAGAGCTGTTGTGGGATTT
CCTGAAATATGATTTCTTCCAAACCTGGTCAGTAATTGGAGGTTTACTGT
TGATTGTTGCCTACGGTCCAGGCGGGGTTTCGATTGATGATTACAAAAAG
GATTGGTGATTTTTCCAGCAAAATAAATTTAGTTCTTTTTTGGATACGTT
TTTGACGTGAACTTCATGACGACCACCGGATGATGATGTTGATGATGATG
ATGATTATTATTATTGTTTTTTTGTCGTTTTGCAATATTTCTACATTTAT
TGTTGTTTATATTATATTGGATTCGAATTATTGGCTGCTGATTCTGATTG
GTGGTTTGATTGATTAATAATAATTTGCTTTTATTATTGCTATTTTCGTT
GTACTTTAACCAGTTTTACATGACGTGCAATATTTGTGATTAAATAATAA
TAATATTGTGTTCTCGTTTTTTTCTAATCGATATTGAATATAAATTTGCG
CGATATACTTGATCATTTGTAACTTATTGTTTTTACTGGTTTATGATCTG
AATAATGTTGAGATCGGTATGAATTTAATTGACTTTGTGTTAGTTCGAAA
TTTTCCCTTTTTATGATTAGGTTTAAATTATAGTCTTTTGATTGGTCAAT
TTTTATTTTGCGAACTTTATAATAAATTTTTAGTATTATAATAAATTTTA
ACTCTAAAAAAA
back to top

protein sequence of SMED30006304-orf-1

>SMED30006304-orf-1 ID=SMED30006304-orf-1|Name=SMED30006304-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MVDFIRNNKKDCLSNLENYADIVIRKTRRFLPHIARVCLVSTFIEDGYRL
ITQWSDQIDFISSLWKMNSFIIGFFLLINIICQLMGSALIICRYRVNSGC
AILMFDVILQTIGYGITNKVFIMRNLALIGSLLLLLAESNEKVKSYLAGL
PSTGINQPKQYMLLGGRLLVVLIFITLIHWDGGFFYLIQTLANLVLIIMV
AIGLKTKLCAIILVFWLTTMNFWYNNFWYYIDRELLWDFLKYDFFQTWSV
IGGLLLIVAYGPGGVSIDDYKKDW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002995Surf4
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002995Surfeit locus 4PFAMPF02077SURF4coord: 12..274
e-value: 2.4E-92
score: 309.4
IPR002995Surfeit locus 4PROSITEPS01339SURF4coord: 241..255
NoneNo IPR availablePANTHERPTHR23427:SF1SURF4L PROTEIN-RELATEDcoord: 8..274
NoneNo IPR availablePANTHERPTHR23427SURFEIT LOCUS PROTEINcoord: 8..274
NoneNo IPR availableTMHMMTMhelixcoord: 99..116
NoneNo IPR availableTMHMMTMhelixcoord: 185..204
NoneNo IPR availableTMHMMTMhelixcoord: 163..180
NoneNo IPR availableTMHMMTMhelixcoord: 211..230
NoneNo IPR availableTMHMMTMhelixcoord: 70..92
NoneNo IPR availableTMHMMTMhelixcoord: 245..267
NoneNo IPR availableTMHMMTMhelixcoord: 120..137