SMED30006289

Overview
NameSMED30006289
Smed IDSMED30006289
Length (bp)702
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006289 (SMED30006289) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006289 (SMED30006289) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006289

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006289SMESG000022669.1 Contig4678newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006289SMESG000022669.1 Contig4678uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006289SMESG000070491.1 SMESG000070472.1 Contig4678newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006289SMESG000070491.1 SMESG000070472.1 Contig4678uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30006289SMESG000022669.1 SmedASXL_030336SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30006289SMESG000022669.1 dd_Smed_v4_13695_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30006289SMESG000022669.1 dd_Smed_v6_13695_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006289 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003391:46454..47148 -3475
Homology
BLAST of SMED30006289 vs. Ensembl Fly
Match: TM4SF (gene:FBgn0020372 transcript:FBtr0072130)

HSP 1 Score: 51.9878 bits (123), Expect = 1.152e-7
Identity = 40/136 (29.41%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  338 LLIKSKLVQSVEKFEEGVGTDFI--------------NFLQVTFKCCGVSGPQDWIKRSPGLPFSCC-YSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN*HLFILYYLND 700
            L ++  L  SVE F +    +F+              N +Q   +CCGV GP D+  R   LP+SCC            T YK+GC  V+   + + +  +A  AA++ + Q    +GI   +   HL IL+  ND
Sbjct:  105 LAMRENLPTSVEIFIDDSFVEFLDKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDY--RRLSLPWSCCSRPEHAYESACDTHYKRGCLAVVSEQIRNRLLITAFGAAIIAIFQ---SLGIFCAV---HLTILFGKND 232          
BLAST of SMED30006289 vs. Ensembl Fly
Match: TM4SF (gene:FBgn0020372 transcript:FBtr0330600)

HSP 1 Score: 51.6026 bits (122), Expect = 1.270e-7
Identity = 40/136 (29.41%), Postives = 61/136 (44.85%), Query Frame = 2
Query:  338 LLIKSKLVQSVEKFEEGVGTDFI--------------NFLQVTFKCCGVSGPQDWIKRSPGLPFSCC-YSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN*HLFILYYLND 700
            L ++  L  SVE F +    +F+              N +Q   +CCGV GP D+  R   LP+SCC            T YK+GC  V+   + + +  +A  AA++ + Q    +GI   +   HL IL+  ND
Sbjct:  105 LAMRENLPTSVEIFIDDSFVEFLDKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDY--RRLSLPWSCCSRPEHAYESACDTHYKRGCLAVVSEQIRNRLLITAFGAAIIAIFQ---SLGIFCAV---HLTILFGKND 232          
BLAST of SMED30006289 vs. Ensembl Xenopus
Match: ENSXETT00000022327.1 (tetraspanin-4-like [Source:NCBI gene;Acc:101734690])

HSP 1 Score: 46.595 bits (109), Expect = 3.433e-6
Identity = 24/89 (26.97%), Postives = 44/89 (49.44%), Query Frame = 2
Query:  395 TDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCK-QLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ-FASFIGILM 655
            T+  + +Q  F+CCGV    DW++    +P +CC  +   CK   K ++++ C+  +   +  +I    +    +LVVQ F     +LM
Sbjct:   26 TNAWDIVQTEFRCCGVKNATDWLESKGSVPHTCCVEHSPACKSNPKLWWEEACYNKVRNWVESNIRSVGIFGICILVVQVFGLIFSMLM 114          
BLAST of SMED30006289 vs. Ensembl Xenopus
Match: asmt (acetylserotonin O-methyltransferase [Source:Xenbase;Acc:XB-GENE-942483])

HSP 1 Score: 46.2098 bits (108), Expect = 8.254e-6
Identity = 24/89 (26.97%), Postives = 44/89 (49.44%), Query Frame = 2
Query:  395 TDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCK-QLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ-FASFIGILM 655
            T+  + +Q  F+CCGV    DW++    +P +CC  +   CK   K ++++ C+  +   +  +I    +    +LVVQ F     +LM
Sbjct:   63 TNAWDIVQTEFRCCGVKNATDWLESKGSVPHTCCVEHSPACKSNPKLWWEEACYNKVRNWVESNIRSVGIFGICILVVQVFGLIFSMLM 151          
BLAST of SMED30006289 vs. TrEMBL
Match: A0A336LVF9 (Tetraspanin OS=Culicoides sonorensis OX=179676 GN=CSON005465 PE=3 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.319e-7
Identity = 40/142 (28.17%), Postives = 66/142 (46.48%), Query Frame = 2
Query:  266 IFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKFEEGVG-TDFINFLQVTFKCCGVSGPQDWIK-----RSPGLPFSCCYSNFGK-----CKQL-KTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILM 655
            + +V+  +ELS  +   +L  +   L+   L +++E + +    T   + +Q+ FKCCGV  P+DWI       S GLP SCC   FG      CK   +  YK GC    G+ +  H      +  +L  +Q    + I++
Sbjct:   91 LLIVVFILELSAGISGYVLRNQTTRLVGDGLSKTMEDYSKSEEITKIWDEIQMDFKCCGVHKPEDWIPILNTTESGGLPMSCCEPKFGNIGSSSCKSTDENVYKNGCIDEFGKFVRAHAVSIGAAGLILACIQLTGALLIVV 232          
BLAST of SMED30006289 vs. TrEMBL
Match: A0A336N925 (Tetraspanin OS=Culicoides sonorensis OX=179676 GN=CSON009469 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.370e-7
Identity = 39/133 (29.32%), Postives = 62/133 (46.62%), Query Frame = 2
Query:  266 IFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKFEEGVG-TDFINFLQVTFKCCGVSGPQDWI-----KRSPGLPFSCCYSNFGK-----CKQL-KTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ 628
            + +V+  +ELS  +   +L  +   L+   L +++E + +    T   + +Q+ FKCCGV  P+DWI       S GLP SCC   FG      CK   +  YK GC    G+ +  H      +  +L  +Q
Sbjct:   91 LLIVVFILELSAGISGYVLRNQTTRLVGDGLSKTMEDYSKSEEITKIWDEIQMDFKCCGVHKPEDWIPILNTTESGGLPMSCCEPKFGNIGSSSCKSTDENVYKNGCIDEFGKFVRAHAVSIGAAGLILACIQ 223          
BLAST of SMED30006289 vs. TrEMBL
Match: A0A194QSH1 (Tetraspanin OS=Papilio machaon OX=76193 GN=RR48_12772 PE=3 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 7.599e-7
Identity = 35/129 (27.13%), Postives = 65/129 (50.39%), Query Frame = 2
Query:  266 IFLVITSMELSLFLKCGLLGERNKLL--IKSKLVQSVEKFEEGVG-TDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQL----KTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQF 631
            + L++T++   + +     G +N  +  I++ ++QSV+ +E         + LQ+ F+CCGV+G  DW +    +P SCC+ ++G            Y  GC  V+G  L ++ Y   + AA++  VQ 
Sbjct:   87 VVLLLTTLVFEIVMTVVAFGLKNDAVSEIRAPMIQSVQFYETRRDIAKLWDDLQMEFECCGVAGRHDWARDR--IPVSCCHIDYGTVSPFVCTTANSYLVGCASVLGEWLSYYAYVIGVVAAIVTGVQL 213          
BLAST of SMED30006289 vs. TrEMBL
Match: A0A3Q3XHS9 (Tetraspanin OS=Mola mola OX=94237 PE=3 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.442e-6
Identity = 36/120 (30.00%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  329 RNKL--LIKSKLVQSVEKFEEGVGT--DFINFLQVTFKCCGVSGPQDWIKRSPG---LPFSCCYS-----NFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGIL 652
            RNK+  +++  L   + K++ G G   D ++ LQ+  KCCGV+   DW   +PG   +P SCC +       G        Y+KGC   + + L  +I +  ++A   LV+ F   +GI+
Sbjct:  108 RNKVSVVVQDNLTDMISKYKNGTGEFKDTVDKLQIDMKCCGVNNSSDWRYLAPGGNTVPDSCCLNITRSCGNGTMTDPTIVYQKGCHDAVVQFLQKNIQWVIVAA---LVIAFLQIMGIV 224          
BLAST of SMED30006289 vs. TrEMBL
Match: A0A484BSB8 (Tetraspanin OS=Drosophila navojoa OX=7232 GN=AWZ03_001728 PE=3 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.205e-6
Identity = 27/84 (32.14%), Postives = 42/84 (50.00%), Query Frame = 2
Query:  392 GTDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFI 643
            GTD + F Q TFKCCG++GP D+ K +  +P SC  +N        T Y  GC   +       +    +   +L+ V+ A+F+
Sbjct:  119 GTDAMGFYQTTFKCCGITGPIDYTKSNLTIPASCYVTNSTATTSTHTVYPDGCLNKLIDFFEQAMKLVKVFGWILIAVEAAAFV 202          
BLAST of SMED30006289 vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 52.373 bits (124), Expect = 1.631e-8
Identity = 39/138 (28.26%), Postives = 62/138 (44.93%), Query Frame = 2
Query:  269 FLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEK-FEEGVGTD------FINFLQVTFKCCGVSGPQDWIKR-------SPGLPFSCCYSNFGKC----KQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ 628
            F ++  M  SL +   LLG   +  +K K+ +++ + F E  GTD       I+++Q   KCCGV    DW  R       +  +P SCC SN   C    K     Y +GC  ++ + +   + Y    A +  +VQ
Sbjct:   88 FFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNGTDSNTASRAIDYVQHQLKCCGVKNYLDWKDRPWFNHTGNNSVPISCCRSNVTHCDGNIKHPGDIYNEGCEAMVEKTVKDILNYVMRVALIYALVQ 225          
BLAST of SMED30006289 vs. Ensembl Nematostella
Match: EDO39847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S901])

HSP 1 Score: 53.1434 bits (126), Expect = 1.258e-8
Identity = 38/123 (30.89%), Postives = 53/123 (43.09%), Query Frame = 2
Query:  314 GLLGERNKLLIKSKLVQSVEKFEE---GVGTDFINFLQVTFKCCGVSGPQDW-----IKRSPGLPFSCCYSNFGKC-----KQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFI 643
            G L   NK  I+++L + + K  E   G     IN +Q  FKCCG     DW     +K S  +P SCC S    C     K  K  Y KGC+ +I   +   +      A  +LV+Q    +
Sbjct:  101 GALAYNNKDKIENRLDKDILKAIENYPGKNEKSINDMQTKFKCCGADNYTDWQSNIKMKNSSSVPDSCCKSEKAGCGVGGVKDPKDIYTKGCFTIIKGEIEKSLKPIGGLAIAVLVIQLLGMV 223          
BLAST of SMED30006289 vs. Ensembl Nematostella
Match: EDO41431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S485])

HSP 1 Score: 49.6766 bits (117), Expect = 2.598e-7
Identity = 41/144 (28.47%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  293 LSLFLKCGLLG--ERNKL-LIKSKLVQSVEKF-EEGVGTDFINFLQVTFKCCGVSGPQDWI-----------KRSPGLPFSCCYSNFGKCKQ-------LKT--------FYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFA 634
            L L + CG +   +++K+  +K +L Q ++K+ ++ +  D I+F+Q   KCCGV   +DW            + S G+PFSCC  +    +Q       LKT         Y  GCW     I G+      ++ AVL+ + F 
Sbjct:   94 LILLIACGAVAYTQKDKVQALKERLKQDLKKYLDDPLNQDLIDFMQTLLKCCGVESYKDWQANPYFNCSSPGRMSCGVPFSCCKESIQFNRQCGYDAGKLKTDAERLENGVYSGGCWP---SIKGNLYTVIGITGAVLICIIFT 234          
BLAST of SMED30006289 vs. Ensembl Nematostella
Match: EDO34309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ7])

HSP 1 Score: 47.7506 bits (112), Expect = 9.572e-7
Identity = 32/111 (28.83%), Postives = 52/111 (46.85%), Query Frame = 2
Query:  266 IFLVITSMELSLFLKCGLLG----ERNKLLIKSKLVQSVEKF--EEGVGTDFINFLQVTFKCCGVSGPQDWI-----KRSPGLPFSCCYSNFGKCKQLKTFYK-KGCWKVI 562
            IF ++  +  SL +  G+LG     + K  +K+ L  +++ +  EE      ++ LQ    CCG +GP DW+     K    LP SCC  +   C     F+  KGC+  +
Sbjct:   80 IFFILLLVVFSLEITAGVLGAIYKNQAKDEVKNGLTDAIDHYSKEEQGFQKAVDKLQENLDCCGSTGPNDWVNSTFWKEKHHLPKSCCTHDSDVCFPYDKFHNTKGCYTTL 190          
BLAST of SMED30006289 vs. Ensembl Nematostella
Match: EDO41432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S486])

HSP 1 Score: 47.3654 bits (111), Expect = 1.005e-6
Identity = 34/112 (30.36%), Postives = 50/112 (44.64%), Query Frame = 2
Query:  338 LLIKSKLVQSVEKFEEGVGT--------DFINFLQVTFKCCGVSGPQDW-----------IKRSPGLPFSCCYSNFGKCKQ-------LKT--------FYKKGCWKVIGRI 571
             L + KLV    + E+G+ +        +FI+F+Q  FKCCG+   +DW           +  + G+PFSCC  +    +Q       LKT         Y KGC  V+G I
Sbjct:   53 FLQREKLVDPKARLEDGLKSYQQDSSKQEFIDFIQTRFKCCGIESYKDWQANRYFSCSSPVPTACGVPFSCCKKSIQGNRQCGYDAGKLKTDADRLENGVYSKGCVVVVGFI 164          
BLAST of SMED30006289 vs. Ensembl Nematostella
Match: EDO41430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S484])

HSP 1 Score: 45.8246 bits (107), Expect = 4.880e-6
Identity = 35/134 (26.12%), Postives = 58/134 (43.28%), Query Frame = 2
Query:  326 ERNKLLIKSKLVQSVEKFEEGVGTDF---INFLQVTFKCCGVSGPQDWI-----------KRSPGLPFSCCYSNFGKCKQL---------------KTFYKKGCWKVIGRILGHHIYYS-AMSAAVLLVVQFAS 637
             R+K++  +KL   ++ + +    +F   I+ LQ   KCCG++   DW              S G+PFSCC  +    +Q                K  Y KGCWK     +  ++Y    ++AAVL+++   S
Sbjct:   98 HRDKVV--AKLKDDLQHYRDPDKENFQFLIDRLQTNLKCCGINSYNDWQTNVYFNCSSPGSESCGVPFSCCKESIQLNRQCGYDAGRMKTDAERLEKGVYSKGCWKTAISFIMDNLYLVIGITAAVLILIIVGS 229          
BLAST of SMED30006289 vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 53.5286 bits (127), Expect = 2.927e-8
Identity = 35/114 (30.70%), Postives = 56/114 (49.12%), Query Frame = 2
Query:  329 RNKL--LIKSKLVQSVEKFEEGVGTDF---INFLQVTFKCCGVSGPQDW---IKRSPGLPFSCCYSNFGKC-----KQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQF 631
            RNK+  ++   L + +E ++ G   DF   ++ +Q   KCCGV+   DW         +P SCC +    C     K   T Y+KGC  VI  +L  +I +  ++A V+ +VQ 
Sbjct:  108 RNKISPIVNEGLTKMIENYKNGT-DDFKATVDQIQENLKCCGVNSSSDWSYLDSDGNSVPDSCCINKTKGCGKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAAIVIALVQI 220          
BLAST of SMED30006289 vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 52.373 bits (124), Expect = 7.333e-8
Identity = 35/113 (30.97%), Postives = 56/113 (49.56%), Query Frame = 2
Query:  329 RNKL--LIKSKLVQSVEKFEEGVGTDF---INFLQVTFKCCGVSGPQDW---IKRSPGLPFSCCYSNFGKC-----KQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ 628
            RNK+  ++   L + +E ++ G   DF   ++ +Q   KCCGV+   DW         +P SCC +    C     K   T Y+KGC  VI  +L  +I +  ++A V+ +VQ
Sbjct:  108 RNKISPIVNEGLTKMIENYKNGT-DDFKATVDQIQENLKCCGVNSSSDWSYLDSDGNSVPDSCCINKTKGCGKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAAIVIALVQ 219          
BLAST of SMED30006289 vs. Planmine SMEST
Match: SMESG000022669.1 (SMESG000022669.1)

HSP 1 Score: 306.605 bits (784), Expect = 1.681e-106
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 2
Query:   17 MCLSYKWAILYXXXXXXXXXXXXXXXXVLGIQNYNNYXXXXXXXXXXXXXXXXXXXXXXXXXXNIRXXXXXXXXXXXXXXXXXIFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKFEEGVGTDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN 667
            MCLSYKWAILYGMMSSSSITGSLLIITVLGIQNYNNYPFDLFLDFLPLSIFILLILMVTIMVLNIRMSLMTQTSSSQSVSLFFIFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKFEEGVGTDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN
Sbjct:    1 MCLSYKWAILYGMMSSSSITGSLLIITVLGIQNYNNYPFDLFLDFLPLSIFILLILMVTIMVLNIRMSLMTQTSSSQSVSLFFIFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKFEEGVGTDFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN 217          
BLAST of SMED30006289 vs. Planmine SMEST
Match: SMESG000021802.1 (SMESG000021802.1)

HSP 1 Score: 58.151 bits (139), Expect = 4.845e-10
Identity = 40/144 (27.78%), Postives = 67/144 (46.53%), Query Frame = 2
Query:  266 IFLVITSMELSLFLKCGLLGERNKLLIKSKLVQSVEKF--EEGVGTDFINFLQVTFKCCGVSGPQDWIKRSPG-----LPFSCCYSN--FGKC-KQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFIGILMQLDN 667
            + L+I + ELS FL   LL  + +   +  L+  + K+  E  + T +I++LQ   KCCGV    DW ++ P       P SCC S   F  C K +   Y K C +V+   +   +   ++    L ++Q    +G+ +  D 
Sbjct:   94 LMLLICTFELSAFLSGTLLRSQVESRTRQDLLNQLNKYTMETNITTGYIDYLQQEIKCCGVDNITDWKRKFPSGYIEYYPDSCCKSEFLFLDCGKNISLIYTKSCMEVLTMWMSRDVLVFSLICFGLCLLQIMGIVGLCLVQDQ 237          
BLAST of SMED30006289 vs. Planmine SMEST
Match: SMESG000035080.1 (SMESG000035080.1)

HSP 1 Score: 47.7506 bits (112), Expect = 1.841e-6
Identity = 32/108 (29.63%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  335 KLLIKSKLVQSVEKFEEGVGTDFINFLQVTFKCCGVSGPQDWIKRSP--GLPFSCCYSNFGKCK---QLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQFASFI 643
            K+ I++ +   + K EE     F+N +Q   KCCGV    D+IK+     +PFSCC     +CK   + K  + KGC         H +   +M   V+  ++F   I
Sbjct:  120 KISIQNYMNSKITKQEE----IFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMI 223          
BLAST of SMED30006289 vs. Planmine SMEST
Match: SMESG000020341.1 (SMESG000020341.1)

HSP 1 Score: 46.595 bits (109), Expect = 4.528e-6
Identity = 24/77 (31.17%), Postives = 40/77 (51.95%), Query Frame = 2
Query:  398 DFINFLQVTFKCCGVSGPQDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAMSAAVLLVVQ 628
            DF + +Q  +KCCG++   D+I  +  +P SCC  N   C +L+ F KKGC K     + + +   A+    L ++ 
Sbjct:  132 DFFDKIQQKYKCCGLNNANDYIFNNAEIPKSCC-GNIKNCTELEAF-KKGCEKPTEAFVSYVLTTMALVVICLCIID 206          
The following BLAST results are available for this feature:
BLAST of SMED30006289 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TM4SF1.152e-729.41gene:FBgn0020372 transcript:FBtr0072130[more]
TM4SF1.270e-729.41gene:FBgn0020372 transcript:FBtr0330600[more]
back to top
BLAST of SMED30006289 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000022327.13.433e-626.97tetraspanin-4-like [Source:NCBI gene;Acc:101734690... [more]
asmt8.254e-626.97acetylserotonin O-methyltransferase [Source:Xenbas... [more]
back to top
BLAST of SMED30006289 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A336LVF94.319e-728.17Tetraspanin OS=Culicoides sonorensis OX=179676 GN=... [more]
A0A336N9257.370e-729.32Tetraspanin OS=Culicoides sonorensis OX=179676 GN=... [more]
A0A194QSH17.599e-727.13Tetraspanin OS=Papilio machaon OX=76193 GN=RR48_12... [more]
A0A3Q3XHS92.442e-630.00Tetraspanin OS=Mola mola OX=94237 PE=3 SV=1[more]
A0A484BSB85.205e-632.14Tetraspanin OS=Drosophila navojoa OX=7232 GN=AWZ03... [more]
back to top
BLAST of SMED30006289 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tspan3a1.631e-828.26tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of SMED30006289 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006289 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398471.258e-830.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414312.598e-728.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343099.572e-728.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414321.005e-630.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414304.880e-626.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30006289 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cd632.927e-830.70CD63 molecule [Source:NCBI gene;Acc:101174188][more]
cd637.333e-830.97CD63 molecule [Source:NCBI gene;Acc:101174188][more]
back to top
BLAST of SMED30006289 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022669.11.681e-106100.00SMESG000022669.1[more]
SMESG000021802.14.845e-1027.78SMESG000021802.1[more]
SMESG000035080.11.841e-629.63SMESG000035080.1[more]
SMESG000020341.14.528e-631.17SMESG000020341.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006289 ID=SMED30006289|Name=SMED30006289|organism=Schmidtea mediterranea sexual|type=transcript|length=702bp
CCGATCTTTCCTATCCATGTGTTTGTCATACAAATGGGCAATTTTGTATG
GAATGATGTCCTCCTCCTCGATCACTGGATCATTGCTGATCATCACGGTG
CTGGGAATACAGAACTATAATAATTATCCATTTGATCTGTTTTTGGATTT
CTTGCCTTTGTCAATTTTCATCTTGCTGATCCTTATGGTCACGATAATGG
TGCTGAATATCCGAATGTCGTTAATGACGCAGACCAGTTCTTCTCAGAGT
GTTTCGTTATTTTTCATCTTCCTTGTCATTACCTCGATGGAACTATCGCT
ATTTCTCAAGTGCGGTCTCCTAGGAGAACGAAATAAATTGTTGATAAAGA
GTAAATTGGTTCAGTCTGTCGAAAAATTCGAAGAAGGTGTAGGAACAGAT
TTCATCAATTTCCTTCAAGTCACTTTCAAATGTTGTGGCGTTAGTGGACC
ACAGGACTGGATCAAACGGAGTCCCGGGTTGCCTTTTAGTTGTTGCTATT
CTAATTTTGGAAAGTGCAAGCAATTAAAAACCTTCTATAAAAAAGGATGT
TGGAAAGTGATAGGAAGGATTCTTGGACATCATATATATTATTCAGCTAT
GTCAGCAGCGGTATTGCTGGTCGTCCAGTTTGCCAGTTTTATCGGGATAT
TAATGCAATTAGATAACTGACATCTGTTTATATTATATTATCTCAATGAT
GC
back to top

protein sequence of SMED30006289-orf-1

>SMED30006289-orf-1 ID=SMED30006289-orf-1|Name=SMED30006289-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
RSFLSMCLSYKWAILYGMMSSSSITGSLLIITVLGIQNYNNYPFDLFLDF
LPLSIFILLILMVTIMVLNIRMSLMTQTSSSQSVSLFFIFLVITSMELSL
FLKCGLLGERNKLLIKSKLVQSVEKFEEGVGTDFINFLQVTFKCCGVSGP
QDWIKRSPGLPFSCCYSNFGKCKQLKTFYKKGCWKVIGRILGHHIYYSAM
SAAVLLVVQFASFIGILMQLDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0000484secretory system
Vocabulary: INTERPRO
TermDefinition
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 51..211
e-value: 3.1E-13
score: 50.0
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 106..187
e-value: 5.8E-10
score: 40.9
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 123..190
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 128..179
e-value: 6.91836E-14
score: 62.9071
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 191..213