Ciliogenesis associated TTC17 interacting protein

Overview
NameCiliogenesis associated TTC17 interacting protein
Smed IDSMED30006301
Length (bp)1207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ciliogenesis associated TTC17 interacting protein (SMED30006301) t-SNE clustered cells

Violin plots show distribution of expression levels for Ciliogenesis associated TTC17 interacting protein (SMED30006301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ciliogenesis associated TTC17 interacting protein (SMED30006301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ciliogenesis associated TTC17 interacting protein (SMED30006301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30006301h1SMcG0012021 Contig50501newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006301h1SMcG0012021 Contig50501uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006301h1SMcG0012021 Contig55931uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006301h1SMcG0012021 Contig55931newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006301h1SMcG0012021 Contig25795newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006301h1SMcG0012021 Contig25795uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30006301h1SMcG0012021 dd_Smed_v4_10698_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Human
Match: CATIP (ciliogenesis associated TTC17 interacting protein [Source:HGNC Symbol;Acc:HGNC:25062])

HSP 1 Score: 130.954 bits (328), Expect = 9.133e-34
Identity = 81/328 (24.70%), Postives = 162/328 (49.39%), Query Frame = 2
Query:  125 KATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITF 1090
            +A   A++FL+++  ++L+   + + L   +      G+  + +++  Y      LT C+ V   +   L  + C   +  ++ +KL+ + Q  ++ +KF    M +K+ +   +    +++ + E +  +     F    ++G++SE A+++L R++  R  VP N   +  +   +L   T++ L    + +  ++  V  +E+ V++ +      Q Y + DGHL  + QVGSP    + +M    E+D    +P F    L WE+DM+L S+FLD KE  +     YL+ H E   L+  F+  +L+R+P + V FA+ +F  F
Sbjct:   27 EANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPF 354          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Zebrafish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:767803])

HSP 1 Score: 169.474 bits (428), Expect = 1.593e-48
Identity = 104/359 (28.97%), Postives = 188/359 (52.37%), Query Frame = 2
Query:   83 LQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDY-----------VEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYE 1123
            ++ S +   ++ ++KA+ SA+EF++ I   DLE  ++ D L   +    ++G + V++ K+ Y+   C  +   +  T+  + C T I +++ +KL+ L +   E +K     + +K+ +   +    + + + E +  +  +  F +  + G+VSE ++ +L R++  +  VP+N + +  +    LS + +KAL   K  + ++ V + GIER +YSA      W  +F+PDGHL S+ Q+GSP  MK+  +              VEKD     P      L WE+DM+L S+FLD KE  K+    YL+ H E+K L+  F+Q +L+RKP +   FA  +F  F+S+  P  + E
Sbjct:    1 MEESELTQNETEELKASVSAVEFIH-IAQRDLEQCLFADSLVTVSDSGRELGDFSVSVTKASYNEELCYLLHANSHGTIDDVPCGTSIVAYISRKLEILEENHHEYVKLEKKTVDRKIHIVRQDDQLVVDRVISEREGVKTQTLKFPLSSLDGFVSEASNFLLLRIMARQKIVPENMTFLSLDADSGLSKSVYKALGWQKQMVGEDLVDIFGIERTIYSANLSSATWHCFFMPDGHLASRVQLGSPAVMKLLHLPFLLDGVIKTFFFLVEKDKI---PVMEKKPLIWEEDMELYSKFLDRKEELKADYSSYLRQHPELKALLADFLQFLLLRKPQDVFSFARDFFAPFASQSPPGKSQE 355          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Xenopus
Match: ENSXETT00000050581.1 (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:100495462])

HSP 1 Score: 181.415 bits (459), Expect = 1.126e-52
Identity = 107/343 (31.20%), Postives = 186/343 (54.23%), Query Frame = 2
Query:  122 IKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTS----CIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEI--SKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSN 1132
            + A+  ALEFL ++  ++L   ++ D L   +    +VG Y V+++ + Y+L      C  V   ++ ++ G+ C T I   +  KL+TL Q   E +K     + KK   +++ +G EI  ++ + E +     +       + G++SE A++++ R+L  R + +    + F++   L  +T+ AL +    I  + V V GIER ++S  +  T WQ +++ DGHL +  Q+GS +++K+ EM    E D    KP F    L+W++D+QL S+FLD KE   S    YL+ H E+K L+  FMQ +L+RKP + V+FA+ YF  FSS  +P   + +S+
Sbjct:   37 VSASSEALEFLRSVGQEELNLCLFADSLVTESVSGVEVGTYTVSVQPAYYELDGMEEKCFLVHAASQGSIDGVPCGTSIIGHISYKLETLEQHLHEYVKLRGHSLDKKT--QTVRQGDEIVINRIITEGEKLHRETTSHPASSLCGFISEAANLLIMRILARRKMKEPLEFLAFDEEANLCVSTYAALGSQTQMIGKQTVDVFGIERTIHSP-EVPTTWQCFYLSDGHLATHVQIGSSVTIKLTEMPILSEPDEKDPKPVFEKKPLDWQEDLQLHSEFLDRKEEFISDHETYLRRHPEMKVLLADFMQFLLLRKPDDIVDFAAEYFQPFSSTHEPRDPFVSSH 376          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 128.642 bits (322), Expect = 3.061e-32
Identity = 84/335 (25.07%), Postives = 165/335 (49.25%), Query Frame = 2
Query:  122 IKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLV-ARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKP 1108
            ++A P     L++  ++D+  F +P+ L   +      G+  + +++  Y      LT C+ V   +   L    C + +  ++   L+ + Q  +E +KF    M +K+ V   +  + +++ + E +  +     F  +  +G+VS  A+V+L R++   + VP     +  +   +L   T+K+L    + + +++  +  +E+ ++S +      Q Y +PDGHL  + QVGSP    + +M    E+D   S PTF    L W +D++L S+FLD KE  +     YL+ H E + L+  F+  +L+R+P + V FA+ +F  F++   P
Sbjct:   14 LEAGPGETASLHHPGLEDMLLF-FPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVTRSVKEGEETKTGVSVFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGNQQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFAALRSP 347          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 124.02 bits (310), Expect = 1.087e-30
Identity = 81/324 (25.00%), Postives = 159/324 (49.07%), Query Frame = 2
Query:  155 NNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLV-ARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKP 1108
            +   ++D+  F +P+ L   +      G+  + +++  Y      LT C+ V   +   L    C + +  ++   L+ + Q  +E +KF    M +K+ V   +  + +++ + E +  +     F  +  +G+VS  A+V+L R++   + VP     +  +   +L   T+K+L    + + +++  +  +E+ ++S +      Q Y +PDGHL  + QVGSP    + +M    E+D   S PTF    L W +D++L S+FLD KE  +     YL+ H E + L+  F+  +L+R+P + V FA+ +F  F++   P
Sbjct:    6 DGAGLEDMLLF-FPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVTRSVKEGEETKTGVSVFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGNQQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFAALRSP 328          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Mouse
Match: Catip (ciliogenesis associated TTC17 interacting protein [Source:MGI Symbol;Acc:MGI:2685062])

HSP 1 Score: 67.3958 bits (163), Expect = 3.067e-12
Identity = 49/240 (20.42%), Postives = 108/240 (45.00%), Query Frame = 2
Query:  125 KATPSALEFLNNI------------DIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLV-ARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHL 790
            +A   A+ FLN+              ++D+  F +P+ L   +      G+  + +++  Y      LT C+ V   +   L    C + +  ++   L+ + Q  +E +KF    M +K+ V   +  + +++ + E +  +     F  +  +G+VS  A+V+L R++   + VP     +  +   +L   T+K+L    + + +++  +  +E+ ++S +      Q Y +PDGHL
Sbjct:   28 EANAEAISFLNSFCEPDGGAGVGRRGLEDMLLF-FPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVTRSVKEGEETKTGVSVFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGNQQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHL 266          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Match: sp|Q0IHI3|CATIP_XENLA (Ciliogenesis-associated TTC17-interacting protein OS=Xenopus laevis OX=8355 GN=catip PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 4.668e-54
Identity = 107/335 (31.94%), Postives = 179/335 (53.43%), Query Frame = 2
Query:  143 LEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTS-----CIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSN 1132
            LEFL ++ +++L   ++ D L   +    ++G + V+++ + Y L       C  V   ++ T+ G+ C T I   +  KL+TL Q   E +K     + KK  +        I++ + E +     +   S  ++ G +SE A++++ R+L  R + D    + F++   L ++T+  L +    I  E V V GIER ++S  +  T WQ +F+ DGHL S  Q+GSP+++K+ EM    E D    KP F    L W++D+QL S+FLD KE   S    YL+ H E+K L+  FMQ +L+RKP + ++FA+ YF  FSS  +PN  + +S+
Sbjct:   33 LEFLCSVGLEELNLCLFTDSLATVSVSGVELGNFAVSVQPAYYQLDGLEEEKCFLVHAASQGTIDGVPCGTSIIGHISYKLETLEQHVHEYVKLKGHSLDKKTQIVRQGDKLVINRIITEGEKLHRETSSHSTSLLSGLISEAANLLIMRILARRKIKDPLKFLAFDEEGNLCTSTYAPLGSQAQVIGKEMVDVFGIERTIHSP-EVPTTWQCFFLSDGHLASHVQIGSPVTIKLNEMPVLSEPDEKDPKPVFEKKPLAWQEDLQLHSEFLDRKEELISDHETYLRRHPEVKVLLADFMQFLLLRKPDDIMDFAAEYFKPFSSTQEPNDPFVSSH 366          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Match: sp|Q08CH6|CATIP_DANRE (Ciliogenesis-associated TTC17-interacting protein OS=Danio rerio OX=7955 GN=catip PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.203e-47
Identity = 104/359 (28.97%), Postives = 188/359 (52.37%), Query Frame = 2
Query:   83 LQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDY-----------VEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYE 1123
            ++ S +   ++ ++KA+ SA+EF++ I   DLE  ++ D L   +    ++G + V++ K+ Y+   C  +   +  T+  + C T I +++ +KL+ L +   E +K     + +K+ +   +    + + + E +  +  +  F +  + G+VSE ++ +L R++  +  VP+N + +  +    LS + +KAL   K  + ++ V + GIER +YSA      W  +F+PDGHL S+ Q+GSP  MK+  +              VEKD     P      L WE+DM+L S+FLD KE  K+    YL+ H E+K L+  F+Q +L+RKP +   FA  +F  F+S+  P  + E
Sbjct:    1 MEESELTQNETEELKASVSAVEFIH-IAQRDLEQCLFADSLVTVSDSGRELGDFSVSVTKASYNEELCYLLHANSHGTIDDVPCGTSIVAYISRKLEILEENHHEYVKLEKKTVDRKIHIVRQDDQLVVDRVISEREGVKTQTLKFPLSSLDGFVSEASNFLLLRIMARQKIVPENMTFLSLDADSGLSKSVYKALGWQKQMVGEDLVDIFGIERTIYSANLSSATWHCFFMPDGHLASRVQLGSPAVMKLLHLPFLLDGVIKTFFFLVEKDKI---PVMEKKPLIWEEDMELYSKFLDRKEELKADYSSYLRQHPELKALLADFLQFLLLRKPQDVFSFARDFFAPFASQSPPGKSQE 355          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Match: sp|Q7Z7H3|CATIP_HUMAN (Ciliogenesis-associated TTC17-interacting protein OS=Homo sapiens OX=9606 GN=CATIP PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.386e-33
Identity = 81/328 (24.70%), Postives = 162/328 (49.39%), Query Frame = 2
Query:  125 KATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITF 1090
            +A   A++FL+++  ++L+   + + L   +      G+  + +++  Y      LT C+ V   +   L  + C   +  ++ +KL+ + Q  ++ +KF    M +K+ +   +    +++ + E +  +     F    ++G++SE A+++L R++  R  VP N   +  +   +L   T++ L    + +  ++  V  +E+ V++ +      Q Y + DGHL  + QVGSP    + +M    E+D    +P F    L WE+DM+L S+FLD KE  +     YL+ H E   L+  F+  +L+R+P + V FA+ +F  F
Sbjct:   27 EANAEAIDFLSSLHKEELQMLFFSETLAMVSDTGEPQGELTIEVQRGKYQEKLGMLTYCLFVHASSRGFLDKMLCGNSLLGYLSEKLELMEQHSQDFIKFLILPMERKMSLLKQDDQLAVTRSIKEGEEVKTGVTSFPWSSIKGFISEAANLVLLRVMAWRRMVPSNARFLTLDTEGKLCYLTYQNLGFQTIQVDHQQAEVFIVEQTVHAEEGIPMSCQYYLLSDGHLAKRIQVGSPGCCIITKMPILREEDEIEPRPVFEKKPLVWEEDMELYSKFLDRKEELRLGHASYLRQHPEAHALISDFLLFLLLRQPEDVVTFAAEFFGPF 354          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Match: sp|B9EKE5|CATIP_MOUSE (Ciliogenesis-associated TTC17-interacting protein OS=Mus musculus OX=10090 GN=Catip PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.141e-31
Identity = 84/335 (25.07%), Postives = 165/335 (49.25%), Query Frame = 2
Query:  122 IKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLV-ARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKP 1108
            ++A P     L++  ++D+  F +P+ L   +      G+  + +++  Y      LT C+ V   +   L    C + +  ++   L+ + Q  +E +KF    M +K+ V   +  + +++ + E +  +     F  +  +G+VS  A+V+L R++   + VP     +  +   +L   T+K+L    + + +++  +  +E+ ++S +      Q Y +PDGHL  + QVGSP    + +M    E+D   S PTF    L W +D++L S+FLD KE  +     YL+ H E + L+  F+  +L+R+P + V FA+ +F  F++   P
Sbjct:   14 LEAGPGETASLHHPGLEDMLLF-FPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVTRSVKEGEETKTGVSVFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGNQQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFAALRSP 347          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Match: sp|M0RAU5|CATIP_RAT (Ciliogenesis-associated TTC17-interacting protein OS=Rattus norvegicus OX=10116 GN=Catip PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.770e-30
Identity = 85/336 (25.30%), Postives = 164/336 (48.81%), Query Frame = 2
Query:  152 LNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYD-----LTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKN 1141
            L +  ++D+  F +P+ L   +      G+  + ++K  Y      LT C+ V   +   L    C + +  ++ + L+ + Q  +E +KF    M +K+ V   +    +S+ + E +  +     F  + ++G+VS  A+V+L R++  R  VP     +  +   +L   T+K+L    + + +++  +  +E+ ++S        Q Y + DGHL  + QVGSP    + +M    E+D     PTF    L WE+D++L S+FLD KE  +    +YL+ H E + L+  F+  +L+R+P + V FA+ +F  F++   P     +S+  +
Sbjct:   23 LCHTGLEDMLLF-FPETLAILSDTGEPQGELTIEVQKGKYKDDLGILTHCLLVHASSRGFLDKSVCGSSLLGYLNEHLELMEQHSQEFIKFPIIPMERKMSVLKQDDQLVVSRSVKEGEETKTGVSVFPCKSLKGFVSSAANVVLLRVMAWRQSVPSGARFLALDSEGKLCYCTYKSLGFQTIQVGNQQAEMFIVEQTIHSEDGIPFSCQFYLLSDGHLAKRVQVGSPGCCIITKMPLIREEDVIEPPPTFDRKPLVWEEDLELYSKFLDRKEQLRLSHTRYLRQHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFGPFAALRSPIPALRSSHQPS 357          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Match: A0A1I8I1U5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 4.946e-67
Identity = 110/335 (32.84%), Postives = 193/335 (57.61%), Query Frame = 2
Query:  137 SALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKN 1141
            SAL FL  +  DD  Y ++ D L + +     +G+Y+++++K+      C+ V   +   +  + C T I+ +V   L+T+ Q   E +K     + ++V +   ++G  ++K +++ +  E  SK      M+G++SEGA+++L RLL+ +  P  F ++ F+    L  A++  L      I  + V V G++R++ S  D  T WQ YF+ D HL+++AQVGSP+ MKV ++ + +E D  + KP F   EL WEDD++L S++ + KE  K+  + Y++DH E+  +M  F+Q +L+RKPANPV+ A+ YF +FS+R+ P  ++  S S  
Sbjct:   38 SALAFLRELQEDDFTYLLFEDSLVSVSEQGKQLGEYKMSVEKAIKFGDPCLLVTASSHGLIDNVPCGTSISCYVTFNLETIEQRQHEYVKLENHPLDRRVDIVRCDEGLRVTKNVVQGERKETASKVMPYGAMEGFISEGANLLLQRLLITKIFPSFFDVLSFDSDSNLCQASYTFLGEKSQLIGGQPVQVLGVQRVIQSMTDVPTSWQTYFLKDSHLITRAQVGSPVIMKVLQIPELIEPDERIPKPDFPKRELQWEDDLELYSRYSERKEAIKADHLSYMRDHPELSAMMSDFLQHLLLRKPANPVQSAAEYFASFSTRLPPQASFIRSGSAG 372          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Match: A0A1S3HRK3 (ciliogenesis-associated TTC17-interacting protein OS=Lingula unguis OX=7574 GN=LOC106157533 PE=4 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 1.538e-65
Identity = 111/332 (33.43%), Postives = 190/332 (57.23%), Query Frame = 2
Query:  125 KATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTY 1120
            KA+   + FL NID DD +Y M+ D L   +    ++G++ VT++    D      +   +   + G+ C T IT++V +KL+T+ Q   E +K     + +K  +   + G+ I++ + + +  +  ++ +  + M G++SEG++++L RL + + VPD F  + F+    L +A ++ALE  K  + ++ + V+GIER + S  D  T WQ YF  DGHL ++ QVGSP++M++  +   +E D    KPTF    LNWE+DM++ S+FLD KE   +    Y+K H E+K L+  F Q +L+RKP + + FA+ YF +FS+ +K    Y
Sbjct:   31 KASEDCILFLENIDDDDYKYLMFGDSLVTVSDTGRELGEFTVTIEPVKRDEQHVFLIHANSHGAIDGVPCGTSITAYVSKKLETIEQQHHEYVKLENHPLDRKTFIVKQDDGFVINRVITQGEDVQRTAQTYKFDDMAGFISEGSNLLLQRLFIKKGVPDLFECLSFDSDLNLCTAPYRALEERKQIVDNQDIVVHGIERTINSISDLPTTWQSYFTKDGHLTNRVQVGSPVTMRLTRVPTPIEPDEEPEKPTFGKQPLNWEEDMEMYSKFLDRKEQLVNDHTVYMKKHPELKALLADFTQFLLLRKPDDVISFAADYFSSFSTTMKSASPY 362          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Match: K1PAC7 (Uncharacterized protein C2orf62-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10005459 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.878e-64
Identity = 109/333 (32.73%), Postives = 190/333 (57.06%), Query Frame = 2
Query:  140 ALEFLNNIDI-DDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNS 1135
            AL F+++I   DD +Y M+ D L   +    ++G++ ++++ + Y  T C  +   +  ++ G+ C T IT++V Q L+T+ Q   E +K     + +K  +      + I++ + + +  +  SK   +  M+G++SEG++++LHRLL+ + +PDN   + F+    L S  ++ LE     +   ++ V G+ER + S  D  T WQ YF+ D H+ ++ QVGSP++MK+  +   +E+D    KP F    L+WEDDMQL S+FLD KE  K     Y++ H E+K L+  F+Q +L+RKP + V+FA+ YF +FS+ +     Y  SN+
Sbjct:   39 ALRFIDSIVAEDDYKYLMFDDHLVTVSDTGKELGEFTISVEPTRYKQTDCFLIHANSHGSIDGVPCGTSITAYVAQNLETIEQQHHEYVKLENCPLDRKTFIVKQPDNFIINRVITQGEDVQRSSKTVELAKMKGFISEGSNLLLHRLLIEKGIPDNLQFLSFDSDTNLCSVIYRPLEDRTQTVGSTEIRVFGVERTINSYSDLPTTWQSYFMQDCHMTNRVQVGSPVTMKLTSVPQLIERDEEPPKPVFEKKALSWEDDMQLYSKFLDRKEELKGDHTTYMRSHPELKNLLADFLQFLLLRKPDDVVQFAAEYFSSFSASMPSMTPYLASNA 371          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Match: A0A267FSF4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032198g1 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 5.068e-62
Identity = 102/319 (31.97%), Postives = 184/319 (57.68%), Query Frame = 2
Query:  185 FMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKN 1141
             ++ D L + +     +G+Y+++++K+      C+ V   +   +  + C T I+ +V   L+T+ Q   E +K     + ++V +   ++G  ++K +++ +  E  SK      M+G++SEGA+++L RLL+ +  P  F ++ F+    L  A++  L      I  + V V G++R++ S  D  T WQ YF+ D HL+++AQVGSP+ MKV ++ + +E D  + KP F   EL WEDD++L S++ + KE  K+  + Y++DH E+  +M  F+Q +L+RKPANPV+ A+ YF +FS+R+ P  ++  S S  
Sbjct:    1 LLFEDSLVSVSEQGKQLGEYKMSVEKAIKFGDPCLLVTASSHGLIDNVPCGTSISCYVTFNLETIEQRQHEYVKLENHPLDRRVDIVRCDEGLRVTKNVVQGERKETASKVMPYGAMEGFISEGANLLLQRLLITKIFPSFFDVLSFDSDSNLCQASYTFLGEKSQLIGGQPVQVLGVQRVIQSMTDVPTSWQTYFLKDSHLITRAQVGSPVIMKVLQIPELIEPDERIPKPDFPKRELQWEDDLELYSRYSERKEAIKADHLSYMRDHPELSAMMSDFLQHLLLRKPANPVQSAAEYFASFSTRLPPQASFIRSGSAG 319          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Match: A0A3S1ABE8 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_004742 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 7.975e-62
Identity = 110/349 (31.52%), Postives = 198/349 (56.73%), Query Frame = 2
Query:   95 SIQSFDSSKI-KATPSALEFLNNI-DIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNS 1135
            ++Q   +++I K +P AL++L+ I   +D +Y M+ D+L   +    ++G++ VT++ + Y    C  +   +  ++ G+ C T I  +V + L TL Q   E +K     + +K  +      Y IS+ + + +  +  +K   +E M+G++SEG++++LHRLL+ + + D+   I F+    L    +K+L+     + D ++ V G+ER + S  D  T WQ YF+ DGHL ++ QVGSP++MK+ ++   +E+D    KP F    LNWE+DMQ+ S+F+D KE  K     Y++ H E++ L+  F+Q +L+RKP + + FA+ YF  FS+ +     +  SN+
Sbjct:   21 TVQPAQTTEIPKTSPQALKYLDEIVPEEDFKYVMFDDQLVTVSDAGKELGEFTVTVEPTRYKGLECFLIHANSHGSIDGVPCGTSIVCYVSKCLDTLEQQHHEYVKLDNCPLDRKTFLVRQSDHYTISRVITQGEDVQRTTKNVPVEQMRGFISEGSNLLLHRLLIEKRMDDDLQFISFDSDTNLCPVIYKSLDERTQTVEDVELRVYGVERTINSTVDLPTTWQSYFMNDGHLTNRVQVGSPVTMKLAKVPVRIERDEETPKPVFEKKRLNWEEDMQMHSKFVDRKEELKGDHASYMRHHPELRALLADFLQFLLLRKPDDVIAFAADYFSAFSTSMPDPSPFLASNA 369          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 196.438 bits (498), Expect = 5.912e-59
Identity = 107/340 (31.47%), Postives = 185/340 (54.41%), Query Frame = 2
Query:  113 SSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVA-RHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENS 1129
            + + KA+P AL FL++I   +++  ++ D L   +    ++G++ V+++K+ Y+   C  V   +   +  I C T IT++V   L+TL Q   E +K     + +KV +   +    +++   E +  +  +    +  +QG+VSE  + I+ R+L   + +P+    + FN   +LS AT++ L T K  +  E V V GIE  + S  D +  W  YF+PDGHL S+ Q+GSP++M + ++     K+    KP F    L WE+DM+L S+FLD KE  K+    Y++DH E+K L+  FMQ +L+RKP +   FA  +F  F  +  P+ +++ S
Sbjct:   11 ADQPKASPEALAFLSSIGHREVDQCLFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITAYVSSSLETLEQNHHEYMKVQEHMLDRKVNMVRRDGCLVVNRVTTEKEEVKKQTFTLPLHSIQGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVGKEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKEERDQKPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPFDFQRPPDSSFKTS 350          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 187.578 bits (475), Expect = 7.269e-56
Identity = 111/340 (32.65%), Postives = 182/340 (53.53%), Query Frame = 2
Query:  113 SSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVA-RHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENS 1129
            + + KA+P AL FL++I++D     ++ D L   +    ++G++ V+++K+ Y+   C  V   +   +  I C T IT++V   L+TL Q   E +K     +  KV V  ++   E+ K+               +  +QG+VSE  + I+ R+L   + +P+    + FN   +LS AT++ L T K  +  E V V GIE  + S  D +  W  YF+PDGHL S+ Q+GSP++M + ++     KD    KP F    L WE+DM+L S+FLD KE  K+    Y++DH E+K L+  FMQ +L+RKP +   FA  +F  F  +  P+ +++ S
Sbjct:   11 ADQPKASPEALAFLSSIEVDQC---LFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITAYVSSSLETLEQNHHEYMKC----LYGKVHVYLLQ---EVKKQTFT----------LPLHSIQGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVGKEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKD---QKPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPFDFQRPPDSSFKTS 327          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Cavefish
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:103037303])

HSP 1 Score: 184.882 bits (468), Expect = 2.713e-54
Identity = 107/359 (29.81%), Postives = 185/359 (51.53%), Query Frame = 2
Query:  113 SSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKIT-------------------SFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVA-RHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENS 1129
            + + KA+P AL FL++I   +++  ++ D L   +    ++G++ V+++K+ Y+   C  V   +   +  I C T IT                   ++V   L+TL Q   E +K     + +KV +   +    +++   E +  +  +    +  +QG+VSE  + I+ R+L   + +P+    + FN   +LS AT++ L T K  +  E V V GIE  + S  D +  W  YF+PDGHL S+ Q+GSP++M + ++     K+    KP F    L WE+DM+L S+FLD KE  K+    Y++DH E+K L+  FMQ +L+RKP +   FA  +F  F  +  P+ +++ S
Sbjct:   11 ADQPKASPEALAFLSSIGHREVDQCLFADSLVTISDSGRELGEFSVSIQKASYENEPCYMVHANSHGAIDNIPCGTSITEKRYNLEDTTGPIPGDAFIAYVSSSLETLEQNHHEYMKVQEHMLDRKVNMVRRDGCLVVNRVTTEKEEVKKQTFTLPLHSIQGFVSEATNFIILRILAQQKKIPEKIMFLSFNADTQLSVATYRELGTKKQVVGKEMVDVFGIEMTISSGDDIQASWHCYFLPDGHLASRVQLGSPVTMNLLQLPPIANKEERDQKPVFEKKPLVWEEDMELHSKFLDRKEELKAGHSSYVRDHPELKTLLADFMQFLLLRKPQDVFSFAQDFFAPFDFQRPPDSSFKTS 369          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Sea Lamprey
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:767803])

HSP 1 Score: 159.458 bits (402), Expect = 1.803e-45
Identity = 106/340 (31.18%), Postives = 183/340 (53.82%), Query Frame = 2
Query:  128 ATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCY----DLTSCIK--VKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVAR-HVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYV----------EKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSS 1096
            A+  A+ FL +ID  +L + ++ D+L   +   T +G++ + +  + Y    D     +  V   ++  ++ I C T + ++V   L TL Q   E L+ +   + +KV +   E+   ++K + E +     S    M  + G++SE + ++L RLL  R HVP + + +  +    L++ TF++L T +L I ++KV V GIER +YS     T W  Y++ DGHL+ + QVGSP +M +  +              + DS + + T     LNWE+DMQ+ S+FLD KE   S+  +Y + H E++ L+  F+Q +L+RKPA+PV  A+ YF +FS+
Sbjct:    1 ASEEAINFLASIDPQELSHCLFGDELMTMSRDGTHLGEFRMRVYSAPYREHPDSGGGTRFLVHATSKGAINDIPCGTTVCAYVTTNLATLEQHHHEYLELNEQALDRKVELVWQEESLLVNKVVTEGEEVLRESVRLEMSHLAGFLSEASCLLLTRLLTRRAHVPHDLTFLCLDSESCLATCTFRSLGTEELSIGEKKVEVFGIERTLYSQTAPPTTWHSYYLLDGHLVRREQVGSPTTMMIVRLPAQTPAAEEAEEEGDTDSGVEQQT-----LNWEEDMQMYSRFLDRKEELLSEHAEYARAHPELRALLGDFLQYLLLRKPADPVACAAPYFASFSA 335          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Nematostella
Match: EDO33354 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE5])

HSP 1 Score: 70.8626 bits (172), Expect = 1.064e-14
Identity = 37/161 (22.98%), Postives = 84/161 (52.17%), Query Frame = 2
Query:  185 FMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKAL 667
             ++PD L   +    ++G+  VT++K  +   SC+ V   +   +  +   T +T+++ + L T+ Q   E +K     + K+  +   E GY I K + + +        FS E  QG++SEG+++++ R+++ + VP + + + F+    LS++++ ++
Sbjct:    1 LVFPDTLVTTSTTGREIGEMSVTVEKVVWKDESCLLVHANSHGVVDQVPIGTSVTAYINRSLATIEQTHYEYVKIPEKPLDKRTYLTLDETGYTIRKTISQGEEVRKTESHFSPEDFQGFISEGSNLLIQRIMILKGVPPDMTFLAFDSETNLSTSSYVSI 161          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Medaka
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:101159136])

HSP 1 Score: 134.035 bits (336), Expect = 1.488e-35
Identity = 84/324 (25.93%), Postives = 168/324 (51.85%), Query Frame = 2
Query:  125 KATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISK-EMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITF 1090
            +A+  A+  +++ + ++L+  ++ + L   +    ++G + VT++ +      C+ +  ++  T+ G  C T +T+F+  +L+ L + + E +K     +  +  +   +    I K   IE ++ +  S  + M  ++G ++EG+S++L RL+  R  VP+N   +  ++   +   TF  L   ++ +S +   V GI+R+V+  K     W+ YF+ +GHL+S+ QVGSP++M++ +     E          S+T++    D      FL+ ++  K +   YL+ H EI+ L+  FMQ +L+RKP N  +FA  YF  F
Sbjct:   26 EASDDAVALMSSFEPEELQRCVFTESLVVLSESGRELGTFNVTVQYAQKVQQPCLLLHAQSHGTIDGAPCGTTVTAFISCELEVLEEEYHEYIKLEGHSVDNRCHMVQKDGNILIEKVTTIEEEVTKE-SASYPMSSLRGLITEGSSLLLMRLITLRKTVPENMQFVTLDKQLNIIHITFSDLGEKQMEVSGQVREVFGIQRMVHCGKGRPDTWENYFLTNGHLVSRHQVGSPVTMRLLQQPPRTEGPE-----KVSLTQVERTVD------FLERQKELKEEYALYLRQHPEIRALISDFMQFLLLRKPENVYKFAKEYFSPF 337          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Medaka
Match: catip (ciliogenesis associated TTC17 interacting protein [Source:NCBI gene;Acc:101159136])

HSP 1 Score: 134.035 bits (336), Expect = 1.488e-35
Identity = 84/324 (25.93%), Postives = 168/324 (51.85%), Query Frame = 2
Query:  125 KATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISK-EMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARH-VPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITF 1090
            +A+  A+  +++ + ++L+  ++ + L   +    ++G + VT++ +      C+ +  ++  T+ G  C T +T+F+  +L+ L + + E +K     +  +  +   +    I K   IE ++ +  S  + M  ++G ++EG+S++L RL+  R  VP+N   +  ++   +   TF  L   ++ +S +   V GI+R+V+  K     W+ YF+ +GHL+S+ QVGSP++M++ +     E          S+T++    D      FL+ ++  K +   YL+ H EI+ L+  FMQ +L+RKP N  +FA  YF  F
Sbjct:   26 EASDDAVALMSSFEPEELQRCVFTESLVVLSESGRELGTFNVTVQYAQKVQQPCLLLHAQSHGTIDGAPCGTTVTAFISCELEVLEEEYHEYIKLEGHSVDNRCHMVQKDGNILIEKVTTIEEEVTKE-SASYPMSSLRGLITEGSSLLLMRLITLRKTVPENMQFVTLDKQLNIIHITFSDLGEKQMEVSGQVREVFGIQRMVHCGKGRPDTWENYFLTNGHLVSRHQVGSPVTMRLLQQPPRTEGPE-----KVSLTQVERTVD------FLERQKELKEEYALYLRQHPEIRALISDFMQFLLLRKPENVYKFAKEYFSPF 337          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Planmine SMEST
Match: SMESG000029479.1 (SMESG000029479.1)

HSP 1 Score: 734.947 bits (1896), Expect = 0.000e+0
Identity = 358/359 (99.72%), Postives = 358/359 (99.72%), Query Frame = 2
Query:   80 MLQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKNIDFLL 1156
            MLQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFK LETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKNIDFLL
Sbjct:    1 MLQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKTLETIKLPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENSNSKNIDFLL 359          
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Planmine SMEST
Match: SMESG000009424.1 (SMESG000009424.1)

HSP 1 Score: 232.261 bits (591), Expect = 1.671e-72
Identity = 115/331 (34.74%), Postives = 189/331 (57.10%), Query Frame = 2
Query:  128 ATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTTDVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTLYQIFEEILKFSTFKMTKKVVVKSME---KGYEISKEMIE-NDIDEHWSKFFSMEIMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIKLPISDEK---VAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMKVYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKYLKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSR 1099
            A+P+AL F+  I + DL+Y  + D L  FT    ++G Y   +K+ CY    CI V+ R+E  + G+ C T + +++   L+TLYQ   E+++        ++ +   +   +GY I KE+ + N+  E   + F+  +M GY+SEGA+++L R+++++ +PD F ++ F+    L  A++K L  +K+ I   +   +   GIER +    D    WQ YF  DGHL+S+ Q+GSP+ MKV  +   +E D FL  P F    LNW DD+QL   F D KE   + +  Y++ H E+++L+  F+QA+L  KP N ++FA  +F TFS+R
Sbjct:   36 ASPNALGFIEKITLTDLKYTFFIDDLMTFTEDDKEIGFYRANVKEGCYKGDECIIVEARSEGIVEGVPCFTDVLAYLNASLQTLYQRLHEVVRLPQGGALDRLTITEFDGSVEGYRIRKEIKQGNEKREVTERTFAHAVMHGYISEGANIVLQRIIMSKGLPDYFDVVSFDADTNLCLASYKDLAALKIQIGSPQQTQLRCYGIERRLQCLTDVPVTWQTYFQSDGHLISRVQIGSPLQMKVRSVPKLIEHDEFLPVPAFPRAHLNWRDDLQLTRIFQDRKEELAAANRLYMRSHPELQHLIADFLQALLAHKPENTIQFAGDFFATFSNR 366          
The following BLAST results are available for this feature:
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CATIP9.133e-3424.70ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
catip1.593e-4828.97ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000050581.11.126e-5231.20ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Catip3.061e-3225.07ciliogenesis associated TTC17 interacting protein ... [more]
Catip1.087e-3025.00ciliogenesis associated TTC17 interacting protein ... [more]
Catip3.067e-1220.42ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0IHI3|CATIP_XENLA4.668e-5431.94Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|Q08CH6|CATIP_DANRE1.203e-4728.97Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|Q7Z7H3|CATIP_HUMAN4.386e-3324.70Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|B9EKE5|CATIP_MOUSE2.141e-3125.07Ciliogenesis-associated TTC17-interacting protein ... [more]
sp|M0RAU5|CATIP_RAT2.770e-3025.30Ciliogenesis-associated TTC17-interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I1U54.946e-6732.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3HRK31.538e-6533.43ciliogenesis-associated TTC17-interacting protein ... [more]
K1PAC73.878e-6432.73Uncharacterized protein C2orf62-like protein OS=Cr... [more]
A0A267FSF45.068e-6231.97Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A3S1ABE87.975e-6231.52Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
catip5.912e-5931.47ciliogenesis associated TTC17 interacting protein ... [more]
catip7.269e-5632.65ciliogenesis associated TTC17 interacting protein ... [more]
catip2.713e-5429.81ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
catip1.803e-4531.18ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO333541.064e-1422.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
catip1.488e-3525.93ciliogenesis associated TTC17 interacting protein ... [more]
catip1.488e-3525.93ciliogenesis associated TTC17 interacting protein ... [more]
back to top
BLAST of Ciliogenesis associated TTC17 interacting protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000029479.10.000e+099.72SMESG000029479.1[more]
SMESG000009424.11.671e-7234.74SMESG000009424.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006301 ID=SMED30006301|Name=Ciliogenesis associated TTC17 interacting protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1207bp
ATCAAATTTCTGATTAATATTTCGTATAGATTTTTAAACTTCAACCGTTT
ATTATATATAAAATTAATTAAATATACAAATGCTGCAACGATCGAGTATA
CAAAGTTTTGATAGTTCAAAAATTAAAGCTACTCCTAGTGCTTTGGAATT
TTTAAATAATATAGATATCGATGATTTGGAATATTTTATGTATCCTGATA
AATTAGGAAATTTTACTTTTTTGACCACTGATGTAGGAAAATATGAGGTA
ACTCTAAAGAAATCTTGTTATGACCTTACTTCTTGTATTAAAGTTAAAAT
AAGGAACGAAATCACTTTGTCGGGTATTTATTGCCAAACCAAAATCACAT
CATTTGTAGGTCAGAAATTGAAGACACTTTATCAGATTTTTGAAGAAATT
CTAAAATTTTCTACTTTTAAAATGACAAAAAAAGTGGTGGTAAAATCCAT
GGAAAAAGGTTACGAAATATCAAAAGAAATGATTGAAAACGATATAGATG
AGCATTGGTCGAAATTCTTTTCGATGGAAATTATGCAAGGTTATGTTTCT
GAAGGAGCTAGTGTTATACTTCACAGGCTTCTTGTAGCACGCCATGTGCC
CGATAATTTTTCTATTATAGTATTCAATCAGTATTGGGAATTATCTTCTG
CAACATTCAAAGCTTTAGAAACTATAAAATTACCCATCTCTGATGAAAAG
GTCGCAGTAAATGGTATTGAACGCATAGTTTATTCGGCCAAAGATTATGA
AACAATTTGGCAAATGTACTTTGTTCCCGATGGTCATCTAATGTCTAAAG
CACAAGTTGGATCTCCAATATCAATGAAAGTCTACGAGATGACGGATTAT
GTTGAAAAAGATAGTTTTTTAAGCAAGCCCACATTTAGCATGACCGAATT
AAATTGGGAAGATGATATGCAATTGATATCACAGTTTTTAGACATGAAAG
AAGTTAATAAATCCAAAAGCATTAAATATTTGAAAGATCATATGGAAATT
AAATACCTCATGAAAAGTTTTATGCAAGCCATTTTAATTCGTAAACCTGC
AAATCCTGTTGAATTTGCTTCTAGATATTTTATAACGTTTTCCTCGAGAG
TGAAACCGAATTATACTTATGAAAATTCTAATTCCAAAAATATTGATTTT
TTATTGTAAGAGAAATTATCTAAGGAAATCTCGTTTTAAGTAAAAGTGGG
CTTATTT
back to top

protein sequence of SMED30006301-orf-1

>SMED30006301-orf-1 ID=SMED30006301-orf-1|Name=SMED30006301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=360bp
MLQRSSIQSFDSSKIKATPSALEFLNNIDIDDLEYFMYPDKLGNFTFLTT
DVGKYEVTLKKSCYDLTSCIKVKIRNEITLSGIYCQTKITSFVGQKLKTL
YQIFEEILKFSTFKMTKKVVVKSMEKGYEISKEMIENDIDEHWSKFFSME
IMQGYVSEGASVILHRLLVARHVPDNFSIIVFNQYWELSSATFKALETIK
LPISDEKVAVNGIERIVYSAKDYETIWQMYFVPDGHLMSKAQVGSPISMK
VYEMTDYVEKDSFLSKPTFSMTELNWEDDMQLISQFLDMKEVNKSKSIKY
LKDHMEIKYLMKSFMQAILIRKPANPVEFASRYFITFSSRVKPNYTYENS
NSKNIDFLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060271cilium morphogenesis
GO:0061371determination of heart left/right asymmetry
GO:0030030cell projection organization
GO:0030041actin filament polymerization
GO:0044782cilium organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR003117cAMP_dep_PK_reg_su_I/II_a/b
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0015629actin cytoskeleton
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR15505:SF3CILIOGENESIS-ASSOCIATED TTC17-INTERACTING PROTEINcoord: 10..352
NoneNo IPR availablePANTHERPTHR15505FAMILY NOT NAMEDcoord: 10..352
NoneNo IPR availableSUPERFAMILYSSF47391Dimerization-anchoring domain of cAMP-dependent PK regulatory subunitcoord: 299..337