SMED30006256

Overview
NameSMED30006256
Smed IDSMED30006256
Uniprot Best hitCoiled-coil domain-containing protein 96 OS=Macaca fascicularis OX=9541 GN=CCDC96 PE=2 SV=1 (E=1.50442e-41)
Length (bp)1114
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30006256 (SMED30006256) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30006256 (SMED30006256) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006256 (SMED30006256) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006256 (SMED30006256) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006256

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006256SMESG000034101.1 SmedASXL_004335SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006256SMESG000034101.1 dd_Smed_v6_9313_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30006256SMESG000034101.1 dd_Smed_v4_9313_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006256 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001174:86269..87375 -5517
Homology
BLAST of SMED30006256 vs. Ensembl Human
Match: CCDC96 (coiled-coil domain containing 96 [Source:HGNC Symbol;Acc:HGNC:26900])

HSP 1 Score: 153.295 bits (386), Expect = 3.875e-41
Identity = 110/327 (33.64%), Postives = 189/327 (57.80%), Query Frame = -1
Query:   92 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKK-------VEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINT---RTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKI 1042
            R +L+ + ++  +E       N  +QHKI + LR+KK        ++ + A A EK     EQ Y + +  L +L +Q   +   +   + +L+ + +    +V+++  +FQ  +  +  +A+ +   R G+  + +++E I   E+KKE ++   RL  I+L+  +   ++ ++++E+L  GL LIDFEQ KIENQ++NEK+EER E+LLKLR K+T +V ++THVKEKL F+  E   ++  L E E + +  RD LT  KQ R+ LR+ N +L + CG+LG   LLR+ E+ VD  E+  +++  +K     LTL  +G++ KI
Sbjct:  225 RSDLLDQYRSLLVERNRSQRYNLYLQHKIFEALRRKKGLEAAEVADRGAEAEAPEK-----EQAYLRHLGMLEELKKQQADDLQWYHQELGQLKRQCQEKLTRVEKEWRRFQALKKQVVMQAMGSCRMRGGRQAALREVEQIQALEDKKEKEMSAVRLENIQLKQSLVHFETRMRTQEDLTQGLLLIDFEQLKIENQTFNEKIEERNEELLKLRSKVTNSVQVITHVKEKLHFMDMENACKKTQLAEIEAQAALGRDILTKTKQAREGLRTDNIRLNQKCGLLGKDSLLRDLEEKVDKTELLHRRLESLKRHHASLTLSCRGVRQKI 546          
BLAST of SMED30006256 vs. Ensembl Zebrafish
Match: ccdc96 (coiled-coil domain containing 96 [Source:ZFIN;Acc:ZDB-GENE-081022-156])

HSP 1 Score: 147.517 bits (371), Expect = 1.412e-39
Identity = 110/316 (34.81%), Postives = 194/316 (61.39%), Query Frame = -1
Query:   77 LKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKA-INTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKIENTRI 1021
            L   Q E + L +IN  +Q +I +   KKK +Q    +  ++ I + EQ Y K M+ + D+  Q    +   + R+E+L  ++    ++V+++   F   ++    KA +  + GK  +   +E++   E K+E ++V  RL  IKL+N+++K +  L+SK EL DGL L+DFEQ K ENQS+ +KLEER+E+L +L+KK+ ++V  ++HVKEKL F++ E   +   L +T+  ++  R+ LT  +Q RD LR+ N KL++  G++GN+ LL++YE+ +DT E  +QK+  +K    +L+++  G+Q KI+++R+
Sbjct:  165 LHKLQSENEKLNKINQQLQTRIAEHFSKKKGDQ---HVKLDEDISEQEQ-YEKYMQLIADMKEQQLHFSKLHQERMEDLHLQSSEKLKQVEQELRFFAALKYETVMKASLTGKVGKQETLAKVELLKAEELKQEDKLVCVRLNNIKLKNKISKYERALRSKRELVDGLLLMDFEQLKTENQSFMDKLEERSEELHRLKKKVASSVQGISHVKEKLHFMQMENKAKHTQLAQTDTLVALKREVLTRTRQVRDGLRTDNLKLQQRSGLMGNTTLLQDYEEKMDTSENLQQKLEMLKKHHAELSMKCAGVQRKIKDSRL 476          
BLAST of SMED30006256 vs. Ensembl Xenopus
Match: ENSXETT00000001668.1 (coiled-coil domain containing 96 [Source:NCBI gene;Acc:100489589])

HSP 1 Score: 172.94 bits (437), Expect = 2.356e-48
Identity = 134/330 (40.61%), Postives = 203/330 (61.52%), Query Frame = -1
Query:   65 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAI-NTRTGKPISPKDLEIIS---LNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKIENTRIGSSN 1042
            REELIQ+ +    E   + + N  +Q+K+ ++ R+KK E        EK I D EQ+Y K + +L ++ ++  ++    + +IEEL+ +   +  +V ++   FQ ++ +++  A  +   GK  S    E ++     E++KE +V +  L  IKL+N++++  S L+SKEELA+GLHLIDFEQ KIENQ+YNEK+EER E+LLKLRKKIT+ VH LTHVKEKL+F++ E   ++  L E E  L+  RD LT  KQ RD LR  N KLK+  G+L N  LL+++ED VD  E+  QK+  +K +  +L+L  +GL  KIE   +   N
Sbjct:  232 REELIQQYQALIQERDKVQQHNAQLQNKLYEYFRRKKGEDLRPET--EKRISDQEQRYLKYLTSLEEMKKKNMEDAAMHQQQIEELEAQCLEVVSRVDKEMASFQEHKKSVALLAYKHFGAGKHASSAFTEALAQLQAKEDRKEKEVTQVHLENIKLKNQISQFQSTLRSKEELAEGLHLIDFEQLKIENQTYNEKIEERNEELLKLRKKITSTVHTLTHVKEKLQFMQAENQEKKDQLMEVEAVLANKRDILTKTKQARDSLRRDNLKLKQRSGLLDNKLLLKDFEDKVDETEVLSQKLESLKRRHAELSLSGKGLMKKIEEGNLALKN 559          
BLAST of SMED30006256 vs. Ensembl Xenopus
Match: gins3 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:548359])

HSP 1 Score: 50.447 bits (119), Expect = 3.273e-6
Identity = 48/161 (29.81%), Postives = 86/161 (53.42%), Query Frame = -1
Query:  239 ISQKAINTRTGKPISPKDLEIISLNEEK---KETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKK 712
            I + AI+ +    +SP   ++I   EEK   +++ V + RL    L+ +  K+   +K KEE+ + LH +DF+Q KIEN  + E+++ER +DLL+L+      + +L   K+KL     E     K +   +E L     +   ++Q+R++    N+KL+K
Sbjct:  173 IGKAAISIKKSAGVSPD--KVIRYMEEKMRARDSLVDKLRLKNAALKVQKKKMKMQVKQKEEMGEVLHEVDFQQLKIENAQFLERIDERNQDLLQLKLTAGDTLLVLNLFKKKLNTAMAESTHLDKEIHMRKEMLQRIELEAQLVEQDREKAERVNKKLRK 331          
BLAST of SMED30006256 vs. Ensembl Mouse
Match: Ccdc96 (coiled-coil domain containing 96 [Source:MGI Symbol;Acc:MGI:1913967])

HSP 1 Score: 156.762 bits (395), Expect = 2.162e-42
Identity = 110/322 (34.16%), Postives = 190/322 (59.01%), Query Frame = -1
Query:   92 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAI--AEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAIN---TRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKI 1042
            R EL+++  +  +E       N  +Q KI + LRKK +E  +     + E    + EQ Y + +  L +L +Q   +   ++  + EL+++ +  + +V+++  +FQ  +  +  + +    TR G+  + +++E +   E+KKE ++   RL  ++L+  +   ++ +K++E+LA+GL LIDFEQ KIENQ++NEK+EER E+LLKLR K+T+NV I+THVKEKL F+  E   ++  L E + +++  RD LT  KQ RD LR  N KL + CG+LG   LLR+ E+ V+  E+  +++  +K     L L  +G++ KI
Sbjct:  254 RGELVEQYHSLLVERNRYQRYNMYLQQKIHETLRKKGLEAAAEPGDKSAEPESPEKEQAYLRYLAMLEELKKQEADDLEWYRQEVRELKQQCQEKQTRVEKEWRRFQALKKQVVMQVMGSCRTRGGRQAALREVEQLQALEDKKEKEMSAVRLENVQLKQSLVHFETRMKAQEDLAEGLLLIDFEQLKIENQTFNEKVEERNEELLKLRTKVTSNVQIITHVKEKLSFIDTENSCKKAQLSEVDAQVALGRDLLTKTKQARDSLRIDNVKLSQKCGLLGKESLLRDLEEKVEKTEMLNRRLESLKRHHAGLALSCKGVKQKI 575          
BLAST of SMED30006256 vs. UniProt
Match: sp|Q95LS7|CCD96_MACFA (Coiled-coil domain-containing protein 96 OS=Macaca fascicularis OX=9541 GN=CCDC96 PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.504e-41
Identity = 108/303 (35.64%), Postives = 183/303 (60.40%), Query Frame = -1
Query:   92 NTSIQHKIGDFLRKKKVEQTSAAIAEEKGI----VDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINT---RTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKI 979
            N  +QHKI + LRKKK     AA   ++G      + EQ Y + +  L DL +Q   +   +   + +L+++ +    +V+++  +FQ  +  +  +A+ +   R G+  + +++E I   E+KKE ++   RL  ++L+  +   ++ ++++E+L  GL LIDFEQ KIENQ++NEK+EER E+LLKLR K+T +V ++TH+KEKL F+  E   ++K L E E +++  RD LT  KQ R+ LR+ N +L + CG+LGN  LLR+ E+ VD  ++  Q++  +K     LTL  +G++ KI
Sbjct:  251 NLYLQHKIFEALRKKKG--LEAAEVPDRGAQAEAPEKEQAYLRHLGMLEDLKKQQADDLQWYHQELGQLKQQCQEKLSRVEKEWRRFQALKKQVVMQAMGSCRMRGGRQAALREVEQILALEDKKEKEMSAVRLENVQLKQSLVHFETRMRTQEDLTQGLLLIDFEQLKIENQTFNEKIEERNEELLKLRNKVTNSVQVITHMKEKLHFMDTENACKKKQLAEIEAQVAQGRDILTKTKQAREGLRTDNIRLNQKCGLLGNDSLLRDLEEKVDKTQLLHQRLESLKRHHAGLTLSCRGVRQKI 551          
BLAST of SMED30006256 vs. UniProt
Match: sp|Q9CR92|CCD96_MOUSE (Coiled-coil domain-containing protein 96 OS=Mus musculus OX=10090 GN=Ccdc96 PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.512e-41
Identity = 110/322 (34.16%), Postives = 190/322 (59.01%), Query Frame = -1
Query:   92 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAI--AEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAIN---TRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKI 1042
            R EL+++  +  +E       N  +Q KI + LRKK +E  +     + E    + EQ Y + +  L +L +Q   +   ++  + EL+++ +  + +V+++  +FQ  +  +  + +    TR G+  + +++E +   E+KKE ++   RL  ++L+  +   ++ +K++E+LA+GL LIDFEQ KIENQ++NEK+EER E+LLKLR K+T+NV I+THVKEKL F+  E   ++  L E + +++  RD LT  KQ RD LR  N KL + CG+LG   LLR+ E+ V+  E+  +++  +K     L L  +G++ KI
Sbjct:  254 RGELVEQYHSLLVERNRYQRYNMYLQQKIHETLRKKGLEAAAEPGDKSAEPESPEKEQAYLRYLAMLEELKKQEADDLEWYRQEVRELKQQCQEKQTRVEKEWRRFQALKKQVVMQVMGSCRTRGGRQAALREVEQLQALEDKKEKEMSAVRLENVQLKQSLVHFETRMKAQEDLAEGLLLIDFEQLKIENQTFNEKVEERNEELLKLRTKVTSNVQIITHVKEKLSFIDTENSCKKAQLSEVDAQVALGRDLLTKTKQARDSLRIDNVKLSQKCGLLGKESLLRDLEEKVEKTEMLNRRLESLKRHHAGLALSCKGVKQKI 575          
BLAST of SMED30006256 vs. UniProt
Match: sp|Q2M329|CCD96_HUMAN (Coiled-coil domain-containing protein 96 OS=Homo sapiens OX=9606 GN=CCDC96 PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 1.861e-40
Identity = 110/327 (33.64%), Postives = 189/327 (57.80%), Query Frame = -1
Query:   92 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKK-------VEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINT---RTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKI 1042
            R +L+ + ++  +E       N  +QHKI + LR+KK        ++ + A A EK     EQ Y + +  L +L +Q   +   +   + +L+ + +    +V+++  +FQ  +  +  +A+ +   R G+  + +++E I   E+KKE ++   RL  I+L+  +   ++ ++++E+L  GL LIDFEQ KIENQ++NEK+EER E+LLKLR K+T +V ++THVKEKL F+  E   ++  L E E + +  RD LT  KQ R+ LR+ N +L + CG+LG   LLR+ E+ VD  E+  +++  +K     LTL  +G++ KI
Sbjct:  225 RSDLLDQYRSLLVERNRSQRYNLYLQHKIFEALRRKKGLEAAEVADRGAEAEAPEK-----EQAYLRHLGMLEELKKQQADDLQWYHQELGQLKRQCQEKLTRVEKEWRRFQALKKQVVMQAMGSCRMRGGRQAALREVEQIQALEDKKEKEMSAVRLENIQLKQSLVHFETRMRTQEDLTQGLLLIDFEQLKIENQTFNEKIEERNEELLKLRSKVTNSVQVITHVKEKLHFMDMENACKKTQLAEIEAQAALGRDILTKTKQAREGLRTDNIRLNQKCGLLGKDSLLRDLEEKVDKTELLHRRLESLKRHHASLTLSCRGVRQKI 546          
BLAST of SMED30006256 vs. TrEMBL
Match: gnl|BL_ORD_ID|20709474 (tr|A0A504YS26|A0A504YS26_FASGI Coiled-coil domain-containing protein 96 OS=Fasciola gigantica OX=46835 GN=FGIG_02600 PE=4 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 2.527e-80
Identity = 148/296 (50.00%), Postives = 211/296 (71.28%), Query Frame = -1
Query:  176 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKK---VEQ----TSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTV 1042
            RE+LI++ + A IE K   E N  +Q K+ ++ R+KK   VEQ    +SA  +   G VD+EQ+YNK + +L +L RQY+     +  +IEEL+      +++V+E   +F NY+++I +KA+++RTG+PI+PKDL  +   E+KKET V+  RL  IKL+NEV K+++ILKSKEELA+GLHLIDFEQ KIENQ+YNEK+EER E+L KL+KKI++ V I+THVKEKL+ V+ +   +++ L   + +L+ NRDQLT LKQ RD LR+ N +L++SCG+LG S LL NYED VD V
Sbjct:  230 REQLIEQYRQAVIEHKIARETNLQLQTKLAEYFRRKKADAVEQHSATSSAGGSGADGAVDYEQRYNKYIVSLTELRRQYQTMQNTYHKQIEELKNICAQRQQEVEEAYKEFTNYKYSIGKKALHSRTGRPINPKDLLAMLAAEQKKETIVMAVRLENIKLRNEVAKVEAILKSKEELAEGLHLIDFEQLKIENQTYNEKIEERNEELAKLKKKISSTVQIMTHVKEKLQAVQSDNARQRQRLGIADAELTFNRDQLTRLKQTRDHLRADNSRLRRSCGLLGKSALLFNYEDSVDAV 525          
BLAST of SMED30006256 vs. TrEMBL
Match: gnl|BL_ORD_ID|16780077 (tr|A0A2H1C9E3|A0A2H1C9E3_FASHE Coiled-coil domain-containing protein 96 OS=Fasciola hepatica OX=6192 GN=D915_005798 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 3.672e-80
Identity = 148/296 (50.00%), Postives = 211/296 (71.28%), Query Frame = -1
Query:  176 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKK---VEQ----TSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTV 1042
            RE+LI++ + A IE K   E N  +Q K+ ++ R+KK   VEQ    +SA  +   G VD+EQ+YNK + +L +L RQY+     +  +IEEL+      +++V+E   +F NY+++I +KA+++RTG+PI+PKDL  +   E+KKET V+  RL  IKL+NEV K+++ILKSKEELA+GLHLIDFEQ KIENQ+YNEK+EER E+L KL+KKI++ V I+THVKEKL+ V+ +   +++ L   + +L+ NRDQLT LKQ RD LR+ N +L++SCG+LG S LL NYED VD V
Sbjct:  230 REQLIEQYRQAVIEHKIARETNLQLQTKLAEYFRRKKADAVEQHSATSSAGGSGADGAVDYEQRYNKYIVSLTELRRQYQTMQNTYHKQIEELKNVCAQRQQEVEEAYKEFTNYKYSIGKKALHSRTGRPINPKDLLAMLAAEQKKETIVMGVRLENIKLRNEVAKVEAILKSKEELAEGLHLIDFEQLKIENQTYNEKIEERNEELAKLKKKISSTVQIMTHVKEKLQAVQSDNARQRQRLGIADAELTFNRDQLTRLKQARDHLRADNSRLRRSCGLLGKSALLFNYEDSVDAV 525          
BLAST of SMED30006256 vs. TrEMBL
Match: gnl|BL_ORD_ID|22546812 (tr|A0A5J4NGW5|A0A5J4NGW5_9TREM DUF4201 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0009732 PE=4 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 1.098e-79
Identity = 147/326 (45.09%), Postives = 221/326 (67.79%), Query Frame = -1
Query:   86 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVE-------QTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKIEN 1042
            RE+LI++ K A +E K   E N  +Q KI ++ R+KK +        +S   +    +VD+EQ+YNK + +L +L  +Y+     +  +IEE++    + + +V +   +F NY++ I +KA+++RTG+PI+PK+LE +   E+KKE  V+E RL  IKL+NEV K+++ILKSKE+LA+GLHLIDFEQ KIENQ+YNEK+EER E+L KL++KI + V I+THVKEKL+ V+Y+   +++ L   + +L+ NRDQLT LKQ RD LR+ N KL++SCG+LG + LL NYED VDTV+ +K  + ++K        R + +  KIEN
Sbjct:  116 REQLIEQYKQALVEHKIAREANLQLQTKIAEYFRRKKADVAEQQSGTSSFGGSTTDNVVDYEQRYNKYISSLTELKNEYQSMQATYHKQIEEMKRVCADRQREVDDAYREFTNYKYNIGKKALHSRTGRPINPKELEAMLNAEQKKEAIVMEVRLENIKLRNEVAKVEAILKSKEQLAEGLHLIDFEQLKIENQTYNEKIEERNEELAKLKRKIASTVQIMTHVKEKLQAVQYDNAKQRQRLGIADAELTFNRDQLTRLKQARDHLRADNSKLRRSCGLLGKTALLLNYEDSVDTVKSKKAALEKIKRLTSNYVTRTKSIMEKIEN 441          
BLAST of SMED30006256 vs. TrEMBL
Match: gnl|BL_ORD_ID|25570667 (tr|A0A448XDZ7|A0A448XDZ7_9PLAT DUF4201 domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS27914 PE=4 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 1.917e-79
Identity = 142/296 (47.97%), Postives = 207/296 (69.93%), Query Frame = -1
Query:  173 REELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQ------TSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVE 1042
            RE  IQ+      E KSL E N  +Q KI ++ R+KK E       TS ++ ++   VDFEQ+YN+ +  L +L ++Y+   I +K +I EL++     + +V   + +F  +++ I++K++N+RTG+P++ +D+E +  +E++KE  VVE RL  IKLQNEVNK +SILKSKEELA+GLHLIDFEQ KIENQ+YNEK+EER E+L KL+KKI T V I+THVKEKL+ ++YE    +  L   +++L+ +RD+ T LKQ RD+LRS N +LK+SCG+LG +DLL NYE CVD ++
Sbjct:   29 RESFIQKYHYYVGENKSLREANAHMQTKISEYFRRKKAENAELASNTSGSMNDQS--VDFEQRYNRYITHLIELRKEYQALQISYKDQINELKQFCNLRQTEVDAIQNEFAAFKYNIAKKSLNSRTGRPLNLRDIENLQASEQRKEAAVVEVRLENIKLQNEVNKFESILKSKEELAEGLHLIDFEQLKIENQTYNEKIEERNEELGKLKKKIATTVQIMTHVKEKLQSIQYELVEHRDYLNAVDKELTQHRDKNTRLKQTRDKLRSGNSRLKRSCGLLGRNDLLLNYETCVDAID 322          
BLAST of SMED30006256 vs. TrEMBL
Match: gnl|BL_ORD_ID|16147342 (tr|A0A4V3SFS0|A0A4V3SFS0_OPIFE DUF4201 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003699 PE=4 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 9.513e-79
Identity = 143/297 (48.15%), Postives = 205/297 (69.02%), Query Frame = -1
Query:  176 SREELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKV---EQTSAAIAEEKG----IVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTV 1045
            +REELI + + A ++ K   E N  +Q K+ ++ R+KK    EQ S A +        +VD+EQ+YNK + +L +L  QY++    ++ +IEEL+      +++V E    F NY++ + +KA++ RTG+PI+PKDL  +   E+KKE  V+E RL  IKL+NEV KI++ILKSKEELA+GLHLIDFEQ KIENQ+YNEK+EER E+L KL++KI + V I+THVKEKL+ V+YE   +++ L   + +L+ NRDQL  LK+ RDR+R  N KL++SCG+LG + LL NYED VD V
Sbjct:  106 AREELIDQYRQAVMDHKVAREANLQLQTKLAEYFRRKKADAAEQQSGASSMGGSTTDNVVDYEQRYNKYISSLTELRNQYQKMQSSYQKQIEELKAVCSERQKEVDEAYRDFTNYKYNVGKKALHGRTGRPINPKDLLAMLSAEQKKEAVVMEVRLENIKLRNEVAKIEAILKSKEELAEGLHLIDFEQLKIENQTYNEKIEERNEELGKLKRKIASTVQIMTHVKEKLQAVQYENAKQRQRLAIADAELTFNRDQLAKLKKARDRIRMDNSKLRRSCGLLGKTALLLNYEDSVDAV 402          
BLAST of SMED30006256 vs. Ensembl Cavefish
Match: ENSAMXT00000056357.1 (coiled-coil domain containing 96 [Source:NCBI gene;Acc:103024094])

HSP 1 Score: 80.8777 bits (198), Expect = 1.232e-16
Identity = 62/159 (38.99%), Postives = 94/159 (59.12%), Query Frame = -1
Query:   77 LKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKIENTRI 553
            +K  EEL  G H++DFEQ K ENQ   EK+EE  E LLK +KK +  V  LTHVKEK++FV+ E   ++  L   +  +S  ++ LT +KQ RD LR  N +L +S G+L    LLR+ E+ V+  E  + +++         TLR Q  Q+ ++++R+
Sbjct:  184 MKDDEELDVGQHMVDFEQLKSENQVNREKIEECKEKLLKQKKKNSETVQALTHVKEKIQFVQVENQEKRAQLAGLDALVSRKQEVLTRMKQARDGLRVDNLRLHQSSGLLAYPTLLRDMEEKVEKCEALETRLD---------TLRRQSAQITLKSSRV 333          
BLAST of SMED30006256 vs. Ensembl Sea Lamprey
Match: ccdc113 (coiled-coil domain containing 113 [Source:NCBI gene;Acc:450041])

HSP 1 Score: 53.1434 bits (126), Expect = 3.760e-8
Identity = 28/78 (35.90%), Postives = 49/78 (62.82%), Query Frame = -1
Query:  359 IKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYEC 592
            +K+QN+  K+   L+ KEE+ + LH +DF Q +IEN  + EK++ER +D+L+L+    + + +L   K+KL  +  E 
Sbjct:  173 LKIQNK--KMLLQLQQKEEMGEALHEVDFSQLQIENNQFVEKIDERNQDMLRLKLTAASTLQVLNSYKKKLNLLMEEA 248          
BLAST of SMED30006256 vs. Ensembl Nematostella
Match: EDO40032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B1])

HSP 1 Score: 146.362 bits (368), Expect = 1.461e-42
Identity = 85/185 (45.95%), Postives = 123/185 (66.49%), Query Frame = -1
Query:  449 EEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTE 1003
            E  SL  +N  +QHK+ ++ RKKK ++    +  EK + D EQ+Y K M  L +L  + ++E   FK +IE+L+   +  +E V++    F  ++F ++++AIN+R+GKPI PKD+E   L E KKE +V   RL  IKL+N + K +  LK+KEELA+GLHLIDFEQ KIENQ+YNEK+EER E
Sbjct:    8 ERSSLMSLNAQLQHKLAEYFRKKKSDERQQEV--EKNVTDQEQRYLKYMSNLEELQNEEKREQESFKSQIEDLKTRCQEKQEAVEKSSADFTKFKFDVAKQAINSRSGKPIPPKDIEQYELAEMKKEQEVTLVRLDNIKLKNRLKKREMQLKAKEELAEGLHLIDFEQLKIENQTYNEKIEERNE 190          
BLAST of SMED30006256 vs. Ensembl Nematostella
Match: EDO35964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJZ5])

HSP 1 Score: 57.7658 bits (138), Expect = 2.613e-9
Identity = 43/116 (37.07%), Postives = 66/116 (56.90%), Query Frame = -1
Query:  356 AINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNV-HILTHVKEKLEFVKYECD 700
            A+N RT K I+ +           ++T + + RL    L+ +  K+   LK KEE+ + LH +DF Q KIENQ Y EK++E+ +DLL+L K ++ NV  IL   K+KL  +  E +
Sbjct:  161 AVNQRTNKVIAERVTRYFEDKLRARDTLIEKLRLKNSTLKVQKRKLHMQLKQKEEMGEVLHEVDFNQLKIENQQYLEKIDEKNQDLLRL-KLMSGNVQQILNTYKKKLHTLTMESE 275          
BLAST of SMED30006256 vs. Planmine SMEST
Match: SMESG000034101.1 (SMESG000034101.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 331/331 (100.00%), Postives = 331/331 (100.00%), Query Frame = -1
Query:   62 IKLSREELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEXXXXXXXXXXXXXXKLTLRNQGLQMKIENTRIGSSNG 1054
            IKLSREELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIEELQEETKNLEEKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEIQKQKMNEMKNKQIKLTLRNQGLQMKIENTRIGSSNG
Sbjct:  233 IKLSREELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIEELQEETKNLEEKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTVEIQKQKMNEMKNKQIKLTLRNQGLQMKIENTRIGSSNG 563          
BLAST of SMED30006256 vs. Planmine SMEST
Match: SMESG000033855.1 (SMESG000033855.1)

HSP 1 Score: 146.362 bits (368), Expect = 3.787e-39
Identity = 99/292 (33.90%), Postives = 164/292 (56.16%), Query Frame = -1
Query:  176 SREELIQELKNAQIEEKSLFEINTSIQHKIGDFLRKKKVEQTSA--AIAEEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKFRIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVDTV 1045
            SR  +I ++K    E KSL + N   Q K+ ++ +  K +Q  +   I+E+  IVDF  +Y++  E L  L+ +   E   ++ +IE+LQ  ++   ++++     F  Y+  I   A+++RTG  + P  +    + E KKE  +   RL  +KL+++  + D  L+SKE    GL LIDFEQ KIENQ++NEK+EER E + KL +KIT   H+L+H+KEK+ F  ++  +    L    ++    +     +K+ RD ++ +N+ L+  CG+LG  D LR YE+C D V
Sbjct:  198 SRLNMISKIKELIFERKSLLDANVVNQSKLVEYFKLVKAKQKGSIKTISEKDFIVDFNTQYDRYREILSVLMNELSTETSKYQEKIEKLQSTSETKTKQIEIADKDFVKYQENIGYSALHSRTGFKLDPDVIRDFFVAESKKEAIIKTERLQNLKLEHKNARFDKALRSKENFEGGLRLIDFEQLKIENQTFNEKVEERREAINKLNRKITNCNHLLSHIKEKINFTDHDKRISNLKLISLNKEFKRLQKSSNKIKKVRDYIKGNNRSLQMQCGLLGKKDYLRKYEECYDDV 489          
BLAST of SMED30006256 vs. Planmine SMEST
Match: SMESG000078404.1 (SMESG000078404.1)

HSP 1 Score: 132.494 bits (332), Expect = 9.891e-36
Identity = 94/246 (38.21%), Postives = 152/246 (61.79%), Query Frame = -1
Query:  182 EEKGIVDFEQKYNKQMETLRDLIRQYEQENIDFKF----RIXXXXXXXXXXXXKVKEDKTKFQNYRFAISQKAINTRTGKPISPKDLEIISLNEEKKETQVVE-TRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKYECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNSDLLRNYEDCVD 904
            +E  IVD +Q+Y K + T+  L  Q EQ N + K      ++      + +  K+K+D+     YR  I+  A ++ TGK ISP + +I+ ++ E+K+T+V++ +RL  IK+Q  V+K+ +++ SKE + + L L+DFEQ KIENQ+Y EKLEE  E + +L+ KI  N+HI+TH+KEKL F   E   E +  K     L+ +R  LT LK++RD + S+N+ + KS G++ +  LL+++E  VD
Sbjct:    8 QESAIVDIDQRYYKYLNTVCFL--QGEQINSENKKIKNEEMKNNDSIEREIRIKIKDDE--LTAYRHEIAMNAAHSHTGKKISPNEWDIM-ISSERKKTEVIQCSRLENIKMQYRVSKLRAVIHSKECVGNKLSLMDFEQIKIENQAYYEKLEEGKEFIRRLKLKIHNNIHIITHMKEKLCFTVKELHKETENEKNKTIILNISRKALTKLKKSRDEIISNNRNMIKSGGLMNHDTLLKHFEKTVD 248          
BLAST of SMED30006256 vs. Planmine SMEST
Match: SMESG000050787.1 (SMESG000050787.1)

HSP 1 Score: 51.9878 bits (123), Expect = 3.658e-7
Identity = 34/104 (32.69%), Postives = 61/104 (58.65%), Query Frame = -1
Query:  341 KKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHLIDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEF-------VKYECDLEQKI 631
            +++T + + RL    L+ + +K+   LK KEE+ + LH +DF+Q KIEN  Y EK+EE+ ++L++L+      + +L   K+KL         +KYE +  Q++
Sbjct:  188 QRDTLIDKLRLKNSTLRQQKSKLKMQLKQKEEMGEVLHEVDFKQLKIENTQYLEKIEEKNQELMRLKLMAGRTLQVLNSYKKKLTTLMNDVKKIKYEINARQEL 291          
The following BLAST results are available for this feature:
BLAST of SMED30006256 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC963.875e-4133.64coiled-coil domain containing 96 [Source:HGNC Symb... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006256 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006256 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc961.412e-3934.81coiled-coil domain containing 96 [Source:ZFIN;Acc:... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000001668.12.356e-4840.61coiled-coil domain containing 96 [Source:NCBI gene... [more]
gins33.273e-629.81coiled-coil domain containing 113 [Source:NCBI gen... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc962.162e-4234.16coiled-coil domain containing 96 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30006256 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q95LS7|CCD96_MACFA1.504e-4135.64Coiled-coil domain-containing protein 96 OS=Macaca... [more]
sp|Q9CR92|CCD96_MOUSE1.512e-4134.16Coiled-coil domain-containing protein 96 OS=Mus mu... [more]
sp|Q2M329|CCD96_HUMAN1.861e-4033.64Coiled-coil domain-containing protein 96 OS=Homo s... [more]
back to top
BLAST of SMED30006256 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|207094742.527e-8050.00tr|A0A504YS26|A0A504YS26_FASGI Coiled-coil domain-... [more]
gnl|BL_ORD_ID|167800773.672e-8050.00tr|A0A2H1C9E3|A0A2H1C9E3_FASHE Coiled-coil domain-... [more]
gnl|BL_ORD_ID|225468121.098e-7945.09tr|A0A5J4NGW5|A0A5J4NGW5_9TREM DUF4201 domain-cont... [more]
gnl|BL_ORD_ID|255706671.917e-7947.97tr|A0A448XDZ7|A0A448XDZ7_9PLAT DUF4201 domain-cont... [more]
gnl|BL_ORD_ID|161473429.513e-7948.15tr|A0A4V3SFS0|A0A4V3SFS0_OPIFE DUF4201 domain-cont... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000056357.11.232e-1638.99coiled-coil domain containing 96 [Source:NCBI gene... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1133.760e-835.90coiled-coil domain containing 113 [Source:NCBI gen... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006256 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400321.461e-4245.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359642.613e-937.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30006256 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006256 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000034101.10.000e+0100.00SMESG000034101.1[more]
SMESG000033855.13.787e-3933.90SMESG000033855.1[more]
SMESG000078404.19.891e-3638.21SMESG000078404.1[more]
SMESG000050787.13.658e-732.69SMESG000050787.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006256 ID=SMED30006256|Name=SMED30006256|organism=Schmidtea mediterranea sexual|type=transcript|length=1114bp
TTTTTTTCGAGCATAAAAGTATTTTTTACTAAAATTGATAACATTTCATA
AATCCAATTCATCCATTAGAACTTCCTATTCTTGTGTTTTCGATTTTCAT
TTGCAGTCCTTGATTGCGAAGGGTTAATTTAATTTGTTTGTTTTTCATTT
CATTCATTTTTTGTTTCTGTATCTCAACAGTATCAACGCAATCTTCATAA
TTCCTGAGGAGGTCTGAATTTCCCAGCATTCCACAGGATTTCTTTAATTT
CTGATTCGACGATCTTAACCTGTCACGATTTTGTTTCAATGATGTCAATT
GATCTCGATTTGTTGACAGCTTTTCTTCGGTTTCTTTCAAAATTTTCTGT
TCCAAATCACATTCGTATTTGACGAATTCCAATTTTTCTTTCACATGAGT
CAAAATGTGAACATTGGTCGTGATTTTTTTCCGCAATTTCAATAAATCTT
CAGTTCTCTCTTCGAGTTTCTCATTGTATGACTGATTTTCAATTTTGAAT
TGTTCGAAATCTATCAAATGTAACCCGTCGGCCAATTCTTCTTTCGATTT
TAAAATCGAATCAATTTTATTTACTTCGTTTTGGAGTTTTATGCATACCA
AGCGAGTTTCGACGACTTGGGTTTCTTTTTTCTCTTCATTCAAACTAATT
ATTTCCAAATCCTTGGGAGATATCGGTTTTCCGGTTCTCGTATTAATCGC
TTTTTGGCTTATTGCAAACCTATAGTTTTGGAATTTAGTTTTATCTTCTT
TGACTTTTTCTTCAAGATTTTTTGTTTCTTCTTGTAATTCTTCGATTCGG
AATTTAAAGTCAATGTTTTCCTGTTCATATTGTCTAATTAAATCTCTCAG
TGTTTCCATTTGTTTATTGTACTTTTGTTCAAAATCCACAATGCCTTTTT
CTTCAGCTATAGCTGCGGAAGTTTGTTCAACTTTTTTTTTCCGTAAAAAA
TCTCCAATTTTATGCTGGATAGAAGTGTTTATTTCAAATAACGATTTTTC
TTCAATTTGAGCATTTTTAAGTTCTTGGATCAATTCTTCGCGAGATAACT
TAATTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCT
TCTTCTTCTTCTTC
back to top

protein sequence of SMED30006256-orf-1

>SMED30006256-orf-1 ID=SMED30006256-orf-1|Name=SMED30006256-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=352bp
EEEEEEEEEEEEEEEEEEEEIKLSREELIQELKNAQIEEKSLFEINTSIQ
HKIGDFLRKKKVEQTSAAIAEEKGIVDFEQKYNKQMETLRDLIRQYEQEN
IDFKFRIEELQEETKNLEEKVKEDKTKFQNYRFAISQKAINTRTGKPISP
KDLEIISLNEEKKETQVVETRLVCIKLQNEVNKIDSILKSKEELADGLHL
IDFEQFKIENQSYNEKLEERTEDLLKLRKKITTNVHILTHVKEKLEFVKY
ECDLEQKILKETEEKLSTNRDQLTSLKQNRDRLRSSNQKLKKSCGMLGNS
DLLRNYEDCVDTVEIQKQKMNEMKNKQIKLTLRNQGLQMKIENTRIGSSN
G*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR025254DUF4201
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 259..293
NoneNo IPR availableCOILSCoilCoilcoord: 75..127
NoneNo IPR availableCOILSCoilCoilcoord: 1..45
NoneNo IPR availableCOILSCoilCoilcoord: 203..234
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..20
NoneNo IPR availablePANTHERPTHR15654UNCHARACTERIZEDcoord: 1..345
NoneNo IPR availablePANTHERPTHR15654:SF1COILED-COIL DOMAIN-CONTAINING PROTEIN 96coord: 1..345
IPR025254Domain of unknown function DUF4201PFAMPF13870DUF4201coord: 161..333
e-value: 1.7E-40
score: 138.6