SMED30006263

Overview
NameSMED30006263
Smed IDSMED30006263
Length (bp)3545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30006263 (SMED30006263) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30006263 (SMED30006263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006263 (SMED30006263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006263 (SMED30006263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 SmedASXL_014829SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006263SMESG000056318.1 dd_Smed_v4_2292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006263SMESG000056318.1 dd_Smed_v4_2292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006263SMESG000056318.1 dd_Smed_v4_2292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v6_674_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v6_674_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v6_674_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006263SMESG000056318.1 dd_Smed_v4_2292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30006263SMESG000056318.1 dd_Smed_v4_2292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006263SMESG000056319.1 SMESG000056318.1 SMESG000022275.1 dd_Smed_v4_674_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006263 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.025890:2442..7607 -17342
Homology
BLAST of SMED30006263 vs. Planmine SMEST
Match: SMESG000056318.1 (SMESG000056318.1)

HSP 1 Score: 1423.3 bits (3683), Expect = 0.000e+0
Identity = 706/710 (99.44%), Postives = 707/710 (99.58%), Query Frame = 2
Query: 1244 STQTEDEIDFIMQFIKTSTNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDFYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTRXXXXXXXXXXXXYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARDQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLLNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 3373
            STQTEDEIDFIMQFIKTS NSEIIRTIKEIIYENLDLNDVACQTTFDLSFLD YLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILAR+QGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNL NSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF
Sbjct: 1958 STQTEDEIDFIMQFIKTSKNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDCYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARNQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLFNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 2667          

HSP 2 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 403/406 (99.26%), Postives = 405/406 (99.75%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFXXXXXXXXXXXXILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1220
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD
Sbjct: 1544 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1949          

HSP 3 Score: 534.258 bits (1375), Expect = 1.011e-161
Identity = 329/346 (95.09%), Postives = 334/346 (96.53%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  283 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 628          

HSP 4 Score: 530.406 bits (1365), Expect = 2.531e-160
Identity = 327/346 (94.51%), Postives = 333/346 (96.24%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFK SEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQ+DQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1220 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQIDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1565          

HSP 5 Score: 516.538 bits (1329), Expect = 1.321e-155
Identity = 312/346 (90.17%), Postives = 317/346 (91.62%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCT                ATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  607 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCT----------------ATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 936          

HSP 6 Score: 464.922 bits (1195), Expect = 6.040e-138
Identity = 304/346 (87.86%), Postives = 311/346 (89.88%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLE ++                    + EMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  915 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEILA-------------------QKIEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1241          

HSP 7 Score: 451.055 bits (1159), Expect = 2.303e-133
Identity = 286/304 (94.08%), Postives = 291/304 (95.72%), Query Frame = 3
Query:  129 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 304          
BLAST of SMED30006263 vs. Planmine SMEST
Match: SMESG000056318.1 (SMESG000056318.1)

HSP 1 Score: 1422.53 bits (3681), Expect = 0.000e+0
Identity = 706/710 (99.44%), Postives = 707/710 (99.58%), Query Frame = 2
Query: 1244 STQTEDEIDFIMQFIKTSTNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDFYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTRXXXXXXXXXXXXYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARDQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLLNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 3373
            STQTEDEIDFIMQFIKTS NSEIIRTIKEIIYENLDLNDVACQTTFDLSFLD YLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILAR+QGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNL NSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF
Sbjct: 1942 STQTEDEIDFIMQFIKTSKNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDCYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARNQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLFNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 2651          

HSP 2 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 403/406 (99.26%), Postives = 405/406 (99.75%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFXXXXXXXXXXXXILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1220
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD
Sbjct: 1528 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1933          

HSP 3 Score: 534.643 bits (1376), Expect = 8.598e-162
Identity = 329/346 (95.09%), Postives = 334/346 (96.53%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  283 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 628          

HSP 4 Score: 530.406 bits (1365), Expect = 2.160e-160
Identity = 327/346 (94.51%), Postives = 333/346 (96.24%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFK SEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQ+DQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1204 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQIDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1549          

HSP 5 Score: 491.5 bits (1264), Expect = 5.454e-147
Identity = 295/346 (85.26%), Postives = 301/346 (86.99%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTV                                +ATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  607 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTV--------------------------------EATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 920          

HSP 6 Score: 464.922 bits (1195), Expect = 5.308e-138
Identity = 304/346 (87.86%), Postives = 311/346 (89.88%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLE ++                    + EMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  899 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEILA-------------------QKIEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1225          

HSP 7 Score: 451.44 bits (1160), Expect = 2.028e-133
Identity = 286/304 (94.08%), Postives = 291/304 (95.72%), Query Frame = 3
Query:  129 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 304          
BLAST of SMED30006263 vs. Planmine SMEST
Match: SMESG000056318.1 (SMESG000056318.1)

HSP 1 Score: 1421.76 bits (3679), Expect = 0.000e+0
Identity = 706/710 (99.44%), Postives = 707/710 (99.58%), Query Frame = 2
Query: 1244 STQTEDEIDFIMQFIKTSTNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDFYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTRXXXXXXXXXXXXYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARDQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLLNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 3373
            STQTEDEIDFIMQFIKTS NSEIIRTIKEIIYENLDLNDVACQTTFDLSFLD YLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILAR+QGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNL NSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF
Sbjct: 1860 STQTEDEIDFIMQFIKTSKNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDCYLSSFGLDQIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYSTNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSLIELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISKVEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKYSQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIASQTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVCLKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEIHTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKTHERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNSMYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLRIKDVLNTETGDLYDEILARNQGLLLDNGSFFDKQANKEINFEMALLHHYIEVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLFNSTFKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLF 2569          

HSP 2 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 403/406 (99.26%), Postives = 405/406 (99.75%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFXXXXXXXXXXXXILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1220
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD
Sbjct: 1446 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQVNFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEWAEVGLD 1851          

HSP 3 Score: 534.643 bits (1376), Expect = 6.517e-162
Identity = 329/346 (95.09%), Postives = 334/346 (96.53%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  283 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 628          

HSP 4 Score: 526.168 bits (1354), Expect = 6.308e-159
Identity = 324/343 (94.46%), Postives = 330/343 (96.21%), Query Frame = 3
Query:   12 IKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            IKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFK SEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQ+DQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1125 IKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQIDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1467          

HSP 5 Score: 491.5 bits (1264), Expect = 4.687e-147
Identity = 295/346 (85.26%), Postives = 301/346 (86.99%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTV                                +ATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  607 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTV--------------------------------EATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 920          

HSP 6 Score: 451.44 bits (1160), Expect = 1.958e-133
Identity = 286/304 (94.08%), Postives = 291/304 (95.72%), Query Frame = 3
Query:  129 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 304          

HSP 7 Score: 325.094 bits (832), Expect = 2.135e-91
Identity = 254/389 (65.30%), Postives = 292/389 (75.06%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVS------------------------------WEIPMLDIATSTAKPT-LEDISTENVIKHVEYSGEW-CREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEI---------EFKNTIFECESSFVNLRRDSAI 1046
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENES+                               ++   +D+++ + K + + D+  E +   V++SG    + I+  +E F  +  V+  T+ S +++ K+     +F   +T + E+ +E KS ++E +S +         EF++ + EC S +     DS I
Sbjct:  899 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKYSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFM-CETVDSESSFECKS-IEESWSHVGGKAVEVSSEFRSVVVECSSEYTIRMEDSQI 1285          
BLAST of SMED30006263 vs. Planmine SMEST
Match: SMESG000022275.1 (SMESG000022275.1)

HSP 1 Score: 525.013 bits (1351), Expect = 2.618e-158
Identity = 322/328 (98.17%), Postives = 325/328 (99.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEF 986
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSS+FRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE 
Sbjct: 1884 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSDFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEM 2211          

HSP 2 Score: 523.087 bits (1346), Expect = 1.277e-157
Identity = 323/346 (93.35%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIET+EV VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1560 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETLEVDVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1905          

HSP 3 Score: 521.161 bits (1341), Expect = 4.740e-157
Identity = 324/346 (93.64%), Postives = 330/346 (95.38%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKF+ETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  283 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFKETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 628          

HSP 4 Score: 520.776 bits (1340), Expect = 5.833e-157
Identity = 322/346 (93.06%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFI+TLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFR VVVECSSEYTIRMEDSQVDQTIET+EVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  607 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFINTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRIVVVECSSEYTIRMEDSQVDQTIETLEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 952          

HSP 5 Score: 516.153 bits (1328), Expect = 2.221e-155
Identity = 322/346 (93.06%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQV QTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  931 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVYQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1276          

HSP 6 Score: 489.96 bits (1260), Expect = 1.862e-146
Identity = 291/346 (84.10%), Postives = 301/346 (86.99%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVE   +               +E  +VD         VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1255 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVENGRQSSRST----------IETLEVD---------VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1581          

HSP 7 Score: 485.337 bits (1248), Expect = 7.406e-145
Identity = 295/363 (81.27%), Postives = 303/363 (83.47%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEI---------EFKNTIFECESSF-VNLRRDSAIQVNFR 1061
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVE+               TI   +  V           MTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDE  ERLLIENESVSWEIPMLDIATST+KPTLEDISTENVI+HVEYSGEWC EIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEI         EF     + ESS  VN  +  A+ V  R
Sbjct: 2786 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEIK--------------TIETVEVGV-----------MTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDERIERLLIENESVSWEIPMLDIATSTSKPTLEDISTENVIEHVEYSGEWCGEIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEENSQETLTEFMFETVDSESSLNVNQLKKVAVHVGVR 3123          

HSP 8 Score: 476.478 bits (1225), Expect = 7.347e-142
Identity = 304/346 (87.86%), Postives = 313/346 (90.46%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMS                  +TVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSS+FRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLEDISTENVI+HVEYSGEWC EIKHESEMFE+EKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 2480 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMS------------------NTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSDFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLEDISTENVIEHVEYSGEWCGEIKHESEMFESEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 2807          

HSP 9 Score: 444.506 bits (1142), Expect = 4.254e-131
Identity = 283/304 (93.09%), Postives = 288/304 (94.74%), Query Frame = 3
Query:  129 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 304          

HSP 10 Score: 410.223 bits (1053), Expect = 1.763e-119
Identity = 264/293 (90.10%), Postives = 274/293 (93.52%), Query Frame = 3
Query:  162 VDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            +++   KLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 2209 IEMLVRKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 2501          
BLAST of SMED30006263 vs. Planmine SMEST
Match: SMESG000022275.1 (SMESG000022275.1)

HSP 1 Score: 524.628 bits (1350), Expect = 3.227e-158
Identity = 322/328 (98.17%), Postives = 325/328 (99.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEF 986
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSS+FRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE 
Sbjct: 1884 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSDFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEM 2211          

HSP 2 Score: 522.702 bits (1345), Expect = 1.590e-157
Identity = 323/346 (93.35%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIET+EV VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1560 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETLEVDVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1905          

HSP 3 Score: 520.776 bits (1340), Expect = 5.845e-157
Identity = 324/346 (93.64%), Postives = 330/346 (95.38%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKF+ETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  283 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFKETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 628          

HSP 4 Score: 520.776 bits (1340), Expect = 7.193e-157
Identity = 322/346 (93.06%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFI+TLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFR VVVECSSEYTIRMEDSQVDQTIET+EVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  607 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFINTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRIVVVECSSEYTIRMEDSQVDQTIETLEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 952          

HSP 5 Score: 516.153 bits (1328), Expect = 2.714e-155
Identity = 322/346 (93.06%), Postives = 329/346 (95.09%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQV QTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:  931 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVYQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1276          

HSP 6 Score: 489.574 bits (1259), Expect = 2.342e-146
Identity = 291/346 (84.10%), Postives = 301/346 (86.99%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVE   +               +E  +VD         VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 1255 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVENGRQSSRST----------IETLEVD---------VMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 1581          

HSP 7 Score: 484.952 bits (1247), Expect = 9.489e-145
Identity = 295/363 (81.27%), Postives = 303/363 (83.47%), Query Frame = 3
Query:    3 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEI---------EFKNTIFECESSF-VNLRRDSAIQVNFR 1061
            EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVE+               TI   +  V           MTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDE  ERLLIENESVSWEIPMLDIATST+KPTLEDISTENVI+HVEYSGEWC EIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEI         EF     + ESS  VN  +  A+ V  R
Sbjct: 2753 EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEIK--------------TIETVEVGV-----------MTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDERIERLLIENESVSWEIPMLDIATSTSKPTLEDISTENVIEHVEYSGEWCGEIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEENSQETLTEFMFETVDSESSLNVNQLKKVAVHVGVR 3090          

HSP 8 Score: 444.506 bits (1142), Expect = 5.196e-131
Identity = 283/304 (93.09%), Postives = 288/304 (94.74%), Query Frame = 3
Query:  129 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct:    1 MSSESFKDSEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 304          

HSP 9 Score: 420.624 bits (1080), Expect = 4.276e-123
Identity = 270/296 (91.22%), Postives = 278/296 (93.92%), Query Frame = 3
Query:  153 SEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDS 1040
            SEI   GFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSS+FRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLEDISTENVI+HVEYSGEWC EIKHESEMFE+EKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE K+     E+  + L   S
Sbjct: 2479 SEIEMFGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSDFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLEDISTENVIEHVEYSGEWCGEIKHESEMFESEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEIKSENIATETGLIELTHTS 2774          

HSP 10 Score: 405.986 bits (1042), Expect = 4.433e-118
Identity = 260/275 (94.55%), Postives = 267/275 (97.09%), Query Frame = 3
Query:  162 VDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDEGKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAXXXXXXXXXXXXXXXXXYTIRMEDSQVDQXXXXXXXXXXXXXXKFIDESSMFELSXXXXXXXXXXXXXXXXPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDISTENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEF 986
            +++   KLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTS E EGKFQETLTEF+CETVDSESSFECKSIEES SH GGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATST+KPTLE+ISTENVI+HVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIE 
Sbjct: 2209 IEMLVRKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSQEAEGKFQETLTEFMCETVDSESSFECKSIEESCSHFGGKAVEVSSEFRSVVVECSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECETVEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTSKPTLENISTENVIEHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQFEETKTRNIETGYEIKSTMKECFSEIEM 2483          
The following BLAST results are available for this feature:
BLAST of SMED30006263 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006263 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056318.11.011e-16199.44SMESG000056318.1[more]
SMESG000056318.18.598e-16299.44SMESG000056318.1[more]
SMESG000056318.16.517e-16299.44SMESG000056318.1[more]
SMESG000022275.12.618e-15898.17SMESG000022275.1[more]
SMESG000022275.13.227e-15898.17SMESG000022275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006263 ID=SMED30006263|Name=SMED30006263|organism=Schmidtea mediterranea sexual|type=transcript|length=3545bp
GTGAAATAGAGATCAAATCTGAAAACATTGCTACTGAAACGGGATTAATC
GAATTGACACATACGAGCTTGGAAAAAGATTCAAAGGCTTCAAATAAGTT
AACTGACTATAAAGCAGAGGCTATAGACATGAGCAGTGAATCATTCAAAG
ATAGCGAAATAGTAGATGTTGGTTTCGAAAAACTGAAAGACACAGTTGAC
TTCAGTGGTAGTGTAGAAAGTCAAATGATTGAAGTAGGAACAGAAACTTT
CGGAGAAAAGCATATTGTTTTCATTGATACACTTACGAGTCATGAAGATG
AAGGAAAATTCCAAGAAACATTGACTGAGTTCATATGTGAGACAGTAGAT
AGTGAAAGCAGTTTTGAATGTAAATCAATTGAAGAAAGTTGGAGTCACGT
TGGAGGTAAGGCAGTTGAGGTAAGCTCAGAATTCAGAAGTGTGGTTGTAG
AATGTTCGAGTGAATACACAATTAGAATGGAAGACAGTCAAGTAGACCAA
ACGATAGAAACAGTAGAAGTCGGTGTAATGACAGTAGAAGTGAAATTTAT
AGATGAGTCGTCGATGTTTGAATTGAGCTGCTGCACAGTTGAATGCGAAA
CTGTTGAAATTGTCGAAGAAATAGTTCCTAAACAGGCAACCGACGAAGAA
TCGGAAAGATTGTTAATTGAGAATGAGAGTGTAAGCTGGGAGATTCCAAT
GCTTGATATTGCTACTTCAACAGCTAAGCCGACATTAGAAGATATTAGCA
CAGAAAATGTAATTAAGCATGTTGAATATAGTGGAGAATGGTGTCGAGAA
ATTAAGCATGAAAGCGAAATGTTTGAAACAGAGAAATCAGTTTACTCAAC
AACTATCATATCATCAGATGAAGACATTAAATATTGTTCGGTTGAAATAC
AATTCGAAGAAACGAAGACTCGCAACATTGAAACTGGCTATGAAATCAAA
TCAACAATGAAAGAATGTTTCAGTGAAATAGAGTTTAAAAATACTATTTT
CGAATGTGAATCATCATTTGTGAATCTGCGTAGAGATTCTGCAATTCAAG
TGAACTTTCGATCTAAAACCTCTGATTTCACTCAGATGTTTGATGTTTCT
TCTACTGAAGACTCCGACACAGATTCGATTTTGGTTAAGGGTTCTGAAGC
TTTCTTAGATTTTTCTGAGCATTCTATGTCTGATGCTGATGATCTTGAAT
GGGCTGAAGTTGGCCTCGATCTAAATATTCTTCCCATTAATATTCTACCC
AAACTGAAGATGAAATCGATTTTATCATGCAATTTATTAAAACCTCTACA
AATTCAGAAATTATTAGAACAATTAAAGAAATAATATATGAAAATCTTGA
TCTAAATGATGTTGCCTGTCAAACTACGTTTGACTTATCATTTTTAGATT
TTTACCTTTCTTCTTTTGGATTAGATCAAATTGTAAATCAATTAAGGTCA
TTAAGGTACTTTGTCGATGAGGTTCAAAATACAGATCATGATCTCAGCCG
GTCTGTCGCCAGCCAATCTGAACCTAAAGAACTTTTCAATGTTGGAACAT
CATGTTTTTTGAAGGATATATATTCCACTAATCATGATATTAGTGTTTCA
ACAGAGTGTGATGATTTTTATTCTTATTTAAATATATACGAAGAAGATTC
TGAATTATCTTTAATACTTAAATCCGATTATCAATCCAATAAACAAAATA
GTATTGGAGAAACTCAAACGTCTTTGATTGAATTAAGATCAACTGGAGTT
CAAACGGTTTCGTCAATTAAAGAGCACTTTTCGATTCTTTCAGTTGTTGA
TAATATATTAGATACTATTTCAGAATCTTCTGTTATAGAATCCTTTATGG
AAAATTTCGAAGATTCGATTTCTAAAGTTGAAATTTATCGAATTACTGAT
GGTGGCAAATTAATATCTGATGAAGAAACTCAAACTGAATTAGATAATCG
CAGTTGTGGTGTTCAAATTTCTTTAGAAGATAATGACATGTTGAACAGTG
GATCAAATTTTGATGATTTCAAATATAGTCAATGGACTAAAGAGTCAGAA
TATATAGAAAGTATTTATACTCACGAATCGAATATCTTTGAAAATATTTT
ACATTCAACTGATTCTTTTCTTAAAATAGATGAACAAACTCAAACAAAAT
TTGGTTTTACTAGGTCAATTGCATCTCAAACAACAACAATAGATCTTACT
GAATCTTATTGGCAAGAATCTATTTCACAATTTGATAATCATATTTCGTT
ATCTATTCAAAAACAAAATATTTTACTATTTCCAAAATCGGATAAATCTT
CATGTTCACAAACTGATTCAGTTTGTCTCAAAGAATGTATAAGTGATTCG
TACTTGGCTGAATGGGCTGAGAAAACAGAAACAATTGAAATTTATCATCC
AATCATTACGGAACCATTAAAAGATACTGTTACCAGACTAACAGAAAGTT
TCGAAGAAGATGAGATTACAGAAATACATACAAGAGAAGTTAATGTTTTT
GAAGAAGAAACATTTGAAACATACTCAAGAATAACTGAATCATCCCAGAC
TGATCCATTTTTTGAGGATACAGAATCAATGTTTGAACAAGACTATAACA
GGCCATTTAAATTGTTGATGAAAACTCATGAACGTCAATTCAATTTAACT
GAAGTGATCGACCTGTCGTTACCATTGAATGTTACTCTCCAACGAGTGTC
TCATCCACGAAATAAAACTAAAGTTTCTGACATAGATATTGCAATTCACC
GTGGATGGATAGATACACAGAACTCAATGTACTGTAATCCTTCTTCAGAT
GAAAAAATGCCTTTAGAAATGGCTTGGAGAACAAATAAAATCGAAATTTC
AGAACCAATCTGTCCCAATAACAGGAGCTTTGGATTGTATGTTGAAAAGA
CTCTAACAAAAACTGAAAAACTTCGAATTAAAGACGTTCTAAATACAGAA
ACTGGAGACCTATATGATGAGATTTTAGCCAGAGATCAAGGGTTGCTATT
GGATAATGGATCATTTTTTGATAAACAGGCGAATAAAGAAATAAATTTCG
AAATGGCTCTTCTTCATCACTACATTGAAGTTCATAAAGACACTGAAGTC
ATTAATTTTTTCGAAAATGACAAAAAGTTTTTAAAAATCAATTTTGTCAT
TGATAAAGAAACTGGAGAATATTTTGATTTTCACACGGCTTCAGAAAGAG
GATTAGTGAATCTTCTCAATTCCACTTTCAAGGACACAGAGAGAAAATGC
GACATAAAATTTGAGGAAGCTGTCCATAGAGAAATAATCGAAACTGAAAG
AATTGATTCGATAAATAATTTCTATTTCCTTCATAAATCTAGTGACAATG
TTATCGAAAGAGAACGGTTGTTCAGTTCTGAATCTTGTGCGTCGAAATCT
CAATCAATGCAATCGTCAGATTATTTTAAAATGTGAAAATTATCAAATCC
TTTTGAACTGTTAATTTTGTAACGAAATTTTATTGACATTTTCTATTGGC
TTTATTTGTAGTTTTCTTGACTTATAATAAATCTCTCAATATTTA
back to top

protein sequence of SMED30006263-orf-1

>SMED30006263-orf-1 ID=SMED30006263-orf-1|Name=SMED30006263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=720bp
MQFIKTSTNSEIIRTIKEIIYENLDLNDVACQTTFDLSFLDFYLSSFGLD
QIVNQLRSLRYFVDEVQNTDHDLSRSVASQSEPKELFNVGTSCFLKDIYS
TNHDISVSTECDDFYSYLNIYEEDSELSLILKSDYQSNKQNSIGETQTSL
IELRSTGVQTVSSIKEHFSILSVVDNILDTISESSVIESFMENFEDSISK
VEIYRITDGGKLISDEETQTELDNRSCGVQISLEDNDMLNSGSNFDDFKY
SQWTKESEYIESIYTHESNIFENILHSTDSFLKIDEQTQTKFGFTRSIAS
QTTTIDLTESYWQESISQFDNHISLSIQKQNILLFPKSDKSSCSQTDSVC
LKECISDSYLAEWAEKTETIEIYHPIITEPLKDTVTRLTESFEEDEITEI
HTREVNVFEEETFETYSRITESSQTDPFFEDTESMFEQDYNRPFKLLMKT
HERQFNLTEVIDLSLPLNVTLQRVSHPRNKTKVSDIDIAIHRGWIDTQNS
MYCNPSSDEKMPLEMAWRTNKIEISEPICPNNRSFGLYVEKTLTKTEKLR
IKDVLNTETGDLYDEILARDQGLLLDNGSFFDKQANKEINFEMALLHHYI
EVHKDTEVINFFENDKKFLKINFVIDKETGEYFDFHTASERGLVNLLNST
FKDTERKCDIKFEEAVHREIIETERIDSINNFYFLHKSSDNVIERERLFS
SESCASKSQSMQSSDYFKM*
back to top

protein sequence of SMED30006263-orf-2

>SMED30006263-orf-2 ID=SMED30006263-orf-2|Name=SMED30006263-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
EIEIKSENIATETGLIELTHTSLEKDSKASNKLTDYKAEAIDMSSESFKD
SEIVDVGFEKLKDTVDFSGSVESQMIEVGTETFGEKHIVFIDTLTSHEDE
GKFQETLTEFICETVDSESSFECKSIEESWSHVGGKAVEVSSEFRSVVVE
CSSEYTIRMEDSQVDQTIETVEVGVMTVEVKFIDESSMFELSCCTVECET
VEIVEEIVPKQATDEESERLLIENESVSWEIPMLDIATSTAKPTLEDIST
ENVIKHVEYSGEWCREIKHESEMFETEKSVYSTTIISSDEDIKYCSVEIQ
FEETKTRNIETGYEIKSTMKECFSEIEFKNTIFECESSFVNLRRDSAIQV
NFRSKTSDFTQMFDVSSTEDSDTDSILVKGSEAFLDFSEHSMSDADDLEW
AEVGLDLNILPINILPKLKMKSILSCNLLKPLQIQKLLEQLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001101Plectin_repeat
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton