Pyridoxal-dependent decarboxylase domain-containing protein 1

Overview
NamePyridoxal-dependent decarboxylase domain-containing protein 1
Smed IDSMED30006254
Length (bp)2609
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pyridoxal-dependent decarboxylase domain-containing protein 1 (SMED30006254) t-SNE clustered cells

Violin plots show distribution of expression levels for Pyridoxal-dependent decarboxylase domain-containing protein 1 (SMED30006254) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pyridoxal-dependent decarboxylase domain-containing protein 1 (SMED30006254) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pyridoxal-dependent decarboxylase domain-containing protein 1 (SMED30006254) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Match: PDXDC1 (pyridoxal dependent decarboxylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28995])

HSP 1 Score: 321.627 bits (823), Expect = 2.063e-96
Identity = 233/805 (28.94%), Postives = 368/805 (45.71%), Query Frame = 1
Query:  133 SFLDSTMAEFEREMRNSMMGK-----VMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            S L+    E  RE      G       +    K + E  K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:    4 SILEGCRREVRRETWKPGPGSEIADPTLAEMGKNLKEAVKMLEDSQRRTEEEN---GKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSPRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGL-TSNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 700          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Match: PDXDC1 (pyridoxal dependent decarboxylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28995])

HSP 1 Score: 321.627 bits (823), Expect = 2.063e-96
Identity = 233/805 (28.94%), Postives = 368/805 (45.71%), Query Frame = 1
Query:  133 SFLDSTMAEFEREMRNSMMGK-----VMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            S L+    E  RE      G       +    K + E  K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:    4 SILEGCRREVRRETWKPGPGSEIADPTLAEMGKNLKEAVKMLEDSQRRTEEEN---GKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSPRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGL-TSNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 700          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Match: PDXDC1 (pyridoxal dependent decarboxylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28995])

HSP 1 Score: 320.857 bits (821), Expect = 2.154e-96
Identity = 227/773 (29.37%), Postives = 360/773 (46.57%), Query Frame = 1
Query:  214 KQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            K + E  K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:   18 KNLKEAVKMLEDSQRRTEEEN---GKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSPRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGLT-SNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Match: PDXDC1 (pyridoxal dependent decarboxylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28995])

HSP 1 Score: 320.857 bits (821), Expect = 2.154e-96
Identity = 227/773 (29.37%), Postives = 360/773 (46.57%), Query Frame = 1
Query:  214 KQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            K + E  K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:   18 KNLKEAVKMLEDSQRRTEEEN---GKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSPRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGLT-SNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Match: PDXDC1 (pyridoxal dependent decarboxylase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:28995])

HSP 1 Score: 314.309 bits (804), Expect = 4.099e-94
Identity = 209/695 (30.07%), Postives = 329/695 (47.34%), Query Frame = 1
Query:  448 QIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:   60 QGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGLT-SNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 654          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Match: C14H10.3 (pep chromosome:WBcel235:X:10220673:10224289:-1 gene:WBGene00007593.1 transcript:C14H10.3b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C14H10.3)

HSP 1 Score: 213.772 bits (543), Expect = 1.770e-58
Identity = 179/706 (25.35%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  460 IILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFR-----CS--TSLFHNNMYNGFLNVCKVALADRY-PKYGLEGYNSLYSR-PPVIYINSAADSQLVDYLRINLGLPSDSI--SLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLC-REHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSE-GTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSP--PAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGP 2532
            ++ S  + +++  L+  H   + + +Y + +   S ++RF      CS   +    ++ NG  +  K+AL   Y   +  +G+ +   +  PV+Y++ A    L  YL    G+   +I   L  +  E+ G   +D    E+++  D++AGK PLI+    G+   G  D +++I  +  ++ K WLH+ G  +A L   +    +  + S+V S+T+ I  WLGIP+ P  TL                 GY+ S +  +   P W+A   +    I   IE     S+ + K L  I  ++MI                        G+ N +E       + +  P+V++F+Y+  S+       +    +K +I +NN D D +    + +  E      Y D LN WL D L      + +  I L    G   R C  E+        + V +FV  +   + I++STV  +  F ++      LVL+ +  WAG+G V ++P   +ET         N E +    +         +I+++N  L+ +L++ D AFS G           D  R  V+  CV+FG+++    +  LV+ V  K  + E S + L+ L+ L++ GI    + L +E +++++ EG+ RQ+P + SL+NWWSP  P    I GR+ NL +GE+ +T+ ++K K  + + P
Sbjct:   60 LVTSASLKSYIDLLSSHHRQSIASWLYGNVNHVFSNLFRFADSQIYCSDPEATISLSIRNGIGHAVKLALKSSYGTDHSTKGWRAFAEQGAPVVYVSPALHMDLSSYLASEFGIADVTILPKLDSDRGEIEG--RIDHHQFEKILDEDLAAGKKPLILIGVVGTTIMGQNDMISKILEIREKKAKFWLHITGQAIAALTFREPNNILVHVLSQVDSMTVPIALWLGIPSAPVVTLHRP------------VEGYKASYREKLDTLPWWVASSYLSGKKIVDMIENAFLLSKVMLKGLSAIPEVEMI------------------------GVDNPVELANRVYKNKFTPPTVLIFKYNYVSIK------NAIQHHKDLI-QNNDDHDAIAIAEKTLQDELE----YGDYLNAWLRDGLLPESLPLGIDTIELGGNYGIAFRFCPLEHAATYSSHIDHVQRFVRKLTDIMRIVESTVVSKLKFSELKDDFPSLVLLPIRNWAGIGAVCYIPSIVKET---------NPEDWNDIQK--------QQISHLNLELVHQLKSVDAAFSSG-----------DCTRYGVS--CVKFGMLSDVKDLHNLVEMVAQKGKEIENSQQYLDSLAHLIRQGIEAANEALRKENDQRLQNEGMMRQLPIMGSLVNWWSPLTPESQNIRGRAFNLKTGEMQETDVLFKSKKNMDATP 686          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Match: C14H10.3 (pep chromosome:WBcel235:X:10220673:10224525:-1 gene:WBGene00007593.1 transcript:C14H10.3b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C14H10.3)

HSP 1 Score: 213.772 bits (543), Expect = 1.770e-58
Identity = 179/706 (25.35%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  460 IILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFR-----CS--TSLFHNNMYNGFLNVCKVALADRY-PKYGLEGYNSLYSR-PPVIYINSAADSQLVDYLRINLGLPSDSI--SLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLC-REHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSE-GTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSP--PAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGP 2532
            ++ S  + +++  L+  H   + + +Y + +   S ++RF      CS   +    ++ NG  +  K+AL   Y   +  +G+ +   +  PV+Y++ A    L  YL    G+   +I   L  +  E+ G   +D    E+++  D++AGK PLI+    G+   G  D +++I  +  ++ K WLH+ G  +A L   +    +  + S+V S+T+ I  WLGIP+ P  TL                 GY+ S +  +   P W+A   +    I   IE     S+ + K L  I  ++MI                        G+ N +E       + +  P+V++F+Y+  S+       +    +K +I +NN D D +    + +  E      Y D LN WL D L      + +  I L    G   R C  E+        + V +FV  +   + I++STV  +  F ++      LVL+ +  WAG+G V ++P   +ET         N E +    +         +I+++N  L+ +L++ D AFS G           D  R  V+  CV+FG+++    +  LV+ V  K  + E S + L+ L+ L++ GI    + L +E +++++ EG+ RQ+P + SL+NWWSP  P    I GR+ NL +GE+ +T+ ++K K  + + P
Sbjct:   60 LVTSASLKSYIDLLSSHHRQSIASWLYGNVNHVFSNLFRFADSQIYCSDPEATISLSIRNGIGHAVKLALKSSYGTDHSTKGWRAFAEQGAPVVYVSPALHMDLSSYLASEFGIADVTILPKLDSDRGEIEG--RIDHHQFEKILDEDLAAGKKPLILIGVVGTTIMGQNDMISKILEIREKKAKFWLHITGQAIAALTFREPNNILVHVLSQVDSMTVPIALWLGIPSAPVVTLHRP------------VEGYKASYREKLDTLPWWVASSYLSGKKIVDMIENAFLLSKVMLKGLSAIPEVEMI------------------------GVDNPVELANRVYKNKFTPPTVLIFKYNYVSIK------NAIQHHKDLI-QNNDDHDAIAIAEKTLQDELE----YGDYLNAWLRDGLLPESLPLGIDTIELGGNYGIAFRFCPLEHAATYSSHIDHVQRFVRKLTDIMRIVESTVVSKLKFSELKDDFPSLVLLPIRNWAGIGAVCYIPSIVKET---------NPEDWNDIQK--------QQISHLNLELVHQLKSVDAAFSSG-----------DCTRYGVS--CVKFGMLSDVKDLHNLVEMVAQKGKEIENSQQYLDSLAHLIRQGIEAANEALRKENDQRLQNEGMMRQLPIMGSLVNWWSPLTPESQNIRGRAFNLKTGEMQETDVLFKSKKNMDATP 686          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Match: C14H10.3 (pep chromosome:WBcel235:X:10220644:10225161:-1 gene:WBGene00007593.1 transcript:C14H10.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C14H10.3)

HSP 1 Score: 213.772 bits (543), Expect = 1.770e-58
Identity = 179/706 (25.35%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  460 IILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFR-----CS--TSLFHNNMYNGFLNVCKVALADRY-PKYGLEGYNSLYSR-PPVIYINSAADSQLVDYLRINLGLPSDSI--SLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLC-REHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSE-GTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSP--PAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGP 2532
            ++ S  + +++  L+  H   + + +Y + +   S ++RF      CS   +    ++ NG  +  K+AL   Y   +  +G+ +   +  PV+Y++ A    L  YL    G+   +I   L  +  E+ G   +D    E+++  D++AGK PLI+    G+   G  D +++I  +  ++ K WLH+ G  +A L   +    +  + S+V S+T+ I  WLGIP+ P  TL                 GY+ S +  +   P W+A   +    I   IE     S+ + K L  I  ++MI                        G+ N +E       + +  P+V++F+Y+  S+       +    +K +I +NN D D +    + +  E      Y D LN WL D L      + +  I L    G   R C  E+        + V +FV  +   + I++STV  +  F ++      LVL+ +  WAG+G V ++P   +ET         N E +    +         +I+++N  L+ +L++ D AFS G           D  R  V+  CV+FG+++    +  LV+ V  K  + E S + L+ L+ L++ GI    + L +E +++++ EG+ RQ+P + SL+NWWSP  P    I GR+ NL +GE+ +T+ ++K K  + + P
Sbjct:   60 LVTSASLKSYIDLLSSHHRQSIASWLYGNVNHVFSNLFRFADSQIYCSDPEATISLSIRNGIGHAVKLALKSSYGTDHSTKGWRAFAEQGAPVVYVSPALHMDLSSYLASEFGIADVTILPKLDSDRGEIEG--RIDHHQFEKILDEDLAAGKKPLILIGVVGTTIMGQNDMISKILEIREKKAKFWLHITGQAIAALTFREPNNILVHVLSQVDSMTVPIALWLGIPSAPVVTLHRP------------VEGYKASYREKLDTLPWWVASSYLSGKKIVDMIENAFLLSKVMLKGLSAIPEVEMI------------------------GVDNPVELANRVYKNKFTPPTVLIFKYNYVSIK------NAIQHHKDLI-QNNDDHDAIAIAEKTLQDELE----YGDYLNAWLRDGLLPESLPLGIDTIELGGNYGIAFRFCPLEHAATYSSHIDHVQRFVRKLTDIMRIVESTVVSKLKFSELKDDFPSLVLLPIRNWAGIGAVCYIPSIVKET---------NPEDWNDIQK--------QQISHLNLELVHQLKSVDAAFSSG-----------DCTRYGVS--CVKFGMLSDVKDLHNLVEMVAQKGKEIENSQQYLDSLAHLIRQGIEAANEALRKENDQRLQNEGMMRQLPIMGSLVNWWSPLTPESQNIRGRAFNLKTGEMQETDVLFKSKKNMDATP 686          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Match: C14H10.3 (pep chromosome:WBcel235:X:10220644:10228137:-1 gene:WBGene00007593.1 transcript:C14H10.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C14H10.3)

HSP 1 Score: 213.386 bits (542), Expect = 5.892e-58
Identity = 179/706 (25.35%), Postives = 320/706 (45.33%), Query Frame = 1
Query:  460 IILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFR-----CS--TSLFHNNMYNGFLNVCKVALADRY-PKYGLEGYNSLYSR-PPVIYINSAADSQLVDYLRINLGLPSDSI--SLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLC-REHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSE-GTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSP--PAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGP 2532
            ++ S  + +++  L+  H   + + +Y + +   S ++RF      CS   +    ++ NG  +  K+AL   Y   +  +G+ +   +  PV+Y++ A    L  YL    G+   +I   L  +  E+ G   +D    E+++  D++AGK PLI+    G+   G  D +++I  +  ++ K WLH+ G  +A L   +    +  + S+V S+T+ I  WLGIP+ P  TL                 GY+ S +  +   P W+A   +    I   IE     S+ + K L  I  ++MI                        G+ N +E       + +  P+V++F+Y+  S+       +    +K +I +NN D D +    + +  E      Y D LN WL D L      + +  I L    G   R C  E+        + V +FV  +   + I++STV  +  F ++      LVL+ +  WAG+G V ++P   +ET         N E +    +         +I+++N  L+ +L++ D AFS G           D  R  V+  CV+FG+++    +  LV+ V  K  + E S + L+ L+ L++ GI    + L +E +++++ EG+ RQ+P + SL+NWWSP  P    I GR+ NL +GE+ +T+ ++K K  + + P
Sbjct:  128 LVTSASLKSYIDLLSSHHRQSIASWLYGNVNHVFSNLFRFADSQIYCSDPEATISLSIRNGIGHAVKLALKSSYGTDHSTKGWRAFAEQGAPVVYVSPALHMDLSSYLASEFGIADVTILPKLDSDRGEIEG--RIDHHQFEKILDEDLAAGKKPLILIGVVGTTIMGQNDMISKILEIREKKAKFWLHITGQAIAALTFREPNNILVHVLSQVDSMTVPIALWLGIPSAPVVTLHRP------------VEGYKASYREKLDTLPWWVASSYLSGKKIVDMIENAFLLSKVMLKGLSAIPEVEMI------------------------GVDNPVELANRVYKNKFTPPTVLIFKYNYVSIK------NAIQHHKDLI-QNNDDHDAIAIAEKTLQDELE----YGDYLNAWLRDGLLPESLPLGIDTIELGGNYGIAFRFCPLEHAATYSSHIDHVQRFVRKLTDIMRIVESTVVSKLKFSELKDDFPSLVLLPIRNWAGIGAVCYIPSIVKET---------NPEDWNDIQK--------QQISHLNLELVHQLKSVDAAFSSG-----------DCTRYGVS--CVKFGMLSDVKDLHNLVEMVAQKGKEIENSQQYLDSLAHLIRQGIEAANEALRKENDQRLQNEGMMRQLPIMGSLVNWWSPLTPESQNIRGRAFNLKTGEMQETDVLFKSKKNMDATP 754          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Match: hdl-1 (Probable aromatic-L-amino-acid decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:P34751])

HSP 1 Score: 51.9878 bits (123), Expect = 2.075e-6
Identity = 33/96 (34.38%), Postives = 48/96 (50.00%), Query Frame = 1
Query:  712 IYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEG 999
            I +  AA+  +V  +R+   LP+D       NF L GD       L   I+ DI  G +P  + A  G+    S DHL+E+  +CREH  WLH++ 
Sbjct:  538 IKMKMAAEVAMVK-MRV---LPTD------QNFILRGD------TLHAAIMADIERGLIPFFVGANFGTSGPCSFDHLHELGPVCREHGTWLHVDA 617          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Fly
Match: CG1486 (gene:FBgn0031174 transcript:FBtr0077190)

HSP 1 Score: 308.145 bits (788), Expect = 1.969e-91
Identity = 227/805 (28.20%), Postives = 390/805 (48.45%), Query Frame = 1
Query:  130 SSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYL--KH-IPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRI---KTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIG-QDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAK-TQIIGRSLNLSSGEINDTEDIYKYKMQL 2520
            +S + S +AE E  +R+S   +V+   E   +  T    +    +EE+ +++  E  L  KH +P +++          + + + ++  + DD+         +  LD   +  ++SH I A+LS L+   L ++TN I  D ++W+  ++ F    S FH +  +  L   ++A+  R P Y LEG     ++P   YI+       + Y    LG+P ++I ++P + + G   +MD  +L++ I  D+   + PL++ A  G+   G +D+L  + ++C+ H +WLH  G  LA L   Q    V  +   + S+ L++GSWLG+P++P   LL   +  + L+   F +   LS +  +    +W +LQ +G   I  R+    +T   +++   +   ++++S     +T  + S   ++P     +   + +    V+++  DG    + I       S  +   + +  +  K +   NN                      Y D LN WL   L    P  + ++I  P+ G+C+R C  E  +G Q   SE++  F +S++ H+ I+ +T+  +  F  +V   D L LV LP WAG+G V F+PE       SL  + + TE                 +N +N  L+  L++ D AFSLG        +  D       L CVRFG++T  + +E+L+D V+      +E+S+ L+ +S++VK GI  VT DL RE EEK+ QEGI R VP +  + NWWSPPAK + I GRSLNL+ G +  TE+IYKY MQ+
Sbjct:   35 ASSIRSGLAELE--LRSS---QVLQRLENVKVSTTPESPNPVENEEEAGERVTSEDLLPAKHRVPSDIL----------KSLEQLVSYTDSDDDPEFP-----LPALDDVSHLALISHSIVAYLSHLDRQQLLRVTNSISGDATRWLGTLFHFAHPASSFHADNADAVLRTVRLAIVARCPGY-LEGGIPALAQP-TFYISENTTPMRLHYACRQLGIPLEAIKVIPEHSQSG---TMDVTLLQKQIQQDVGNNRTPLLVVADIGASLCGYVDNLLRLRDVCKAHNMWLHASGHGLAALVCAQNQGHVEEV---LHSMALNLGSWLGVPSLPI-VLLHRPLQNSALS--AFESDPILSRR--LNALSLWTSLQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGASLSDVIQSP----FDVQALFDAAAPVVAYQFDGS---TTIPLGGSGSSAAAAAAERETAEGLKPLEKINNAS--------------------YFDRLNSWLGQILQRDCPNFDFEVIEHPTHGSCIRYCPLELGLGEQPPSSENLESFAQSLEAHVDILRATIKHKARFIHLVECSDVLRLVPLPEWAGMGGVRFVPEGWE----SLLTDQAKTE-----------------LNKLNIDLVEALKSTDNAFSLG--------EGTDG------LICVRFGMVTHETEVEELLDLVVTVGKSVQENSRVLDTMSEIVKKGIEAVTADLQRESEEKLWQEGILRHVPVVGRVFNWWSPPAKESGIKGRSLNLTQGVVESTENIYKYHMQM 744          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Fly
Match: CG1486 (gene:FBgn0031174 transcript:FBtr0077191)

HSP 1 Score: 308.145 bits (788), Expect = 1.969e-91
Identity = 227/805 (28.20%), Postives = 390/805 (48.45%), Query Frame = 1
Query:  130 SSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYL--KH-IPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRI---KTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIG-QDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAK-TQIIGRSLNLSSGEINDTEDIYKYKMQL 2520
            +S + S +AE E  +R+S   +V+   E   +  T    +    +EE+ +++  E  L  KH +P +++          + + + ++  + DD+         +  LD   +  ++SH I A+LS L+   L ++TN I  D ++W+  ++ F    S FH +  +  L   ++A+  R P Y LEG     ++P   YI+       + Y    LG+P ++I ++P + + G   +MD  +L++ I  D+   + PL++ A  G+   G +D+L  + ++C+ H +WLH  G  LA L   Q    V  +   + S+ L++GSWLG+P++P   LL   +  + L+   F +   LS +  +    +W +LQ +G   I  R+    +T   +++   +   ++++S     +T  + S   ++P     +   + +    V+++  DG    + I       S  +   + +  +  K +   NN                      Y D LN WL   L    P  + ++I  P+ G+C+R C  E  +G Q   SE++  F +S++ H+ I+ +T+  +  F  +V   D L LV LP WAG+G V F+PE       SL  + + TE                 +N +N  L+  L++ D AFSLG        +  D       L CVRFG++T  + +E+L+D V+      +E+S+ L+ +S++VK GI  VT DL RE EEK+ QEGI R VP +  + NWWSPPAK + I GRSLNL+ G +  TE+IYKY MQ+
Sbjct:   35 ASSIRSGLAELE--LRSS---QVLQRLENVKVSTTPESPNPVENEEEAGERVTSEDLLPAKHRVPSDIL----------KSLEQLVSYTDSDDDPEFP-----LPALDDVSHLALISHSIVAYLSHLDRQQLLRVTNSISGDATRWLGTLFHFAHPASSFHADNADAVLRTVRLAIVARCPGY-LEGGIPALAQP-TFYISENTTPMRLHYACRQLGIPLEAIKVIPEHSQSG---TMDVTLLQKQIQQDVGNNRTPLLVVADIGASLCGYVDNLLRLRDVCKAHNMWLHASGHGLAALVCAQNQGHVEEV---LHSMALNLGSWLGVPSLPI-VLLHRPLQNSALS--AFESDPILSRR--LNALSLWTSLQALGRKAIAERLHVAFQTCSILFEIASKCEGIRVLSHTPGAQTGASLSDVIQSP----FDVQALFDAAAPVVAYQFDGS---TTIPLGGSGSSAAAAAAERETAEGLKPLEKINNAS--------------------YFDRLNSWLGQILQRDCPNFDFEVIEHPTHGSCIRYCPLELGLGEQPPSSENLESFAQSLEAHVDILRATIKHKARFIHLVECSDVLRLVPLPEWAGMGGVRFVPEGWE----SLLTDQAKTE-----------------LNKLNIDLVEALKSTDNAFSLG--------EGTDG------LICVRFGMVTHETEVEELLDLVVTVGKSVQENSRVLDTMSEIVKKGIEAVTADLQRESEEKLWQEGILRHVPVVGRVFNWWSPPAKESGIKGRSLNLTQGVVESTENIYKYHMQM 744          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Match: pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:447813])

HSP 1 Score: 320.472 bits (820), Expect = 1.723e-96
Identity = 228/800 (28.50%), Postives = 375/800 (46.88%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPP-SVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQ 2523
             +D T+AE    + ++M          ++LE  KL        E  Q Q  ++   K IP  L  +G +   + Q V   +   + DDE+    R   M+ +  Q +  +L H + A++S L  + L KLT RI SDT+ W+ +++R+   ++ FH +   G L VC++ +   Y  +  EG+ +L S+ PVIY ++A    L  +L   LGLP   + +VP N   G    MD  +L++L+  D  +GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L QV + V T ++K  S+TL  G WLG+PAVP  TL       +    L   AG   S     +   P+W++LQ +G+DGI  RI+  S+ S+++ + LK + S+K    + + V+            LEA          L  + D    P V+VFR+    S PS    ++     +R I                           +D+ N+WL D L+   P   + ++ L  EGTC+R            +  DV+  VE +   I ++  T+  R  F+D V  +  L  ++   W GLG V F P +                        +      +++  IN  L+ +L   + D  FS G      P  SE+         C+  G+ T+   + +LV+ +++     EES K  E ++++V+ GI      L +  EEK+ +EG+ RQ+P + S+LNW+S P +  + GR+ NL+ G ++ TE +Y  K Q++
Sbjct:    8 MMDPTLAEMGNHLSDAM----------KILESGKL--------ETEQGQEGRKMSWKEIPGPLQGDGQDVVSILQLVQNLM---HGDDEEQGHRR---MQFVGEQGHMALLGHSLAAYISVLERERLRKLTTRILSDTTLWLCRLFRYENGSAYFHEDDREGLLKVCRLVMNTHYEDFTTEGFTALSSKHPVIYQSAACRPGLGQHLCSQLGLPLSCLCVVPCNTMFGSLHQMDVALLDKLVKDDRDSGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNMWLHVEGVNLATLVLGQVSSTV-TAATKCDSMTLTPGPWLGLPAVPAVTLY-----RHEDPALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIKHASQLSQQLLEHLKTLASIKTSDILDSEVS-----------LLEA----------LRMVEDELNSP-VVVFRFSHENSAPSSGGSVEGSYAGERDI---------------------------LDAFNRWLGDQLAEQVPLSGVDVVELEDEGTCVRFSPLMTAAALGTQENDVAALVEKLAEMIPLLCCTLRLRQDFRDEVLQQASLSYIEDLNWPGLGVVRFEPRTTD----------------------LDEDKRQDRVEKINSDLLKKLMELDTDLNFSGG------PEFSEEKN-------CIFIGIATEDLDVAELVETIMSLGRDIEESGKLFENMTEVVRKGIQEAELQLQKANEEKLMEEGVLRQIPLVSSVLNWFS-PVQASVKGRTFNLAEGCLDSTEPVYSIKAQMR 692          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Match: pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:447813])

HSP 1 Score: 313.153 bits (801), Expect = 6.999e-94
Identity = 224/800 (28.00%), Postives = 369/800 (46.12%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPP-SVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQ 2523
             +D T+AE    + ++M          ++LE  KL        E  Q Q  ++   K IP  L  +G +   + Q V   +   + DDE+    +   M+ +  Q +  +L H + A++S L  + L KLT RI SDT+ W+ +++R+   ++ FH +   G L VC++ +   Y  +  EG+ +L S+ PVIY ++A    L  +L   LGLP   + +VP N   G    MD  +L++L+  D  +GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L QV + V T ++K  S+TL  G WLG+PAVP  TL     +E+    L   AG   S     +   P+W++LQ +G+DGI  RI+  S+ S+++ + LK + S      IKT V   +                                  V+VFR+    S PS    ++     +R I                           +D+ N+WL D L+   P   + ++ L  EGTC+R            +  DV+  VE +   I ++  T+  R  F+D V  +  L  ++   W GLG V F P +                        +      +++  IN  L+ +L   + D  FS G      P  SE+         C+  G+ T+   + +LV+ +++     EES K  E ++++V+ GI      L +  EEK+ +EG+ RQ+P + S+LNW+S P +  + GR+ NL+ G ++ TE +Y  K Q++
Sbjct:    8 MMDPTLAEMGNHLSDAM----------KILESGKL--------ETEQGQEGRKMSWKEIPGPLQGDGQDVVSILQLVQNLM---HGDDEE----QGHRMQFVGEQGHMALLGHSLAAYISVLERERLRKLTTRILSDTTLWLCRLFRYENGSAYFHEDDREGLLKVCRLVMNTHYEDFTTEGFTALSSKHPVIYQSAACRPGLGQHLCSQLGLPLSCLCVVPCNTMFGSLHQMDVALLDKLVKDDRDSGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNMWLHVEGVNLATLVLGQVSSTV-TAATKCDSMTLTPGPWLGLPAVPAVTLY---RHED--PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIKHASQLSQQLLEHLKTLAS------IKTSVEDELNS-------------------------------PVVVFRFSHENSAPSSGGSVEGSYAGERDI---------------------------LDAFNRWLGDQLAEQVPLSGVDVVELEDEGTCVRFSPLMTAAALGTQENDVAALVEKLAEMIPLLCCTLRLRQDFRDEVLQQASLSYIEDLNWPGLGVVRFEPRTTD----------------------LDEDKRQDRVEKINSDLLKKLMELDTDLNFSGG------PEFSEEKN-------CIFIGIATEDLDVAELVETIMSLGRDIEESGKLFENMTEVVRKGIQEAELQLQKANEEKLMEEGVLRQIPLVSSVLNWFS-PVQASVKGRTFNLAEGCLDSTEPVYSIKAQMR 676          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gad1a (glutamate decarboxylase 1a [Source:ZFIN;Acc:ZDB-GENE-070912-472])

HSP 1 Score: 58.5362 bits (140), Expect = 2.791e-8
Identity = 57/261 (21.84%), Postives = 112/261 (42.91%), Query Frame = 1
Query:  604 NNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            +NMY+       VA    YP+  ++G   + + P ++   S      +      LG  ++++ L+  + E G    + P  LE  ++     G +P+ + A AGS   G+ D +NEI ++C ++ +WLH++G     L + +      +   +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I++  + SE +Y  +K     +M+
Sbjct:  256 SNMYS-----VMVARYKHYPEIKIKG---MAAAPRLVLFTSEHSHYSIKKASAVLGFGTENLILLRTD-ERG---RVIPADLEAKVIDAKQKGFVPMFVNATAGSTVYGAFDPINEIADICEKYNMWLHVDGAWGGGLLMSRKHKHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTTGFEKHIDRCLELSEYLYHKIKNREGYEMV 504          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gad1a (glutamate decarboxylase 1a [Source:ZFIN;Acc:ZDB-GENE-070912-472])

HSP 1 Score: 58.151 bits (139), Expect = 3.300e-8
Identity = 57/261 (21.84%), Postives = 112/261 (42.91%), Query Frame = 1
Query:  604 NNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            +NMY+       VA    YP+  ++G   + + P ++   S      +      LG  ++++ L+  + E G    + P  LE  ++     G +P+ + A AGS   G+ D +NEI ++C ++ +WLH++G     L + +      +   +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I++  + SE +Y  +K     +M+
Sbjct:  252 SNMYS-----VMVARYKHYPEIKIKG---MAAAPRLVLFTSEHSHYSIKKASAVLGFGTENLILLRTD-ERG---RVIPADLEAKVIDAKQKGFVPMFVNATAGSTVYGAFDPINEIADICEKYNMWLHVDGAWGGGLLMSRKHKHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGLLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTTGFEKHIDRCLELSEYLYHKIKNREGYEMV 500          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Match: gad1b (glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GENE-030909-3])

HSP 1 Score: 54.6842 bits (130), Expect = 4.438e-7
Identity = 41/183 (22.40%), Postives = 80/183 (43.72%), Query Frame = 1
Query:  838 PLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            P  LE  ++     G +PL + A AG+   G+ D +N+I ++C ++ +WLH++G     L + +      +   +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I++  + SE +Y  +K     +M+
Sbjct:  314 PADLEAKVIDAKQKGYVPLFVNATAGTTVYGAFDPINDIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVPLQCSAILVREKGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDRCLELSEYLYNKIKNREGYEMV 496          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Match: PDXDC1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:100497493])

HSP 1 Score: 317.39 bits (812), Expect = 3.389e-95
Identity = 233/797 (29.23%), Postives = 384/797 (48.18%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRI--CFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
             +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   + +   ++E++++ R+  ++ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N+LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+ S+++ +SLK ++S+K                     ++E +G                    V+VFR+      S+ T      LN   I     D D L                     NQWL D L+A  P   + ++ L  EGTC+R        V+G    +EDV + V  ++  I ++ +T+  +  F+  V     L  ++  +WAGLG +           Y  F E  +++   + LE I  +  L K+N +   L          FS G    +F   +E N        C+  G+ ++   + +LV+ +     + EE+++ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW+S P +T   GR+ NL++G +  TE  Y  K Q
Sbjct:    8 MVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEERD--GKKHSRKDIPGPLQGSGQNMVSILQLVQNLMHDD--EEEESLSFRR--IQNVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNALYNKQPVIYISAASRPGLGQSICNQLGLPLSCLCRVPCNTMFGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLSQKLLESLKNLSSVK--------------------TSVENDGSS-----------------PVVVFRFVYEGCKSDST------LNLSTIER---DSDAL---------------------NQWLGDQLAALVPLCGVDIVELEDEGTCVRFNPLMTTAVLG--TTAEDVEQLVACLRMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFNEEQDSDKREADLEKITVA-LLKKLNELETDL---------PFSSGP---EF--GAEKN--------CIYIGMASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKANEERLLEEGVLRQIPLVGSMLNWFS-PVQTTPKGRTFNLTAGSLETTETTYISKAQ 673          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Match: PDXDC1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:100497493])

HSP 1 Score: 231.876 bits (590), Expect = 2.124e-64
Identity = 139/405 (34.32%), Postives = 220/405 (54.32%), Query Frame = 1
Query:  124 EKSSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLK 1335
            E    +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   + +   ++E++++ R  N+     Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N+LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+ S+++ +SLK ++S+K
Sbjct:    2 ESGRMVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEERD--GKKHSRKDIPGPLQGSGQNMVSILQLVQNLMHDD--EEEESLSFRIQNV---GEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNALYNKQPVIYISAASRPGLGQSICNQLGLPLSCLCRVPCNTMFGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLSQKLLESLKNLSSVK 377          

HSP 2 Score: 108.612 bits (270), Expect = 1.194e-23
Identity = 80/294 (27.21%), Postives = 143/294 (48.64%), Query Frame = 1
Query: 1642 IDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRI--CFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            + S+   L D L+A  P   + ++ L  EGTC+R        V+G    +EDV + V  ++  I ++ +T+  +  F+  V     L  ++  +WAGLG +           Y  F E  +++   + LE I  +  L K+N +   L          FS G    +F   +E N        C+  G+ ++   + +LV+ +     + EE+++ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW+S P +T   GR+ NL++G +  TE  Y  K Q
Sbjct:  373 LSSVKTSLGDQLAALVPLCGVDIVELEDEGTCVRFNPLMTTAVLG--TTAEDVEQLVACLRMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFNEEQDSDKREADLEKITVA-LLKKLNELETDL---------PFSSGP---EF--GAEKN--------CIYIGMASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKANEERLLEEGVLRQIPLVGSMLNWFS-PVQTTPKGRTFNLTAGSLETTETTYISKAQ 630          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Match: PDXDC1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:100497493])

HSP 1 Score: 223.402 bits (568), Expect = 2.861e-61
Identity = 134/390 (34.36%), Postives = 211/390 (54.10%), Query Frame = 1
Query:  130 SSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSE 1296
            SS +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   + +   ++E++++ R+  ++ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N+LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+  E
Sbjct:   34 SSMVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEERD--GKKHSRKDIPGPLQGSGQNMVSILQLVQNLMHDD--EEEESLSFRR--IQNVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNALYNKQPVIYISAASRPGLGQSICNQLGLPLSCLCRVPCNTMFGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLVE 395          

HSP 2 Score: 105.916 bits (263), Expect = 9.067e-23
Identity = 78/285 (27.37%), Postives = 139/285 (48.77%), Query Frame = 1
Query: 1669 DNLSATFPQINLKMITLPSEGTCLRI--CFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D L+A  P   + ++ L  EGTC+R        V+G    +EDV + V  ++  I ++ +T+  +  F+  V     L  ++  +WAGLG +           Y  F E  +++   + LE I  +  L K+N +   L          FS G    +F   +E N        C+  G+ ++   + +LV+ +     + EE+++ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW+S P +T   GR+ NL++G +  TE  Y  K Q
Sbjct:  416 DQLAALVPLCGVDIVELEDEGTCVRFNPLMTTAVLG--TTAEDVEQLVACLRMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFNEEQDSDKREADLEKITVA-LLKKLNELETDL---------PFSSGP---EF--GAEKN--------CIYIGMASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKANEERLLEEGVLRQIPLVGSMLNWFS-PVQTTPKGRTFNLTAGSLETTETTYISKAQ 664          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Match: PDXDC1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:100497493])

HSP 1 Score: 219.935 bits (559), Expect = 2.073e-60
Identity = 132/388 (34.02%), Postives = 209/388 (53.87%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSE 1296
             +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   + +   ++E++++ R+  ++ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N+LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+  E
Sbjct:    1 MVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEERD--GKKHSRKDIPGPLQGSGQNMVSILQLVQNLMHDD--EEEESLSFRR--IQNVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNALYNKQPVIYISAASRPGLGQSICNQLGLPLSCLCRVPCNTMFGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLVE 360          

HSP 2 Score: 105.916 bits (263), Expect = 7.350e-23
Identity = 78/285 (27.37%), Postives = 139/285 (48.77%), Query Frame = 1
Query: 1669 DNLSATFPQINLKMITLPSEGTCLRI--CFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D L+A  P   + ++ L  EGTC+R        V+G    +EDV + V  ++  I ++ +T+  +  F+  V     L  ++  +WAGLG +           Y  F E  +++   + LE I  +  L K+N +   L          FS G    +F   +E N        C+  G+ ++   + +LV+ +     + EE+++ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW+S P +T   GR+ NL++G +  TE  Y  K Q
Sbjct:  381 DQLAALVPLCGVDIVELEDEGTCVRFNPLMTTAVLG--TTAEDVEQLVACLRMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFNEEQDSDKREADLEKITVA-LLKKLNELETDL---------PFSSGP---EF--GAEKN--------CIYIGMASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKANEERLLEEGVLRQIPLVGSMLNWFS-PVQTTPKGRTFNLTAGSLETTETTYISKAQ 629          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Match: PDXDC1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:100497493])

HSP 1 Score: 220.32 bits (560), Expect = 2.425e-60
Identity = 133/388 (34.28%), Postives = 204/388 (52.58%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSE 1296
             +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   +     DDE+  +     ++ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N+LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+  E
Sbjct:   13 MVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEERD--GKKHSRKDIPGPLQGSGQNMVSILQLVQNLM----HDDEEEESLSFRRIQNVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYDHGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNALYNKQPVIYISAASRPGLGQSICNQLGLPLSCLCRVPCNTMFGSQHQMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLVE 372          

HSP 2 Score: 106.686 bits (265), Expect = 5.252e-23
Identity = 78/285 (27.37%), Postives = 139/285 (48.77%), Query Frame = 1
Query: 1669 DNLSATFPQINLKMITLPSEGTCLRI--CFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D L+A  P   + ++ L  EGTC+R        V+G    +EDV + V  ++  I ++ +T+  +  F+  V     L  ++  +WAGLG +           Y  F E  +++   + LE I  +  L K+N +   L          FS G    +F   +E N        C+  G+ ++   + +LV+ +     + EE+++ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW+S P +T   GR+ NL++G +  TE  Y  K Q
Sbjct:  393 DQLAALVPLCGVDIVELEDEGTCVRFNPLMTTAVLG--TTAEDVEQLVACLRMKIPVLQNTLKLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFNEEQDSDKREADLEKITVA-LLKKLNELETDL---------PFSSGP---EF--GAEKN--------CIYIGMASEDLDVPELVETITAMGREIEENTRLLENMTEVVRKGILEAEVQLYKANEERLLEEGVLRQIPLVGSMLNWFS-PVQTTPKGRTFNLTAGSLETTETTYISKAQ 641          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Match: Pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:MGI Symbol;Acc:MGI:1920909])

HSP 1 Score: 315.849 bits (808), Expect = 1.942e-95
Identity = 228/794 (28.72%), Postives = 371/794 (46.73%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D T+AE  + ++ +M          +MLE +      +  +EE+ K+   E     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  D+  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DGI  RI+     S+ + +SLK++  +K+                             L+E  LS          V+VFR+          +L   D   + +  +N         P  +  E        D+LN+WL + L    PQ  L +I L  +GTC+R        G   + EDV + +  ++  + ++  T+  R  F+  V     L+ VD P W G+G V +  E   +   SL ++    + +   L+         K+N +   L          F +G  +                  C+  G+ +    + +LV+ +   A + EE+S+ LE ++++V+ GI      L +  EE++ +EG+ RQ+P + S+LNW+SP   +Q  GRS NL++G +  TE  Y +K+Q
Sbjct:   10 DPTLAEMGKNLKEAM----------RMLEKSP-----RRTEEENGKKPVSE----DIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSTRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGLWLGLPAVPAVTLYKHDDP-----ALTLVAGLT-SNKPADKLRALPLWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKI-----------------------------LVEDELS--------SPVVVFRFF--------QELPASDSAFKAVPVSN-------IAPAAVGRERHSC----DALNRWLGEQLKQLVPQCGLTVIDLEVDGTCVRFSPLMTAEGLGTRGEDVDQLITCIQSKLPVLTCTLQLREEFKQEVEGTAGLLYVDDPNWPGIGVVRY--EHANDDDTSLKSDPEGEKIHTGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CIYIGMASDDVDVSELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKANEERLLEEGVLRQIPVVGSVLNWFSPVQASQ-KGRSFNLTAGSLESTEYTYVHKVQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Match: Pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:MGI Symbol;Acc:MGI:1920909])

HSP 1 Score: 315.849 bits (808), Expect = 1.132e-94
Identity = 228/794 (28.72%), Postives = 371/794 (46.73%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D T+AE  + ++ +M          +MLE +      +  +EE+ K+   E     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  D+  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DGI  RI+     S+ + +SLK++  +K+                             L+E  LS          V+VFR+          +L   D   + +  +N         P  +  E        D+LN+WL + L    PQ  L +I L  +GTC+R        G   + EDV + +  ++  + ++  T+  R  F+  V     L+ VD P W G+G V +  E   +   SL ++    + +   L+         K+N +   L          F +G  +                  C+  G+ +    + +LV+ +   A + EE+S+ LE ++++V+ GI      L +  EE++ +EG+ RQ+P + S+LNW+SP   +Q  GRS NL++G +  TE  Y +K+Q
Sbjct:   10 DPTLAEMGKNLKEAM----------RMLEKSP-----RRTEEENGKKPVSE----DIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSTRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGLWLGLPAVPAVTLYKHDDP-----ALTLVAGL-TSNKPADKLRALPLWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKI-----------------------------LVEDELS--------SPVVVFRFF--------QELPASDSAFKAVPVSN-------IAPAAVGRERHSC----DALNRWLGEQLKQLVPQCGLTVIDLEVDGTCVRFSPLMTAEGLGTRGEDVDQLITCIQSKLPVLTCTLQLREEFKQEVEGTAGLLYVDDPNWPGIGVVRY--EHANDDDTSLKSDPEGEKIHTGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CIYIGMASDDVDVSELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKANEERLLEEGVLRQIPVVGSVLNWFSPVQASQ-KGRSFNLTAGSLESTEYTYVHKVQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Match: Pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:MGI Symbol;Acc:MGI:1920909])

HSP 1 Score: 219.164 bits (557), Expect = 3.199e-63
Identity = 136/403 (33.75%), Postives = 213/403 (52.85%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMIS 1344
            D T+AE  + ++ +M          +MLE +      +  +EE+ K+   E     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  D+  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DGI  RI+     S+ + +SLK++  +K++ 
Sbjct:   10 DPTLAEMGKNLKEAM----------RMLEKSP-----RRTEEENGKKPVSE----DIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSTRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGLWLGLPAVPAVTLYKHDD-----PALTLVAGLT-SNKPADKLRALPLWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKILG 381          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Match: Pdxdc1 (pyridoxal-dependent decarboxylase domain containing 1 [Source:MGI Symbol;Acc:MGI:1920909])

HSP 1 Score: 192.2 bits (487), Expect = 1.356e-53
Identity = 129/411 (31.39%), Postives = 208/411 (50.61%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI--SRIKTPV 1362
            D T+AE  + ++ +M          +MLE +      +  +EE+ K+   E     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL                        + D   LE+LI  D+  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DGI  RI+     S+ + +SLK++  +K++    + +PV
Sbjct:   10 DPTLAEMGKNLKEAM----------RMLEKSP-----RRTEEENGKKPVSE----DIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSTRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLC-----------------------NQDVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGLWLGLPAVPAVTLYKHDD-----PALTLVAGLT-SNKPADKLRALPLWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKILVEDELSSPV 366          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Match: Gad2 (glutamic acid decarboxylase 2 [Source:MGI Symbol;Acc:MGI:95634])

HSP 1 Score: 57.3806 bits (137), Expect = 6.800e-8
Identity = 51/207 (24.64%), Postives = 97/207 (46.86%), Query Frame = 1
Query:  766 LGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATL-----LMTDMNENYLNKL-----GFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            LG+ +DS+ L+  + E G    M P  LE+ IL     G +P ++ A AG+   G+ D L  + ++C+++KIW+H++      L + +      +   +  SVT +    +G+P    A L     LM   N+ + + L      +   Y   +K++     + VF +W+  +  G  G  + I+K  + +E +Y  +K     +M+
Sbjct:  292 LGIGTDSVILIKCD-ERG---KMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEYLYTIIKNREGYEMV 494          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6P996|PDXD1_HUMAN (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1 PE=1 SV=2)

HSP 1 Score: 320.857 bits (821), Expect = 1.034e-95
Identity = 227/773 (29.37%), Postives = 360/773 (46.57%), Query Frame = 1
Query:  214 KQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKK---PRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            K + E  K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+T+  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DG   RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+                       +  P  D + K    P    S   + +   D+LN+WL + L    P   L ++ L +EGTCLR            + EDV + V  ++  + ++  T+  R  F+  V A   L+ VD P W+G+G V +  E   +   SL ++      +   L+         K+N +   L          F +G  +                  C+  G+ +      +LV+ +   A + EE+S+ LE ++++V+ GI     +L +  EE++ +EG+ RQ+P + S+LNW+SP    Q  GR+ NL++G +  TE IY YK Q
Sbjct:   18 KNLKEAVKMLEDSQRRTEEEN---GKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSPRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAAAKCDSMTMTPGPWLGLPAVPAVTLYKHDDP-----ALTLVAGLT-SNKPTDKLRALPLWLSLQYLGLDGFVERIKHACQLSQRLQESLKKV-----------------------------NYIKILVEDELS--------SPVVVFRF----------------------FQELPGSDPVFKAVPVPNMTPSGVGRERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVACIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRY--EHANDDKSSLKSDPEGENIHAGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CLYVGMASDNVDAAELVETIAATAREIEENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQ-KGRTFNLTAGSLESTEPIYVYKAQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q6DF78|PDXD1_XENLA (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=pdxdc1 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.847e-95
Identity = 233/795 (29.31%), Postives = 373/795 (46.92%), Query Frame = 1
Query:  136 FLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
             +D T+AE         MGK +D       E  K+L+D +   EE +    K+   K IP  L   G N   + Q V   +     DDE+  +     ++ +  Q +  +L H + A++S L+ +HL KLT RI SDT+ W+ +++R+   ++ +H +   G L VC++ +  RY  Y  +G+N LY++ PVIYI++A+   L   +   LGLP   +  VP N   G    MD  +L++LI  DI +GK PL++ A AG+P  G  D L  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL +G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+ GI  RI+  S+ S+++ ++LK       +S +KTPV      EN                       DG     V+VFR+      S+ T      LN   I  ++                        D+LNQWL D L+A  P   + ++ L  EGTC+R             +EDV + V  ++  I ++++T+  +  F+  V     L  ++  +WAGLG +           Y  F+E  +     + LE I  +  L K+N +   L                     C   + G E     C+  G+ ++   + +LV+ +     + EE+S+ LE ++++V+ GI+     L +  EE++ +EG+ RQ+P + S+LNW SP   T   GR+ NL++G +  TE  Y  K Q
Sbjct:    8 MVDPTLAE---------MGKNLD-------EAMKILEDNQRPSEEEKD--GKKYTRKDIPGPLQGSGQNMVSVLQLVQNLM----HDDEEEQSPSLRRIQNVGEQGHMALLGHSLAAYISVLDREHLRKLTTRILSDTTLWLCRLFRYDNGSAYYHEDDREGLLKVCRLVIHSRYEDYTTDGFNVLYNKLPVIYISAASRPGLGQSVCNQLGLPLSCLCRVPCNTMFGSQHEMDVALLDRLIKDDIQSGKCPLLLVANAGTPGAGHTDKLGRLKELCDQYNIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTLGPWLGLPAVPAVTLYRHED-----PSLSLAAGLTSSQPVEKLRALPLWLSLQYLGHSGIVERIKHASQLSQKLLENLKN------LSPVKTPV------EN-----------------------DGSS--PVVVFRFVYEGCKSDST------LNLSTIERDS------------------------DALNQWLGDQLAALVPSSGVDIVELEDEGTCVRFNPLMTCAVLGTTAEDVEQLVACLRMKIPVLENTLRLKEEFRQEVERIAGLSYINDYSWAGLGVLR----------YEQFSEEQDAAKREADLEKITVA-LLKKLNELETDLTF-------------------CSGPEFGAEK---NCIYIGMASEDLDVSELVETITAMGREIEENSRLLENMTEVVRKGILEAEVQLNKANEERLLEEGVLRQIPLVGSMLNWLSPVQATP-KGRTFNLTAGSLETTEMTYISKAQ 673          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|A7MBC2|PDXD1_BOVIN (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Bos taurus OX=9913 GN=PDXDC1 PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 3.226e-94
Identity = 232/792 (29.29%), Postives = 371/792 (46.84%), Query Frame = 1
Query:  154 AEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRIC--FQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            A  E+++ +  + ++  N ++ M    K+L+D + + EE      K+     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY+R PV+Y+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  DI  GK+PL++ A AG+   G  D +  +  +C ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   +G   SNK    +   P+W++LQ +G DGI  RI+   + S+ + +SLK++                             N IK L+E  LS          V+VFR+      S+P       LN              + + R             D+LN+WL + L    P   L ++ L  EGTC+R        V+G   + EDV + V  V+  + ++  T+  R  F+  V A   L+ VD P W G+G V +  E   +   SL  +    + +   L+         K+N +   L          F +G  +                  C+  G+ +    I +LV+ +   A + EE S+ LE ++++V+ GI      L +  EE++ +EG+ RQ+P + S+LNW+SP   +Q  GR+ NL++G +  TE  Y YK+Q
Sbjct:    3 ASLEKKIADPTLAEMGKNLKEAM----KMLEDSQRRTEEEN---GKKLLSGDIPGPLQGSGQDMVSILQLVQNLMHGD--EDEQPQSTRIQN---IGEQGHISLLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNRKPVLYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGKLPLLLVANAGTAAVGHTDKIGRLKEVCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGPWLGLPAVPAVTLYKHDDP-----ALTLVSGLT-SNKPADKLRALPLWLSLQYLGLDGIVERIKHACQLSQRLQESLKKV-----------------------------NHIKILVEDELS--------SPVVVFRFFQELPGSDP------GLNAIPAPSAA---ASAVGRERH----------SCDALNRWLGEQLKQLVPMSGLTVMDLEVEGTCVRFSPLMTAAVLG--TRGEDVDQLVACVQSKLPVLTCTLQLREEFKQEVEATAGLLYVDDPNWPGIGVVRY--EHANDDKSSLKLDPEGEKIHAGLLK---------KLNELESDL---------TFKMGPEYKSMKS-------------CIYIGMASDDIDISELVETIAVTAREIEEDSRLLENMTEVVRKGIQEAQVQLQKANEERLLEEGVLRQIPVVGSVLNWFSPVQASQ-KGRTFNLTAGSLESTEHTYVYKVQ 683          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q99K01|PDXD1_MOUSE (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pdxdc1 PE=1 SV=2)

HSP 1 Score: 316.62 bits (810), Expect = 5.075e-94
Identity = 228/794 (28.72%), Postives = 371/794 (46.73%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV--MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            D T+AE  + ++ +M          +MLE +      +  +EE+ K+   E     IP  L   G +   + Q V   +     +DE+  + R  N   +  Q +  +L H +GA++STL+ + L KLT RI SDT+ W+ +I+R+    + FH     G   +C++A+  RY  + ++G+N LY++ PVIY+++AA   L  YL   LGLP   +  VP N   G    MD   LE+LI  D+  G++PL++ A AG+   G  D +  +  LC ++ IWLH+EG+ LA LAL  V + V   ++K  S+TL  G WLG+PAVP  TL   D        L   AG   SNK    +   P+W++LQ +G DGI  RI+     S+ + +SLK++  +K+                             L+E  LS          V+VFR+          +L   D   + +  +N         P  +  E        D+LN+WL + L    PQ  L +I L  +GTC+R        G   + EDV + +  ++  + ++  T+  R  F+  V     L+ VD P W G+G V +  E   +   SL ++    + +   L+         K+N +   L          F +G  +                  C+  G+ +    + +LV+ +   A + EE+S+ LE ++++V+ GI      L +  EE++ +EG+ RQ+P + S+LNW+SP   +Q  GRS NL++G +  TE  Y +K+Q
Sbjct:   10 DPTLAEMGKNLKEAM----------RMLEKSP-----RRTEEENGKKPVSE----DIPGPLQGSGQDMVSILQLVQNLMHGD--EDEEPQSTRIQN---IGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLRRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQLGLPFPCLCRVPCNTMFGSQHQMDVAFLEKLIKDDVERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSV-LAATKCDSMTLTPGLWLGLPAVPAVTLYKHDDP-----ALTLVAGL-TSNKPADKLRALPLWLSLQYLGLDGIVERIKHACHLSQRLQESLKKVDHIKI-----------------------------LVEDELS--------SPVVVFRFF--------QELPASDSAFKAVPVSN-------IAPAAVGRERHSC----DALNRWLGEQLKQLVPQCGLTVIDLEVDGTCVRFSPLMTAEGLGTRGEDVDQLITCIQSKLPVLTCTLQLREEFKQEVEGTAGLLYVDDPNWPGIGVVRY--EHANDDDTSLKSDPEGEKIHTGLLK---------KLNELESDL---------TFKIGPEYKSMKS-------------CIYIGMASDDVDVSELVETIAVTAREIEENSRLLENMTEVVRKGIQEAQVQLQKANEERLLEEGVLRQIPVVGSVLNWFSPVQASQ-KGRSFNLTAGSLESTEYTYVHKVQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q66HY8|PDXD1_DANRE (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Danio rerio OX=7955 GN=pdxdc1 PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.372e-92
Identity = 216/767 (28.16%), Postives = 358/767 (46.68%), Query Frame = 1
Query:  235 KLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPP-SVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQ 2523
            K+L+  K + E+ Q+   ++   K IP  L  +G +   + Q V   +   + DDE+    +   M+ +  Q +  +L H + A++S L  + L KLT RI SDT+ W+ +++R+   ++ FH +   G L VC++ +   Y  +  EG+ +L S+ PVIY ++A    L  +L   LGLP   + +VP N   G    MD  +L++L+  D  +GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L QV + V T ++K  S+TL  G WLG+PAVP  TL   +        L   AG   S     +   P+W++LQ +G+DGI  RI+  S+ S+++ + LK + S      IKT V   +                                  V+VFR+    S PS    ++     +R I                           +D+ N+WL D L+   P   + ++ L  EGTC+R            +  DV+  VE +   I ++  T+  R  F+D V  +  L  ++   W GLG V F P +                        +      +++  IN  L+ +L   + D  FS G      P  SE+         C+  G+ T+   + +LV+ +++     EES K  E ++++V+ GI      L +  EEK+ +EG+ RQ+P + S+LNW+S P +  + GR+ NL+ G ++ TE +Y  K Q++
Sbjct:   10 KILESGKLETEQGQE--GRKMSWKEIPGPLQGDGQDVVSILQLVQNLM---HGDDEE----QGHRMQFVGEQGHMALLGHSLAAYISVLERERLRKLTTRILSDTTLWLCRLFRYENGSAYFHEDDREGLLKVCRLVMNTHYEDFTTEGFTALSSKHPVIYQSAACRPGLGQHLCSQLGLPLSCLCVVPCNTMFGSLHQMDVALLDKLVKDDRDSGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNMWLHVEGVNLATLVLGQVSSTV-TAATKCDSMTLTPGPWLGLPAVPAVTLYRHED-----PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIKHASQLSQQLLEHLKTLAS------IKTSVEDELNS-------------------------------PVVVFRFSHENSAPSSGGSVEGSYAGERDI---------------------------LDAFNRWLGDQLAEQVPLSGVDVVELEDEGTCVRFSPLMTAAALGTQENDVAALVEKLAEMIPLLCCTLRLRQDFRDEVLQQASLSYIEDLNWPGLGVVRFEPRTTD----------------------LDEDKRQDRVEKINSDLLKKLMELDTDLNFSGG------PEFSEEKN-------CIFIGIATEDLDVAELVETIMSLGRDIEESGKLFENMTEVVRKGIQEAELQLQKANEEKLMEEGVLRQIPLVSSVLNWFS-PVQASVKGRTFNLAEGCLDSTEPVYSIKAQMR 661          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Match: A0A1S3JYW4 (putative pyridoxal-dependent decarboxylase domain-containing protein 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177395 PE=4 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 1.930e-149
Identity = 281/850 (33.06%), Postives = 466/850 (54.82%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNF----DDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMT-DMNENYLNKL-GFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYD------PPSVPS------EPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDS--------------KTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAK-TQIIGRSLNLSSGEINDTEDIYKYKMQLQ-SGPNSVFSIANVNPMEQANSSP 2589
            DS MA   R++R   M  ++   E+++ E+ +++D++  +  E ++   K R  +HIP  L   G N   + + + + +   N+    +++K I    A ++ LD      ILSHG+ A++S L   HL   TN I  DTS W+S+++RF  +   +H +   G + +C++AL  ++PKY  EGY +LYSRPPVIY++SAA + + DYL   LGLPS  +S +P + + G    MD   LEQ +  D+++ + PL++  +AG+P    +D + +I ++C++H+IW H+EG  LA LA+  VP  V+ + +   S+TL++G WLG+P++PY TL  T D  + Y   L      Y+LS        PIW+ LQ +G++G+ +RI+ +   +E++++ L   +SL+ +S    P +K     +PN  +L +     + + V++FL      PSV VF+Y       PP V S      +P K+      +   +      + +   P    SED               + + Y D+LN WL + L      ++L  I +P+EG C+R    EN   Q    ED+  + +S+   + I+++TV ++  FQ++V A+D L LV LP WAGLG V ++P                 ++++  L+ + ++    +IN++N  L+ +L++ D AFSLG         +ED       L C RFGLIT+ + +E+L+  V   A + EESSK LEK+S++V+ GI    +DL +E EEK+ QEG+ R VP + SL++WWSPP K T + GR+ NL+SG+++ TE+ YKY MQ+Q + P+++       P+ +AN  P
Sbjct:   43 DSQMA---RDLRRVWMNPMLAELERKIQENNRVMDEMNRKWREEKEAERKLRLSEHIPEPLKGHGQNLEDIIKHLEDLMVYENYVDGLEEQKLIP---AKLRLLDENAEVAILSHGLSAYVSLLEPSHLKHFTNNIVEDTSLWLSRMFRFDDAAVFYHEDEREGLIRLCRLALHKKFPKYLDEGYEALYSRPPVIYLSSAAKAGMGDYLCAQLGLPSSCLSTIPCSIQPGCQHKMDTTALEQQVEDDVTSARTPLLVLGYAGTPVIAQVDDIEKIQSICKKHQIWFHVEGHHLATLAMYSVPTNVSPVKTG-DSITLNLGCWLGLPSLPYVTLYKTADSTQAYHAGLTSLQTHYKLS------CLPIWVCLQNLGHEGVVNRIKLSVDLAEKMHEKLMGHSSLQEVSNTVKPADK-----DPNETSLRS----RISKAVVNFLTYEISSPSV-VFKYSCYASDAPPEVASYAKNAPKPVKIPAKMPERAPYAAQETSANHV---PSSTQSEDGAEPPTMSVGTEESYRHEDYFDALNIWLAETLKREVSTVHLDTIEVPNEGLCIRFSPLENAQVQGTTLEDMEVWGKSLGKQVSILNATVKQKENFQEVVEAQDNLRLVHLPTWAGLGAVQYIP-----------------DHWIDKLDALTAAAK-REINHLNTELVKQLKSSDTAFSLGR--------AEDG------LVCARFGLITEETDMEELIGLVYTTAKEIEESSKFLEKMSEIVRKGIEAANEDLKKENEEKLIQEGLLRHVPLVGSLVSWWSPPPKETGVKGRTFNLASGKVHSTEETYKYHMQIQEASPDALQPKPKQGPL-KANLKP 833          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Match: A0A1S3K002 (putative pyridoxal-dependent decarboxylase domain-containing protein 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106177395 PE=4 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.237e-147
Identity = 278/851 (32.67%), Postives = 468/851 (54.99%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNF----DDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMT-DMNENYLNKL-GFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPS-VIVFRYD------PPSVPS------EPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDS--------------KTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAK-TQIIGRSLNLSSGEINDTEDIYKYKMQLQ-SGPNSVFSIANVNPMEQANSSP 2589
            DS MA   R++R   M  ++   E+++ E+ +++D++  +  E ++   K R  +HIP  L   G N   + + + + +   N+    +++K I    A ++ LD      ILSHG+ A++S L   HL   TN I  DTS W+S+++RF  +   +H +   G + +C++AL  ++PKY  EGY +LYSRPPVIY++SAA + + DYL   LGLPS  +S +P + + G    MD   LEQ +  D+++ + PL++  +AG+P    +D + +I ++C++H+IW H+EG  LA LA+  VP  V+ + +   S+TL++G WLG+P++PY TL  T D  + Y   L      Y+LS        PIW+ LQ +G++G+ +RI+ +   +E++++ L   +SL+ +S      N++     P +   E+ G+ +++   ++ LL  Y++ S  +VF+Y       PP V S      +P K+      +   +      + +   P    SED               + + Y D+LN WL + L      ++L  I +P+EG C+R    EN   Q    ED+  + +S+   + I+++TV ++  FQ++V A+D L LV LP WAGLG V ++P                 ++++  L+ + ++    +IN++N  L+ +L++ D AFSLG         +ED       L C RFGLIT+ + +E+L+  V   A + EESSK LEK+S++V+ GI    +DL +E EEK+ QEG+ R VP + SL++WWSPP K T + GR+ NL+SG+++ TE+ YKY MQ+Q + P+++       P+ +AN  P
Sbjct:   43 DSQMA---RDLRRVWMNPMLAELERKIQENNRVMDEMNRKWREEKEAERKLRLSEHIPEPLKGHGQNLEDIIKHLEDLMVYENYVDGLEEQKLIP---AKLRLLDENAEVAILSHGLSAYVSLLEPSHLKHFTNNIVEDTSLWLSRMFRFDDAAVFYHEDEREGLIRLCRLALHKKFPKYLDEGYEALYSRPPVIYLSSAAKAGMGDYLCAQLGLPSSCLSTIPCSIQPGCQHKMDTTALEQQVEDDVTSARTPLLVLGYAGTPVIAQVDDIEKIQSICKKHQIWFHVEGHHLATLAMYSVPTNVSPVKTG-DSITLNLGCWLGLPSLPYVTLYKTADSTQAYHAGLTSLQTHYKLS------CLPIWVCLQNLGHEGVVNRIKLSVDLAEKMHEKLMGHSSLQEVS------NRA-----PPKPEAESEGLGHMLSKAINALLT-YEISSPSVVFKYSCYASDAPPEVASYAKNAPKPVKIPAKMPERAPYAAQETSANHV---PSSTQSEDGAEPPTMSVGTEESYRHEDYFDALNIWLAETLKREVSTVHLDTIEVPNEGLCIRFSPLENAQVQGTTLEDMEVWGKSLGKQVSILNATVKQKENFQEVVEAQDNLRLVHLPTWAGLGAVQYIP-----------------DHWIDKLDALTAAAK-REINHLNTELVKQLKSSDTAFSLGR--------AEDG------LVCARFGLITEETDMEELIGLVYTTAKEIEESSKFLEKMSEIVRKGIEAANEDLKKENEEKLIQEGLLRHVPLVGSLVSWWSPPPKETGVKGRTFNLASGKVHSTEETYKYHMQIQEASPDALQPKPKQGPL-KANLKP 832          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Match: A0A1S3JZ92 (putative pyridoxal-dependent decarboxylase domain-containing protein 2 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106177395 PE=4 SV=1)

HSP 1 Score: 452.981 bits (1164), Expect = 3.566e-142
Identity = 270/831 (32.49%), Postives = 457/831 (54.99%), Query Frame = 1
Query:  142 DSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNF----DDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMT-DMNENYLNKL-GFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLK--MISRIKTPV----NKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDS-KTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAK-TQIIGRSLNLSSGEINDTEDIYKYKMQLQ-SGPNSVFSIANVNPMEQANSSP 2589
            DS MA   R++R   M  ++   E+++ E+ +++D++  +  E ++   K R  +HIP  L   G N   + + + + +   N+    +++K I    A ++ LD      ILSHG+ A++S L   HL   TN I  DTS W+S+++RF  +   +H +   G + +C++AL  ++PKY  EGY +LYSRPPVIY++SAA + + DYL   LGLPS  +S +P + + G    MD   LEQ +  D+++ + PL++  +AG+P    +D + +I ++C++H+IW H+EG  LA LA+  VP  V+ + +   S+TL++G WLG+P++PY TL  T D  + Y   L      Y+LS        PIW+ LQ +G++G+ +RI+ +   +E++++ L   +SL+  +   I +P           + P  +   A+  KN  + V        ++P+ +     P   P    +     +     SE+  +   +      + +E+S + + Y D+LN WL + L      ++L  I +P+EG C+R    EN   Q    ED+  + +S+   + I+++TV ++  FQ++V A+D L LV LP WAGLG V ++P                 ++++  L+ + ++    +IN++N  L+ +L++ D AFSLG         +ED       L C RFGLIT+ + +E+L+  V   A + EESSK LEK+S++V+ GI    +DL +E EEK+ QEG+ R VP + SL++WWSPP K T + GR+ NL+SG+++ TE+ YKY MQ+Q + P+++       P+ +AN  P
Sbjct:   43 DSQMA---RDLRRVWMNPMLAELERKIQENNRVMDEMNRKWREEKEAERKLRLSEHIPEPLKGHGQNLEDIIKHLEDLMVYENYVDGLEEQKLIP---AKLRLLDENAEVAILSHGLSAYVSLLEPSHLKHFTNNIVEDTSLWLSRMFRFDDAAVFYHEDEREGLIRLCRLALHKKFPKYLDEGYEALYSRPPVIYLSSAAKAGMGDYLCAQLGLPSSCLSTIPCSIQPGCQHKMDTTALEQQVEDDVTSARTPLLVLGYAGTPVIAQVDDIEKIQSICKKHQIWFHVEGHHLATLAMYSVPTNVSPVKTG-DSITLNLGCWLGLPSLPYVTLYKTADSTQAYHAGLTSLQTHYKLS------CLPIWVCLQNLGHEGVVNRIKLSVDLAEKMHEKLMGHSSLQEVLTYEISSPSVVFKYSCYASDAPPEV---ASYAKNAPKPV--------KIPAKM-----PERAPYAAQETSANHVPSSTQSEDGAEPPTM-----SVGTEESYRHEDYFDALNIWLAETLKREVSTVHLDTIEVPNEGLCIRFSPLENAQVQGTTLEDMEVWGKSLGKQVSILNATVKQKENFQEVVEAQDNLRLVHLPTWAGLGAVQYIP-----------------DHWIDKLDALTAAAK-REINHLNTELVKQLKSSDTAFSLGR--------AEDG------LVCARFGLITEETDMEELIGLVYTTAKEIEESSKFLEKMSEIVRKGIEAANEDLKKENEEKLIQEGLLRHVPLVGSLVSWWSPPPKETGVKGRTFNLASGKVHSTEETYKYHMQIQEASPDALQPKPKQGPL-KANLKP 806          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Match: K1QGU3 (Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10021833 PE=4 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 5.337e-141
Identity = 281/813 (34.56%), Postives = 430/813 (52.89%), Query Frame = 1
Query:  100 QKAAPDQWEKSSFLDSTMAEF----EREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV-MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQ 2523
            ++  P Q +K SF     A+F    + +M +  M  +M   E Q+  +T +LD +  Q E+ +K   KE+   HIP E +  G+N                             ++ LD      +  H + A++STL+ D+L K T++I  D   W+S+++RF  S+  +H    +G + +C++AL  +YPKY +EG+ +LYSRPPVIYI+SAA   L +YL + LGLP  SI  VP +   G    MD  +LE+LI  D+SA K P+++  FAGSP+ GS+DHL+E+  +C+ HKIWLH+EG  LA LA + +P  V   +S   S+TL +G W+GIP +P+ TL  +         L   AG    N  + +   P+W+ LQ +G+DGI  RI+     +E++++ L++I +++ I   K                 EA  IK ++   +  L         IVF+Y    V    T    G +     S  +P  D+          E  K + Y ++LN WL D L      +++++I + +EG+C++    +    +    ED+ KF E++K  I I+D+TV +R  F  +V A+D L +V++P+WAGLG V ++PE  RE +  L  +N+  +                 INNIN  L+  L + D AFSLG        + E+ G       CV+FGLIT  + +E+L+  V +   + EESSK LEKLS+ V+ GI    K+L +E +EK+ QEG+ RQVP + SLLNWWSPP K  + GR+ +LSSG +  TE  YKY MQ+Q
Sbjct:   30 EEEKPKQPKKVSF-----AQFDPDAQMQMNSMFMSPMMKELEAQIKVNTDMLDRMNKQMEDERKARLKEKQTAHIP-EALKGGLN----------------------------KLQILDTHSKAALTGHSLAAYVSTLDEDNLKKFTSKITQDCQLWLSRLFRFPDSSPFYHEEHKDGLVKICRMALYQKYPKYPVEGFEALYSRPPVIYISSAAMPGLSNYLCLQLGLPLSSICNVPCSTVNGTTSIMDVGMLEKLIQDDVSAAKTPVLLVGFAGSPHLGSVDHLDELRKICKNHKIWLHVEGNNLALLATVSIPNSVEPATSG-DSMTLRLGKWIGIPGLPFITLYKSSD-----PALELAAGLSTFNPQLKLNCLPLWIVLQSLGHDGIVDRIKHCCNLAEKMHEILEKIPTIQKIGEEKK-------------EESEAKTIKEMIFVAIDALFVFKMASPTIVFKY----VEDNST----GAVEIAPYSPVSPQEDI---------EEKDKLKTYYNALNTWLCDTLFYENSSVDIELIDVENEGSCIKFSPLDTAQVKGTVIEDIEKFGENLKKQIAILDATVLQRDRFCAVVEAQDNLRIVEMPSWAGLGVVQYMPEEWRERMTDL-PDNAKRD-----------------INNINTELVKRLHSKDTAFSLGF-------NDENIG-------CVKFGLITDDTDLEELIGLVYSVGKEIEESSKFLEKLSEKVQKGIEEANKELHKEMDEKLMQEGLLRQVPLVSSLLNWWSPPPKDSVKGRTFSLSSGTMASTEKTYKYHMQIQ 740          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Match: A0A433TE60 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_012404 PE=4 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.861e-137
Identity = 259/789 (32.83%), Postives = 416/789 (52.72%), Query Frame = 1
Query:  181 SMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDD--EKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSV-MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGPNS 2538
            S M  +    EK + +   LLD + +  E  +KQ  ++    HIP  L   G     + Q V + +     +D  E+   N +A ++ LD      + +H + A  STL    L++  +++ SD   W+S+++RF+ S  ++H+  Y G   + ++AL  RYPKY  EG+ +LYSRPPVIY+++AA   L  YL   LGLP     LVP N   G    MD  +LE+LI  DI++ K P+++ A+AG+P  G +D+L+ +  + + + IWLH+EG  LA L +  VP  V +  S   S+TLD+  WLG+P++PY TL      ++    L   AG    +  + +   P+WM LQ +G++G+ +R++ +S  ++ +++ L +++++K ISR         +++ P R   E   +K+L+   +S LL    V   +VF+Y   S            +                   R  DS   K  +Y D+LN WL + L A+ P++ + ++ +  EG C+R    E    +    EDV +FVES++ ++ ++++T  +R  F+ IV +   L L+DL +WAGLG V ++PE            +   E  ++  E I       +INN+N  L+ +L+  D AFS G         S+D       + CVRFGL+T  + +E+LV  V     + EESSK LE +S++++ GI    K+L +E  EK+  EG+ RQVP + SLLNW+S P+K Q+ GR+ NL+SG+I  T D YKY MQL    NS
Sbjct:   46 SFMDPMTQELEKNVAKTNALLDKISNDMETERKQRFRKILQSHIPEALQGGGKKEEDVMQLVDQLIFYEEVEDGKEEVQINEQAQLQELDETGRLTVTAHSLAAHFSTLEPSALDRAASKLDSDCRLWLSRLFRFKDSVPVYHDKRYEGLAKIAQLALYTRYPKYATEGFEALYSRPPVIYVSTAAPPGLGQYLCQQLGLPRSCCCLVPCNTMFGASSKMDVALLEKLIEDDIASAKTPVLLVAYAGTPIVGHVDNLSRLQEISKANNIWLHVEGNNLATLTMFSVPTSVESALSG-DSITLDLSRWLGVPSLPYITLF-----KDSEQALTEAAGLTTVDARLQLKCLPLWMCLQSLGHEGMVTRVKASSDLAKILFEQLDKLSTIKQISR---------EKKKPER---EPRNVKDLISKAISALLVFEIVTPTVVFKYAEDSTAPGAVVAPYSSI-------------------RVEDSNQEKDAVYFDALNTWLAEALQASNPRVPIDLVEVDKEGVCIRYSPLETAQIRGTTREDVEQFVESLQSNLSVLNATTVQRKKFRTIVTSHTNLRLIDLDSWAGLGAVSYIPEV-----------HCGKEGDLTDKEKI-------EINNLNAELVHKLKAQDTAFSTGQ--------SQDG------IVCVRFGLVTSDTDVEELVSLVYGTGKEVEESSKFLETMSEVIRKGIEEANKELEKENTEKLMHEGVLRQVPVVSSLLNWFS-PSKEQVKGRTFNLTSGKIIPTVDTYKYHMQLHEENNS 764          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Match: pdxdc1 (pyridoxal dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:103041694])

HSP 1 Score: 326.635 bits (836), Expect = 8.616e-99
Identity = 227/799 (28.41%), Postives = 384/799 (48.06%), Query Frame = 1
Query:  139 LDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKM---ISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            +D T+AE    + ++M  K++++ + +  E T             +++L+     + IP  L  +G N   + Q V   +     DDE    +R+  M+ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G + VC++ +  RY  Y  EG+  L  + PVIY +++    L  +L   LGLP  S+ +VP N   G    MD  +L++LI  D+  GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L Q+ + V T ++K  S+TL  G WLG+PAVP  TL     +E+    L   AG   S     +   P+W++LQ +G+DGI  RI  ++  S+ + + LK +TS+K    +SR + P    V   +             L   +LS + D    P V+VFR+            D    +     E    GD  ++                DSLN+WL + L+   P   + ++ L  EG C+R            +  DV+  VE +   + ++  T+  R  F++ V     L  ++  +W GLG V +              E+  T+        +       ++  IN  L+ +LR  + D  FS G      P  SE+         C+  G+ T+   +  LVD + +   + EES K LE ++++V+ GI+     L +  EEK+ +EG+ RQ+P + S++NW+S P ++ + GR+ NL++G ++ T+ IY  K Q
Sbjct:    1 MDPTLAEMGSHLSDAM--KILESGQIETAEDT------------GRRRLS----WRDIPGPLQGDGQNVVTILQLVQNLM----HDDEDKQAHRR--MQYVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYENGSAYYHEDDREGLVKVCRLVINARYEDYATEGFTVLSVKQPVIYQSASCRPGLGQHLCSQLGLPLSSLCIVPCNTMFGSQHQMDIALLDKLIRDDVETGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNVWLHVEGVNLATLVLGQI-SSVVTAATKCDSMTLTPGPWLGLPAVPAVTLY---RHED--PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIRHSAHLSQTLLEQLKSLTSIKTSGSVSRSRVPPISGVSLRD------------VLGSLILSIVEDELSSP-VVVFRFSQ----------DTSSASSGGSVEGYFSGDREVQ----------------DSLNRWLGEQLALLVPTSGVDVVELEDEGVCVRFNPLMTAAALGTQESDVALLVEKLAEMVPVLSCTLRFRLDFREEVLQHACLSYIEDLSWPGLGAVRY--------------ESRRTD--------LEEGKRQQELEKINTELVKKLRELDTDLEFSTG------PEFSEERN-------CIFIGMATEDLDVAALVDTIASTGREVEESGKLLENMTEVVRKGILEAELQLQKASEEKLMEEGVLRQIPLVSSVVNWFS-PVQSSVKGRTFNLAAGSLDTTDPIYAMKAQ 694          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Match: pdxdc1 (pyridoxal dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:103041694])

HSP 1 Score: 322.783 bits (826), Expect = 1.914e-97
Identity = 226/796 (28.39%), Postives = 382/796 (47.99%), Query Frame = 1
Query:  139 LDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            +D T+AE    + ++M  K++++ + +  E T             +++L+     + IP  L  +G N   + Q V   +     DDE    +R+  M+ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G + VC++ +  RY  Y  EG+  L  + PVIY +++    L  +L   LGLP  S+ +VP N   G    MD  +L++LI  D+  GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L Q+ + V T ++K  S+TL  G WLG+PAVP  TL     +E+    L   AG   S     +   P+W++LQ +G+DGI  RI  ++  S+ + + LK +TS+K    I + ++            LEA          LS + D    P V+VFR+            D    +     E    GD  ++                DSLN+WL + L+   P   + ++ L  EG C+R            +  DV+  VE +   + ++  T+  R  F++ V     L  ++  +W GLG V +              E+  T+        +       ++  IN  L+ +LR  + D  FS G      P  SE+         C+  G+ T+   +  LVD + +   + EES K LE ++++V+ GI+     L +  EEK+ +EG+ RQ+P + S++NW+S P ++ + GR+ NL++G ++ T+ IY  K Q
Sbjct:    1 MDPTLAEMGSHLSDAM--KILESGQIETAEDT------------GRRRLS----WRDIPGPLQGDGQNVVTILQLVQNLM----HDDEDKQAHRR--MQYVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYENGSAYYHEDDREGLVKVCRLVINARYEDYATEGFTVLSVKQPVIYQSASCRPGLGQHLCSQLGLPLSSLCIVPCNTMFGSQHQMDIALLDKLIRDDVETGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNVWLHVEGVNLATLVLGQI-SSVVTAATKCDSMTLTPGPWLGLPAVPAVTLY---RHED--PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIRHSAHLSQTLLEQLKSLTSIKTSDVIDSEIS-----------LLEA----------LSMVEDELSSP-VVVFRFSQ----------DTSSASSGGSVEGYFSGDREVQ----------------DSLNRWLGEQLALLVPTSGVDVVELEDEGVCVRFNPLMTAAALGTQESDVALLVEKLAEMVPVLSCTLRFRLDFREEVLQHACLSYIEDLSWPGLGAVRY--------------ESRRTD--------LEEGKRQQELEKINTELVKKLRELDTDLEFSTG------PEFSEERN-------CIFIGMATEDLDVAALVDTIASTGREVEESGKLLENMTEVVRKGILEAELQLQKASEEKLMEEGVLRQIPLVSSVVNWFS-PVQSSVKGRTFNLAAGSLDTTDPIYAMKAQ 682          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Match: pdxdc1 (pyridoxal dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:103041694])

HSP 1 Score: 313.923 bits (803), Expect = 1.884e-94
Identity = 212/741 (28.61%), Postives = 349/741 (47.10%), Query Frame = 1
Query:  304 KHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            + IP  L  +G N   + Q V   +     DDE    +R+  M+ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G + VC++ +  RY  Y  EG+  L  + PVIY +++    L  +L   LGLP  S+ +VP N   G    MD  +L++LI  D+  GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L Q+ + V T ++K  S+TL  G WLG+PAVP  TL     +E+    L   AG   S     +   P+W++LQ +G+DGI  RI  ++  S+ + + LK +TS      IKT V   +                                  V+VFR+            D    +     E    GD  ++                DSLN+WL + L+   P   + ++ L  EG C+R            +  DV+  VE +   + ++  T+  R  F++ V     L  ++  +W GLG V +              E+  T+        +       ++  IN  L+ +LR  + D  FS G      P  SE+         C+  G+ T+   +  LVD + +   + EES K LE ++++V+ GI+     L +  EEK+ +EG+ RQ+P + S++NW+S P ++ + GR+ NL++G ++ T+ IY  K Q
Sbjct:   17 RDIPGPLQGDGQNVVTILQLVQNLM----HDDEDKQAHRR--MQYVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYENGSAYYHEDDREGLVKVCRLVINARYEDYATEGFTVLSVKQPVIYQSASCRPGLGQHLCSQLGLPLSSLCIVPCNTMFGSQHQMDIALLDKLIRDDVETGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNVWLHVEGVNLATLVLGQI-SSVVTAATKCDSMTLTPGPWLGLPAVPAVTLYR---HED--PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIRHSAHLSQTLLEQLKSLTS------IKTSVEDELSS-------------------------------PVVVFRFSQ----------DTSSASSGGSVEGYFSGDREVQ----------------DSLNRWLGEQLALLVPTSGVDVVELEDEGVCVRFNPLMTAAALGTQESDVALLVEKLAEMVPVLSCTLRFRLDFREEVLQHACLSYIEDLSWPGLGAVRY--------------ESRRTD--------LEEGKRQQELEKINTELVKKLRELDTDLEFSTG------PEFSEERN-------CIFIGMATEDLDVAALVDTIASTGREVEESGKLLENMTEVVRKGILEAELQLQKASEEKLMEEGVLRQIPLVSSVVNWFS-PVQSSVKGRTFNLAAGSLDTTDPIYAMKAQ 646          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Match: pdxdc1 (pyridoxal dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:103041694])

HSP 1 Score: 207.608 bits (527), Expect = 4.815e-56
Identity = 109/306 (35.62%), Postives = 173/306 (56.54%), Query Frame = 1
Query:  370 EFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNK-SVMGVFPIWMALQLMGYDGITSRIEKNS 1284
            + + N   DDE    +R   M+ +  Q +  +L H + A++S L+ D L KLT RI SDT+ W+ +++R+   ++ +H +   G + VC++ +  RY  Y  EG+  L  + PVIY +++    L  +L   LGLP  S+ +VP N   G    MD  +L++LI  D+  GK+PL++ A AG+P  G  D L+ +  LC ++ +WLH+EG+ LA L L Q+ + V T ++K  S+TL  G WLG+PAVP  TL     +E+    L   AG   S     +   P+W++LQ +G+DGI  RI  ++
Sbjct:   43 QLVQNLMHDDEDKQAHR---MQYVGEQGHMALLGHSLAAYISVLDRDRLRKLTTRILSDTTLWLCRLFRYENGSAYYHEDDREGLVKVCRLVINARYEDYATEGFTVLSVKQPVIYQSASCRPGLGQHLCSQLGLPLSSLCIVPCNTMFGSQHQMDIALLDKLIRDDVETGKLPLLLIANAGTPGAGHTDKLSRLKELCVQYNVWLHVEGVNLATLVLGQI-SSVVTAATKCDSMTLTPGPWLGLPAVPAVTLY---RHED--PALSLAAGLTSSQPVEKLRALPLWLSLQYLGHDGIVERIRHSA 339          

HSP 2 Score: 121.709 bits (304), Expect = 6.617e-28
Identity = 80/293 (27.30%), Postives = 140/293 (47.78%), Query Frame = 1
Query: 1645 DSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            DSLN+WL + L+   P   + ++ L  EG C+R            +  DV+  VE +   + ++  T+  R  F++ V     L  ++  +W GLG V +              E+  T+        +       ++  IN  L+ +LR  + D  FS G      P  SE+         C+  G+ T+   +  LVD + +   + EES K LE ++++V+ GI+     L +  EEK+ +EG+ RQ+P + S++NW+S P ++ + GR+ NL++G ++ T+ IY  K Q
Sbjct:  406 DSLNRWLGEQLALLVPTSGVDVVELEDEGVCVRFNPLMTAAALGTQESDVALLVEKLAEMVPVLSCTLRFRLDFREEVLQHACLSYIEDLSWPGLGAVRY--------------ESRRTD--------LEEGKRQQELEKINTELVKKLRELDTDLEFSTG------PEFSEERN-------CIFIGMATEDLDVAALVDTIASTGREVEESGKLLENMTEVVRKGILEAELQLQKASEEKLMEEGVLRQIPLVSSVVNWFS-PVQSSVKGRTFNLAAGSLDTTDPIYAMKAQ 662          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Match: zgc:163121 (glutamate decarboxylase 1-like [Source:NCBI gene;Acc:103030265])

HSP 1 Score: 60.4622 bits (145), Expect = 6.393e-9
Identity = 60/247 (24.29%), Postives = 108/247 (43.72%), Query Frame = 1
Query:  658 YPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATL-----LMTDMNE---NYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIK 1353
            +P+    G  +L   PP+    SA     +      LG+ S+++ +V  + E G    M P  LE  I    + G +P  + A AG+   G+ D LNEI ++C    +W+H++      L L +          +  S+T +    +G+P    A L     L+ + N+    YL +    +   Y   +KS+     + VF +W+  +  G +G  S+I    + +E +Y  LK  T  +++ + K
Sbjct:  246 FPEVKTAGMRAL---PPLALFTSAHSHYSIKKSAAVLGIGSENVIVVKCD-ERG---KMIPEELESSIRRAETKGLVPFYVNATAGTTVYGAFDPLNEIADICARCGLWMHVDAAWGGGLLLSRRHRMKLQGIDRASSITWNPHKMMGVPLQCSAILVRKKGLLQECNQLCAEYLFQPDKHYDVSYDTGDKSIQCGRHVDVFKLWLMWKAKGSEGFESQINHCLENAEYLYHKLKSRTDFQLVFQSK 485          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO28925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T539])

HSP 1 Score: 146.747 bits (369), Expect = 1.934e-38
Identity = 84/317 (26.50%), Postives = 155/317 (48.90%), Query Frame = 1
Query: 1645 DSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITE-LRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQ-SGPNSVFSIANVNPMEQANSSP 2589
            D++N+ L + L+   P + +++I +P EG CLR             S+ +  FV  +K  ++ MD+ +  +   +  +  ++ +V+ +    + +  ++  P+         + +  N E      +         ++ N+N+ ++ + +    E F+ G                   L C+ F  +  TS + +LV  +   A +  +SSK LE+++++V+ GI    KDL +E E ++ +EG+ RQVP + SL+NWWSPP K  I GR+ NLSSG ++ TE  YKY+MQ+Q    +  F+ +  N     N+SP
Sbjct:   62 DAMNRRLAEQLAVAEPSVAIEVIDIPKEGQCLRFSPLSTARVMGTTSDHIDNFVACLKEQVIFMDNILLAQLAVRSSLEGKEHVVITEADGPSTVASLMCFPQ---------YWQEKNVEKLTGAKKM--------ELQNLNKEVLAKVMETHPEVFTEGVTQTG--------------LLCINFNKVGSTSEVSELVGFLCTTAEELSDSSKFLEQMTEMVQKGIEAAQKDLVKESENRLIEEGVLRQVPIVSSLVNWWSPPPKDSIQGRTFNLSSGHLDTTEKTYKYRMQVQDEDADGSFTASTPNSKNPPNNSP 347          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO27933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7W3])

HSP 1 Score: 131.724 bits (330), Expect = 1.000e-34
Identity = 65/164 (39.63%), Postives = 98/164 (59.76%), Query Frame = 1
Query:  439 LDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAG-SPNT 927
            +D   +  + S  + A+LS L    + +L+  I SD S W++K++ +   ++ FH++ + G   VC++AL  +YPKYG EG+ +LY+RPPVIYI++AA   L  YL   LGLP  SI  VP N   G   + D    E+L   D+S GK PL++ A+AG  P+T
Sbjct:   38 MDQYTHASVTSCALAAYLSLLEEQQVKRLSACIRSDCSHWLAKMFGYDNGSASFHDSRWEGLTKVCRLALLVKYPKYGTEGFTALYTRPPVIYISTAAAHGLGPYLCSQLGLPQSSICKVPCNTVFGSRHTTDVAAFERLFHDDVSCGKTPLMLIAYAGIEPST 201          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO29227 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T485])

HSP 1 Score: 132.88 bits (333), Expect = 2.095e-34
Identity = 72/205 (35.12%), Postives = 109/205 (53.17%), Query Frame = 1
Query:  439 LDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAG-SPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNT 1050
            +D   +  + S  + A+LS L    + +L+  I SD S W++K++ +   ++ FH++ + G   VC++AL  +YPKYG EG+ +LY+RPPVIYI++AA   L  YL   LGLP  SI  VP N   G   + D    E+L   D+S GK PL++ A+AG  P+T              +H I+     L      +L  P  VN+
Sbjct:   83 MDQYTHASVTSCALAAYLSLLEEQQVKRLSACIRSDCSHWLAKMFGYDNGSASFHDSRWEGLTKVCRLALLVKYPKYGTEGFTALYTRPPVIYISTAAAHGLGPYLCSQLGLPQSSICKVPCNTVFGSRHTTDVAAFERLFHDDVSCGKTPLMLIAYAGIEPST--------------KHTIFPKGFFLACINCGVLACPCMVNS 273          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Match: pdxdc1 (pyridoxal dependent decarboxylase domain containing 1 [Source:NCBI gene;Acc:101155335])

HSP 1 Score: 310.457 bits (794), Expect = 7.046e-93
Identity = 213/740 (28.78%), Postives = 356/740 (48.11%), Query Frame = 1
Query:  310 IPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFG-AGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTF-QDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELR--NDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQ 2517
            IP  L  +G++ + L Q V   L     ++E+    R A    +  Q    +L H + A+ S L  + L KL+ R+ SD++ W+ +++R+   ++ FH +  +G + VC++ L  +Y +YG EGY +L +  PVIY ++A   +L  +L   LGLP  S+  VP N   G    MD  +LE+L+  D  AGK PL++ A AG+ + G  D L+ + ++C +  +WLH+EG+ LA LAL +V + V T +S+  S+TL  G WLG+PAVP  TL     +E+    L  G    RL  K  +   P+W++LQ +G++GIT +I   +  S+++ + LK + S                             IK L+E  L           V++F++   +   E  + D  DL+++ +                           +DS N+WL    +   P   + ++ L  EG C+R            + EDV + V +++  +  M STVT R  F ++       L  V+   WAGLG V + P+S         A+ S  +                ++  IN+ L+ +L+  + D  FS     V     +E NG        V  G++T+   + +LV  +     + EES + LE ++++VK GI+    +L R  EEK+ +EG+ RQ+P + S+LNW S P ++ + GR+ +L++G ++ TE +Y  K Q
Sbjct:   42 IPGPLQGDGLDVSSLLQVVQHLLHEEEEEEEEEEEPRPARRLGVGVQDQVTLLGHSLAAYFSVLQRERLRKLSTRVLSDSTLWLCRLFRYENGSAYFHEDDRDGIVKVCRLVLHAQYKEYGAEGYGALSAHQPVIYQSAAGRPELGQHLCSQLGLPLSSLCTVPCNTVFGSQHQMDVALLEKLLKEDTDAGKRPLLLIANAGTYSAGHTDKLSRLKDVCDQSGLWLHVEGVNLATLALEEVASTV-TAASRSDSLTLTPGPWLGLPAVPAVTLY---RHEDPAMALAAGLTSSRLVEK--LRALPLWLSLQHLGHNGITQKIRHAAALSQQLLQRLKSLDS-----------------------------IKTLVEDELD--------SPVVLFKFCLETSSGEECRQDSVDLHQKNL---------------------------LDSFNRWLGQQAARRVPGSGVDVVELDGEGVCIRFSPLLTAAELGTQGEDVERLVATLQELVPAMTSTVTYRAAFWEETRRLASSLTYVEEMNWAGLGVVRYEPQSDE-------ADGSRRQ---------------QQLEKINKELLKKLQELDSDIVFSSAPEFV-----AEKNG--------VFVGMVTEDVAVAELVQTIAALGREVEESGRLLENMTEVVKKGILEAELELQRASEEKLLEEGMLRQIPVVGSVLNWLS-PVQSSVKGRTFDLAAGSLDSTETMYSTKAQ 675          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 56.6102 bits (135), Expect = 8.037e-8
Identity = 59/254 (23.23%), Postives = 108/254 (42.52%), Query Frame = 1
Query:  628 NVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPA-KVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            N+  V +A RY  +       + + P ++   S      +      LG  +D++ L+  + E G    + P  LE  IL     G +PL + A AGS   G+ D +NEI ++C ++ +WLH++G     L + +    K+N +  +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I+K    S+ +Y  +      +M+
Sbjct:  226 NMYSVMIA-RYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTDNVILLSTD-ERG---RVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGV-ERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMV 473          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 56.6102 bits (135), Expect = 8.717e-8
Identity = 59/254 (23.23%), Postives = 108/254 (42.52%), Query Frame = 1
Query:  628 NVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPA-KVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            N+  V +A RY  +       + + P ++   S      +      LG  +D++ L+  + E G    + P  LE  IL     G +PL + A AGS   G+ D +NEI ++C ++ +WLH++G     L + +    K+N +  +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I+K    S+ +Y  +      +M+
Sbjct:  245 NMYSVMIA-RYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTDNVILLSTD-ERG---RVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGV-ERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMV 492          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Match: GAD1 (glutamate decarboxylase 1 [Source:NCBI gene;Acc:101168897])

HSP 1 Score: 55.8398 bits (133), Expect = 1.170e-7
Identity = 59/254 (23.23%), Postives = 108/254 (42.52%), Query Frame = 1
Query:  628 NVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPA-KVNTISSKVKSVTLDIGSWLGIPAVPYATLL--------MTDMNENYLNK--LGFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            N+  V +A RY  +       + + P ++   S      +      LG  +D++ L+  + E G    + P  LE  IL     G +PL + A AGS   G+ D +NEI ++C ++ +WLH++G     L + +    K+N +  +  SVT +    +G+P    A L+           M   YL +    +   Y   +K++     + +F  W+  +  G  G    I+K    S+ +Y  +      +M+
Sbjct:   44 NMYSVMIA-RYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTDNVILLSTD-ERG---RVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLHVDGAWGGGLLMSRKHRHKLNGV-ERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLYNKINNREGFQMV 291          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Match: gad2 (glutamate decarboxylase 2 [Source:NCBI gene;Acc:101169246])

HSP 1 Score: 55.0694 bits (131), Expect = 3.038e-7
Identity = 58/261 (22.22%), Postives = 115/261 (44.06%), Query Frame = 1
Query:  604 NNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATL-----LMTDMNENYLNKL-----GFGAGYRLSNKSV-----MGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMI 1341
            +NMY   L   K+     +P+   +G +S+   P ++   S      +      LG+ ++S+  +  + E G    M P  LE+ IL     G +P  + A AG+   G+ D L  I ++C+++ IW+H++G     L + +          +  SVT +    + +P    A L     LM + N+ +   L      +   Y   +K++     + +F +W+  +  G  G  ++I++  + SE +Y  +K+    +M+
Sbjct:  247 SNMYAMLLARFKM-----FPEVKEKGMSSV---PRLVAFTSEHSHFSIKKGAAALGIGTESVICIKAD-ECG---KMIPADLERRILEAKQKGFVPFFVSATAGTTVYGAFDPLIAISDICKKYNIWMHVDGAWGGSLLMSRRHRWKLDGVERANSVTWNPHKMMSVPLQCSALLVREEGLMQNCNQMHACYLFQQDKQYDLSYDTGDKALQCGRHVDIFKLWLMWRAKGTIGFEAQIDRCLELSEYLYNKIKDRDGYEMV 495          
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000024587.1 (SMESG000024587.1)

HSP 1 Score: 1775.37 bits (4597), Expect = 0.000e+0
Identity = 855/858 (99.65%), Postives = 857/858 (99.88%), Query Frame = 1
Query:   22 MTSDNEHVSNGIKTVDDFCQVGESFCQKAAPDQWEKSSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGPNSVFSIANVNPMEQANSSPNI 2595
            MTSDNEHVSNGIKTVDDFCQVGESFCQKAAPDQWEKSSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSED+KTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEG CLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDH+INKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGPNSVFSIANVNPMEQANSSPNI
Sbjct:    1 MTSDNEHVSNGIKTVDDFCQVGESFCQKAAPDQWEKSSFLDSTMAEFEREMRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVELINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILSHGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNGFLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLGLPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSPNTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKSVTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFPIWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKSVKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEPTKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDNKTQLYIDSLNQWLTDNLSATFPQINLKMITLPSEGKCLRICFQENVIGQDIKSEDVSKFVESVKHHIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETVYSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLGHFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHIINKAHQFEESSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWWSPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGPNSVFSIANVNPMEQANSSPNI 858          
The following BLAST results are available for this feature:
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDXDC12.063e-9628.94pyridoxal dependent decarboxylase domain containin... [more]
PDXDC12.063e-9628.94pyridoxal dependent decarboxylase domain containin... [more]
PDXDC12.154e-9629.37pyridoxal dependent decarboxylase domain containin... [more]
PDXDC12.154e-9629.37pyridoxal dependent decarboxylase domain containin... [more]
PDXDC14.099e-9430.07pyridoxal dependent decarboxylase domain containin... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C14H10.31.770e-5825.35pep chromosome:WBcel235:X:10220673:10224289:-1 gen... [more]
C14H10.31.770e-5825.35pep chromosome:WBcel235:X:10220673:10224525:-1 gen... [more]
C14H10.31.770e-5825.35pep chromosome:WBcel235:X:10220644:10225161:-1 gen... [more]
C14H10.35.892e-5825.35pep chromosome:WBcel235:X:10220644:10228137:-1 gen... [more]
hdl-12.075e-634.38Probable aromatic-L-amino-acid decarboxylase [Sou... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG14861.969e-9128.20gene:FBgn0031174 transcript:FBtr0077190[more]
CG14861.969e-9128.20gene:FBgn0031174 transcript:FBtr0077191[more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdxdc11.723e-9628.50pyridoxal-dependent decarboxylase domain containin... [more]
pdxdc16.999e-9428.00pyridoxal-dependent decarboxylase domain containin... [more]
gad1a2.791e-821.84glutamate decarboxylase 1a [Source:ZFIN;Acc:ZDB-GE... [more]
gad1a3.300e-821.84glutamate decarboxylase 1a [Source:ZFIN;Acc:ZDB-GE... [more]
gad1b4.438e-722.40glutamate decarboxylase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDXDC13.389e-9529.23pyridoxal-dependent decarboxylase domain containin... [more]
PDXDC12.124e-6434.32pyridoxal-dependent decarboxylase domain containin... [more]
PDXDC12.861e-6134.36pyridoxal-dependent decarboxylase domain containin... [more]
PDXDC12.073e-6034.02pyridoxal-dependent decarboxylase domain containin... [more]
PDXDC12.425e-6034.28pyridoxal-dependent decarboxylase domain containin... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdxdc11.942e-9528.72pyridoxal-dependent decarboxylase domain containin... [more]
Pdxdc11.132e-9428.72pyridoxal-dependent decarboxylase domain containin... [more]
Pdxdc13.199e-6333.75pyridoxal-dependent decarboxylase domain containin... [more]
Pdxdc11.356e-5331.39pyridoxal-dependent decarboxylase domain containin... [more]
Gad26.800e-824.64glutamic acid decarboxylase 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P996|PDXD1_HUMAN1.034e-9529.37Pyridoxal-dependent decarboxylase domain-containin... [more]
sp|Q6DF78|PDXD1_XENLA1.847e-9529.31Pyridoxal-dependent decarboxylase domain-containin... [more]
sp|A7MBC2|PDXD1_BOVIN3.226e-9429.29Pyridoxal-dependent decarboxylase domain-containin... [more]
sp|Q99K01|PDXD1_MOUSE5.075e-9428.72Pyridoxal-dependent decarboxylase domain-containin... [more]
sp|Q66HY8|PDXD1_DANRE2.372e-9228.16Pyridoxal-dependent decarboxylase domain-containin... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JYW41.930e-14933.06putative pyridoxal-dependent decarboxylase domain-... [more]
A0A1S3K0021.237e-14732.67putative pyridoxal-dependent decarboxylase domain-... [more]
A0A1S3JZ923.566e-14232.49putative pyridoxal-dependent decarboxylase domain-... [more]
K1QGU35.337e-14134.56Pyridoxal-dependent decarboxylase domain-containin... [more]
A0A433TE602.861e-13732.83Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdxdc18.616e-9928.41pyridoxal dependent decarboxylase domain containin... [more]
pdxdc11.914e-9728.39pyridoxal dependent decarboxylase domain containin... [more]
pdxdc11.884e-9428.61pyridoxal dependent decarboxylase domain containin... [more]
pdxdc14.815e-5635.62pyridoxal dependent decarboxylase domain containin... [more]
zgc:1631216.393e-924.29glutamate decarboxylase 1-like [Source:NCBI gene;A... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO289251.934e-3826.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279331.000e-3439.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292272.095e-3435.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdxdc17.046e-9328.78pyridoxal dependent decarboxylase domain containin... [more]
GAD18.037e-823.23glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
GAD18.717e-823.23glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
GAD11.170e-723.23glutamate decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
gad23.038e-722.22glutamate decarboxylase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Pyridoxal-dependent decarboxylase domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000024587.10.000e+099.65SMESG000024587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006254 ID=SMED30006254|Name=Pyridoxal-dependent decarboxylase domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2609bp
ATATAAATCTTATATGATAAAATGACATCTGATAATGAACATGTATCAAA
TGGCATTAAAACTGTCGATGATTTTTGTCAAGTTGGTGAAAGCTTTTGCC
AAAAGGCTGCCCCAGACCAATGGGAAAAATCTTCCTTTTTAGATTCGACA
ATGGCCGAATTTGAAAGAGAAATGAGAAATTCAATGATGGGAAAAGTGAT
GGATAATTTCGAAAAACAAATGCTAGAGCACACAAAATTGCTTGATGATT
TGAAGCATCAACAGGAAGAATCCCAGAAACAGTTGAATAAAGAGCGATAT
TTAAAACACATTCCGGTGGAATTAATAAACGAGGGAGTAAATTCGGCAGT
TCTATGGCAGAAAGTTCATGAATTCCTTACAAATCCTAATTTCGACGATG
AAAAGACAATAACTAACAGGAAAGCAAATATGAAGTGCCTCGATCCTCAA
ATATATCAGATCATTTTGTCTCACGGAATCGGTGCTTGGCTCTCGACCTT
GAATATAGATCATTTAAACAAGCTCACTAATCGTATTTATTCAGATACAT
CACAATGGATTTCGAAAATCTGGAGGTTTCGATGTTCAACATCTCTATTC
CATAACAATATGTATAATGGCTTTCTAAATGTTTGCAAGGTTGCCTTAGC
TGATCGGTATCCGAAGTACGGTTTAGAGGGATATAATTCCCTTTATTCTC
GTCCACCAGTTATTTATATCAACAGCGCTGCCGACTCTCAGCTTGTGGAT
TATCTAAGAATAAATCTCGGTCTTCCTTCTGACTCTATAAGTTTAGTTCC
CAATAATTTTGAGTTGGGAGGAGATGAATCTATGGATCCTTTAATTCTCG
AACAACTAATATTAGGAGATATTTCAGCTGGCAAAATGCCATTAATTATT
TATGCCTTTGCTGGATCTCCAAACACCGGGAGCATGGATCACCTTAATGA
AATCCATAACTTGTGTCGAGAACACAAAATTTGGCTACATATGGAAGGAT
TACGACTTGCTCAACTGGCTCTATTGCAAGTGCCGGCCAAGGTCAACACA
ATCAGCTCCAAAGTAAAAAGTGTCACATTGGATATTGGTTCATGGCTTGG
GATTCCTGCCGTTCCGTATGCTACGCTACTCATGACAGATATGAACGAAA
ATTATCTGAATAAACTGGGATTTGGAGCCGGTTACAGACTGAGTAACAAA
TCTGTCATGGGAGTCTTTCCGATTTGGATGGCTCTCCAATTGATGGGTTA
CGATGGTATAACTTCTAGAATCGAAAAGAACTCAAAGACTAGTGAGGAGG
TATACAAATCGTTAAAGGAAATCACAAGTCTGAAAATGATATCCCGGATC
AAGACTCCCGTCAACAAATCAGTAAAACAAGAAAACCCAAATAGAATAAC
TCTAGAAGCGAATGGCATTAAAAATCTCATGGAAACTGTCCTGTCATTTC
TTCTTGATGGTTATCAAGTGCCATCAGTAATAGTTTTCCGATATGATCCG
CCATCTGTCCCCTCTGAACCGACCAAACTCGATTGCGGTGATCTCAACAA
GCGCATCATTAGCGAGAATAACCCGGATGGTGATTTGTTGATCAAGAAGC
CTCGGTTCATCGATTCCGAGGACAGCAAAACGCAATTATACATTGATTCT
TTAAACCAATGGTTGACTGACAATTTGTCAGCGACATTTCCTCAAATAAA
TCTGAAGATGATTACCCTACCATCAGAGGGGACATGTTTGCGTATTTGTT
TCCAGGAGAATGTCATTGGGCAGGACATCAAATCGGAGGACGTGAGCAAA
TTCGTGGAAAGTGTTAAACATCACATTATGATAATGGATTCGACAGTGAC
AAGACGCCCGACATTCCAGGACATAGTTGCAGCTAGAGATGAGTTGGTAC
TGGTTGATCTACCGGCCTGGGCGGGTCTCGGTTGCGTTCTGTTTCTTCCA
GAATCGTGCCGGGAAACCGTTTACAGTCTTTTTGCAGAGAATTCAAACAC
GGAATATTATATGAGCTTCTTGGAATTTATAGCTTCGTCTCCGTATCTAA
ATAAAATAAACAACATTAATCGCAGTCTAATTACAGAGCTACGAAATGAC
GATGAGGCATTTTCTCTAGGACATTTTCATGTAGATTTTCCTTGTGATTC
TGAGGATAATGGCAGAGAAATTGTCACTTTATTCTGTGTCAGATTCGGTC
TTATAACTCAAACGTCTGTCATTGAACAGTTGGTTGATCATGTAATCAAT
AAGGCTCATCAATTCGAAGAATCATCGAAGAACTTGGAAAAATTATCACA
GCTCGTAAAAGATGGTATAGTTCGAGTAACCAAAGATTTGGCTCGTGAAC
AGGAAGAAAAAGTCAAACAGGAAGGAATATTTAGACAAGTCCCATACATT
GACTCACTTTTAAATTGGTGGTCTCCACCAGCTAAAACACAAATAATAGG
AAGGAGTTTAAATTTATCTTCGGGAGAAATAAATGACACTGAAGACATAT
ACAAATACAAAATGCAGCTACAATCAGGCCCGAATTCTGTGTTCTCCATT
GCAAATGTCAATCCAATGGAGCAAGCAAATTCTTCACCAAATATCTAAAT
TATTATTAT
back to top

protein sequence of SMED30006254-orf-1

>SMED30006254-orf-1 ID=SMED30006254-orf-1|Name=SMED30006254-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=859bp
MTSDNEHVSNGIKTVDDFCQVGESFCQKAAPDQWEKSSFLDSTMAEFERE
MRNSMMGKVMDNFEKQMLEHTKLLDDLKHQQEESQKQLNKERYLKHIPVE
LINEGVNSAVLWQKVHEFLTNPNFDDEKTITNRKANMKCLDPQIYQIILS
HGIGAWLSTLNIDHLNKLTNRIYSDTSQWISKIWRFRCSTSLFHNNMYNG
FLNVCKVALADRYPKYGLEGYNSLYSRPPVIYINSAADSQLVDYLRINLG
LPSDSISLVPNNFELGGDESMDPLILEQLILGDISAGKMPLIIYAFAGSP
NTGSMDHLNEIHNLCREHKIWLHMEGLRLAQLALLQVPAKVNTISSKVKS
VTLDIGSWLGIPAVPYATLLMTDMNENYLNKLGFGAGYRLSNKSVMGVFP
IWMALQLMGYDGITSRIEKNSKTSEEVYKSLKEITSLKMISRIKTPVNKS
VKQENPNRITLEANGIKNLMETVLSFLLDGYQVPSVIVFRYDPPSVPSEP
TKLDCGDLNKRIISENNPDGDLLIKKPRFIDSEDSKTQLYIDSLNQWLTD
NLSATFPQINLKMITLPSEGTCLRICFQENVIGQDIKSEDVSKFVESVKH
HIMIMDSTVTRRPTFQDIVAARDELVLVDLPAWAGLGCVLFLPESCRETV
YSLFAENSNTEYYMSFLEFIASSPYLNKINNINRSLITELRNDDEAFSLG
HFHVDFPCDSEDNGREIVTLFCVRFGLITQTSVIEQLVDHVINKAHQFEE
SSKNLEKLSQLVKDGIVRVTKDLAREQEEKVKQEGIFRQVPYIDSLLNWW
SPPAKTQIIGRSLNLSSGEINDTEDIYKYKMQLQSGPNSVFSIANVNPME
QANSSPNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR015421PyrdxlP-dep_Trfase_major
IPR002129PyrdxlP-dep_de-COase
IPR015424PyrdxlP-dep_Trfase
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0030170pyridoxal phosphate binding
GO:0016831carboxy-lyase activity
Vocabulary: biological process
TermDefinition
GO:0019752carboxylic acid metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 62..82
NoneNo IPR availablePANTHERPTHR42735:SF1PYRIDOXAL DEPENDENT DECARBOXYLASE DOMAIN CONTAINING 1coord: 52..838
NoneNo IPR availablePANTHERPTHR42735FAMILY NOT NAMEDcoord: 52..838
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 158..420
e-value: 3.4E-25
score: 90.5
IPR002129Pyridoxal phosphate-dependent decarboxylasePFAMPF00282Pyridoxal_deCcoord: 273..444
e-value: 4.0E-9
score: 35.7
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 169..582