Protein SERAC1

Overview
NameProtein SERAC1
Smed IDSMED30006241
Length (bp)1652
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein SERAC1 (SMED30006241) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein SERAC1 (SMED30006241) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein SERAC1 (SMED30006241) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein SERAC1 (SMED30006241) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006241

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006241SMESG000001897.1 dd_Smed_v4_7655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006241SMESG000001897.1 dd_Smed_v4_7655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein SERAC1 vs. Ensembl Human
Match: SERAC1 (serine active site containing 1 [Source:HGNC Symbol;Acc:HGNC:21061])

HSP 1 Score: 128.257 bits (321), Expect = 1.027e-30
Identity = 94/316 (29.75%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+ + L 
Sbjct:  299 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALA 606          
BLAST of Protein SERAC1 vs. Ensembl Human
Match: SERAC1 (serine active site containing 1 [Source:HGNC Symbol;Acc:HGNC:21061])

HSP 1 Score: 127.487 bits (319), Expect = 1.187e-30
Identity = 94/316 (29.75%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+ + L 
Sbjct:  254 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALA 561          
BLAST of Protein SERAC1 vs. Ensembl Human
Match: SERAC1 (serine active site containing 1 [Source:HGNC Symbol;Acc:HGNC:21061])

HSP 1 Score: 127.872 bits (320), Expect = 1.325e-30
Identity = 94/316 (29.75%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+ + L 
Sbjct:  312 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALA 619          
BLAST of Protein SERAC1 vs. Ensembl Human
Match: SERAC1 (serine active site containing 1 [Source:HGNC Symbol;Acc:HGNC:21061])

HSP 1 Score: 127.872 bits (320), Expect = 1.581e-30
Identity = 94/316 (29.75%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+ + L 
Sbjct:  342 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALA 649          
BLAST of Protein SERAC1 vs. Ensembl Human
Match: SERAC1 (serine active site containing 1 [Source:HGNC Symbol;Acc:HGNC:21061])

HSP 1 Score: 116.316 bits (290), Expect = 7.727e-27
Identity = 73/244 (29.92%), Postives = 124/244 (50.82%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFV 1344
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F 
Sbjct:  342 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFA 577          
BLAST of Protein SERAC1 vs. Ensembl Celegans
Match: F17H10.1 (pep chromosome:WBcel235:X:13105184:13108543:1 gene:WBGene00008925.1 transcript:F17H10.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F17H10.1)

HSP 1 Score: 102.064 bits (253), Expect = 8.386e-23
Identity = 77/252 (30.56%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  805 EIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRA-RVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            E  + DI+ I+G+ GSV +TWRQ D+    D +  + CWP+DWL + + +  R+IG+      F            +S++ R+++   +L+IA +G RP+L++ HS GG+L K +L   +  NL  +T G++F++TPH G+  +    Y  F+   T + + L  N+ +   LN+ F S V ++   I+++ ET  + I     +I+VP     F+      I   HL + KP   S   Y  ++NF+   L
Sbjct:  263 EEPEIDIVLIHGLRGSVAYTWRQKDS----DENLLSSCWPKDWLPLDIKKPFRIIGLEYPSYIF------HFTGTQQSLQTRSERFKEQLEIAGIGKRPVLFICHSMGGLLAKKLLI--DSTNLLKNTVGVLFIATPHKGS-PVANWGYSVFQP--TEDVRMLNENNAINRKLNEDF-SAVSKEIPVIVSMVETVESNIIANAKSIVVPNKSAVFEQGAVYHIADVHLNLCKPTRDSAS-YGVIINFLQDCL 497          
BLAST of Protein SERAC1 vs. Ensembl Celegans
Match: F17H10.1 (pep chromosome:WBcel235:X:13105241:13108543:1 gene:WBGene00008925.1 transcript:F17H10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F17H10.1)

HSP 1 Score: 102.064 bits (253), Expect = 8.386e-23
Identity = 77/252 (30.56%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  805 EIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRA-RVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            E  + DI+ I+G+ GSV +TWRQ D+    D +  + CWP+DWL + + +  R+IG+      F            +S++ R+++   +L+IA +G RP+L++ HS GG+L K +L   +  NL  +T G++F++TPH G+  +    Y  F+   T + + L  N+ +   LN+ F S V ++   I+++ ET  + I     +I+VP     F+      I   HL + KP   S   Y  ++NF+   L
Sbjct:  263 EEPEIDIVLIHGLRGSVAYTWRQKDS----DENLLSSCWPKDWLPLDIKKPFRIIGLEYPSYIF------HFTGTQQSLQTRSERFKEQLEIAGIGKRPVLFICHSMGGLLAKKLLI--DSTNLLKNTVGVLFIATPHKGS-PVANWGYSVFQP--TEDVRMLNENNAINRKLNEDF-SAVSKEIPVIVSMVETVESNIIANAKSIVVPNKSAVFEQGAVYHIADVHLNLCKPTRDSAS-YGVIINFLQDCL 497          
BLAST of Protein SERAC1 vs. Ensembl Fly
Match: CG10383 (gene:FBgn0032699 transcript:FBtr0089628)

HSP 1 Score: 87.0409 bits (214), Expect = 1.584e-17
Identity = 70/253 (27.67%), Postives = 120/253 (47.43%), Query Frame = 1
Query:  865 WRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNP----MSDIDKINRSIEDRAKQISNKLKIAQVGS-RPILWVTHSAGGILLKHILHLNEDN------NLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWF----KSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGD 1572
            WR  D      + E T CWP +WL    P +R++GI+       W+         +K    I+ RA  + +++  + VG+ RPI+W+ HS GG+L K IL  + D+       L  +TKGI+F+ TPH G  S +  +    +  L+P  E K +E NS  LL +++ F     + ++  K+  +           KF   I+  +   + D  +   +K +HL +SKP  +   +Y  +L+ + + +  R D
Sbjct:  495 WRNQDT-----SEEYTNCWPMEWLPDDYPDSRILGIDYTSAVTEWSANFTKYCPCEKGQGHIDVRANTLLDRISASDVGNDRPIVWIGHSMGGLLTKLILLKSLDSQEPKVQQLTKNTKGIVFLGTPHRG--SPIAKWKQHMQMILSPSIEVKEMEENSPKLLEMHRRFMGCLHTLLRHVKVVSVAEGSPTMLTSFKFPLRIVTEE-SSKIDFGDFYLLKDDHLSLSKPIYRQSFLYQRLLHVIREAIKERSD 739          

HSP 2 Score: 56.6102 bits (135), Expect = 4.661e-8
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  577 LSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNE 885
            L ++LAN+S   +++E          L  WQ+  ++ L +   K  +N+     NQ     YPP+V+ L            DI+F++G+LG V+ TWRQ D +
Sbjct:  278 LCKVLANMSLVPDAVEHFFTSGWVGALAEWQQCPDLRLQVISAKTMANLDHDDPNQ---CTYPPNVYPLHPRVRTRRKPKADIVFVHGLLGGVFITWRQRDRK 377          
BLAST of Protein SERAC1 vs. Ensembl Fly
Match: CG10383 (gene:FBgn0032699 transcript:FBtr0343117)

HSP 1 Score: 87.0409 bits (214), Expect = 1.584e-17
Identity = 70/253 (27.67%), Postives = 120/253 (47.43%), Query Frame = 1
Query:  865 WRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNP----MSDIDKINRSIEDRAKQISNKLKIAQVGS-RPILWVTHSAGGILLKHILHLNEDN------NLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWF----KSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGD 1572
            WR  D      + E T CWP +WL    P +R++GI+       W+         +K    I+ RA  + +++  + VG+ RPI+W+ HS GG+L K IL  + D+       L  +TKGI+F+ TPH G  S +  +    +  L+P  E K +E NS  LL +++ F     + ++  K+  +           KF   I+  +   + D  +   +K +HL +SKP  +   +Y  +L+ + + +  R D
Sbjct:  495 WRNQDT-----SEEYTNCWPMEWLPDDYPDSRILGIDYTSAVTEWSANFTKYCPCEKGQGHIDVRANTLLDRISASDVGNDRPIVWIGHSMGGLLTKLILLKSLDSQEPKVQQLTKNTKGIVFLGTPHRG--SPIAKWKQHMQMILSPSIEVKEMEENSPKLLEMHRRFMGCLHTLLRHVKVVSVAEGSPTMLTSFKFPLRIVTEE-SSKIDFGDFYLLKDDHLSLSKPIYRQSFLYQRLLHVIREAIKERSD 739          

HSP 2 Score: 56.6102 bits (135), Expect = 4.661e-8
Identity = 31/103 (30.10%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  577 LSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNE 885
            L ++LAN+S   +++E          L  WQ+  ++ L +   K  +N+     NQ     YPP+V+ L            DI+F++G+LG V+ TWRQ D +
Sbjct:  278 LCKVLANMSLVPDAVEHFFTSGWVGALAEWQQCPDLRLQVISAKTMANLDHDDPNQ---CTYPPNVYPLHPRVRTRRKPKADIVFVHGLLGGVFITWRQRDRK 377          
BLAST of Protein SERAC1 vs. Ensembl Fly
Match: CG5455 (gene:FBgn0039430 transcript:FBtr0085016)

HSP 1 Score: 71.633 bits (174), Expect = 8.254e-13
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  910 TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVG-SRPILWVTHSAGGILLKHILHLNEDNN------LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSF 1341
            +KCWP DWL +  P  RVI +N     ++W P+    +   S+  R+++++  L   +VG  RPI++V HS GG+ +K ++    ++       L  S +G  F S PH G  S L     P     + E   +E N++ LL+L++ F   
Sbjct:  468 SKCWPGDWLPLDCPGVRVIALNYTTDQYLWRPLWKSKEPRSSLIQRSREMAELLIQHRVGHGRPIIYVGHSKGGLFIKQLMVDAWESGRPAMTPLWRSARGCFFYSVPHRG--SHLASIKAPL-LSRSVELLEIEKNNKYLLDLHRRFAGL 615          
BLAST of Protein SERAC1 vs. Ensembl Fly
Match: CG5455 (gene:FBgn0039430 transcript:FBtr0085015)

HSP 1 Score: 71.633 bits (174), Expect = 8.254e-13
Identity = 46/151 (30.46%), Postives = 76/151 (50.33%), Query Frame = 1
Query:  910 TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVG-SRPILWVTHSAGGILLKHILHLNEDNN------LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSF 1341
            +KCWP DWL +  P  RVI +N     ++W P+    +   S+  R+++++  L   +VG  RPI++V HS GG+ +K ++    ++       L  S +G  F S PH G  S L     P     + E   +E N++ LL+L++ F   
Sbjct:  468 SKCWPGDWLPLDCPGVRVIALNYTTDQYLWRPLWKSKEPRSSLIQRSREMAELLIQHRVGHGRPIIYVGHSKGGLFIKQLMVDAWESGRPAMTPLWRSARGCFFYSVPHRG--SHLASIKAPL-LSRSVELLEIEKNNKYLLDLHRRFAGL 615          
BLAST of Protein SERAC1 vs. Ensembl Zebrafish
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:568022])

HSP 1 Score: 134.035 bits (336), Expect = 9.039e-33
Identity = 85/263 (32.32%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  820 DIIFINGMLGSVYFTWRQHDNECEIDTSEK--------TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNEDNNLAS---STKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNR 1566
            D++F++G+LG+ + TWRQ D  C++   EK        T+CWP+ WL+   P  R++ +        WN    ++   +S+  R++++  KLK A VG RP++WV HS GG+L+K  +L   +D +L+S   +TKGI+F S PH G  + +  Y    +Y L P  E K L  +S  L +LN+ F +  K+++ ++L+  ET PT I      ++VP    +    + +++  +HL I KP+ +   +Y   L F+   L  R
Sbjct:  397 DVLFVHGLLGAAFKTWRQKD--CDVTDDEKLEGVREDYTECWPKSWLAADCPNLRILSVEYDTHLSDWNSKCPVENQRKSLAFRSQELLRKLKDAGVGERPVIWVAHSMGGLLVKKMLLDAAKDPDLSSLIKNTKGILFYSVPHHG--TFMAEYSVSVRYLLFPSIEVKELCRDSPALRDLNENFLNIAKDREFKVLSFAETVPTYIGPMLKILVVPAHSADLGIGDLIQVDVDHLNICKPEKKDTFLYKRTLQFIQDALGGR 655          
BLAST of Protein SERAC1 vs. Ensembl Zebrafish
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:568022])

HSP 1 Score: 134.035 bits (336), Expect = 9.039e-33
Identity = 85/263 (32.32%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  820 DIIFINGMLGSVYFTWRQHDNECEIDTSEK--------TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNEDNNLAS---STKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNR 1566
            D++F++G+LG+ + TWRQ D  C++   EK        T+CWP+ WL+   P  R++ +        WN    ++   +S+  R++++  KLK A VG RP++WV HS GG+L+K  +L   +D +L+S   +TKGI+F S PH G  + +  Y    +Y L P  E K L  +S  L +LN+ F +  K+++ ++L+  ET PT I      ++VP    +    + +++  +HL I KP+ +   +Y   L F+   L  R
Sbjct:  397 DVLFVHGLLGAAFKTWRQKD--CDVTDDEKLEGVREDYTECWPKSWLAADCPNLRILSVEYDTHLSDWNSKCPVENQRKSLAFRSQELLRKLKDAGVGERPVIWVAHSMGGLLVKKMLLDAAKDPDLSSLIKNTKGILFYSVPHHG--TFMAEYSVSVRYLLFPSIEVKELCRDSPALRDLNENFLNIAKDREFKVLSFAETVPTYIGPMLKILVVPAHSADLGIGDLIQVDVDHLNICKPEKKDTFLYKRTLQFIQDALGGR 655          
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Match: SERAC1 (serine active site containing 1 [Source:NCBI gene;Acc:101730273])

HSP 1 Score: 145.206 bits (365), Expect = 8.851e-37
Identity = 105/328 (32.01%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  622 ELLNFECVNS----LLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTS-----EKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL---HLNED-NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            E L+ E V+S    +L    K   ++ + +  ++ +N+     N++    YP  +++L       +    DI+FI+G+LG+ + TWRQ D +  +D S     + T+CWP+ WL+   P  R++ I    +   W      D   +S++ R++ +  KLK A VG RPI+WV+HS GG+L+K +L     +ED  +L ++TKG+ F S PH G+Q  L  Y    +  L P  E K L T+S  L  LN  F  F K K  +I++  E  PT++ +     IVP    +    + + +  NHL I KPKS+   IY   L F+   L 
Sbjct:  225 ENLHSEIVDSGWIPILAEAMKSPYVIQSSHAARVLANLDRDSVNEK----YPDGIYVLHPQYRSSQPIRADILFIHGLLGAAFKTWRQQDRDEPLDESAALEDDYTECWPKSWLATDSPDLRILSIEYDTQLSDWKARCPADNNRKSLDYRSRNLLKKLKAAGVGERPIIWVSHSMGGLLVKKMLLKASQDEDMKDLVNNTKGVAFYSVPHHGSQ--LAEYSISARLLLFPSIEVKELSTDSPELKKLNDEFLQFSKNKDFKIISFAELLPTRVGRMMKLHIVPLESADLGIGKLIPVDVNHLNICKPKSKDSFIYQCTLQFIHDVLA 546          
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Match: SERAC1 (serine active site containing 1 [Source:NCBI gene;Acc:101730273])

HSP 1 Score: 145.591 bits (366), Expect = 9.519e-37
Identity = 105/328 (32.01%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  622 ELLNFECVNS----LLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTS-----EKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL---HLNED-NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            E L+ E V+S    +L    K   ++ + +  ++ +N+     N++    YP  +++L       +    DI+FI+G+LG+ + TWRQ D +  +D S     + T+CWP+ WL+   P  R++ I    +   W      D   +S++ R++ +  KLK A VG RPI+WV+HS GG+L+K +L     +ED  +L ++TKG+ F S PH G+Q  L  Y    +  L P  E K L T+S  L  LN  F  F K K  +I++  E  PT++ +     IVP    +    + + +  NHL I KPKS+   IY   L F+   L 
Sbjct:  262 ENLHSEIVDSGWIPILAEAMKSPYVIQSSHAARVLANLDRDSVNEK----YPDGIYVLHPQYRSSQPIRADILFIHGLLGAAFKTWRQQDRDEPLDESAALEDDYTECWPKSWLATDSPDLRILSIEYDTQLSDWKARCPADNNRKSLDYRSRNLLKKLKAAGVGERPIIWVSHSMGGLLVKKMLLKASQDEDMKDLVNNTKGVAFYSVPHHGSQ--LAEYSISARLLLFPSIEVKELSTDSPELKKLNDEFLQFSKNKDFKIISFAELLPTRVGRMMKLHIVPLESADLGIGKLIPVDVNHLNICKPKSKDSFIYQCTLQFIHDVLA 583          
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Match: SERAC1 (serine active site containing 1 [Source:NCBI gene;Acc:101730273])

HSP 1 Score: 145.206 bits (365), Expect = 1.390e-36
Identity = 105/328 (32.01%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  622 ELLNFECVNS----LLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTS-----EKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL---HLNED-NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            E L+ E V+S    +L    K   ++ + +  ++ +N+     N++    YP  +++L       +    DI+FI+G+LG+ + TWRQ D +  +D S     + T+CWP+ WL+   P  R++ I    +   W      D   +S++ R++ +  KLK A VG RPI+WV+HS GG+L+K +L     +ED  +L ++TKG+ F S PH G+Q  L  Y    +  L P  E K L T+S  L  LN  F  F K K  +I++  E  PT++ +     IVP    +    + + +  NHL I KPKS+   IY   L F+   L 
Sbjct:  292 ENLHSEIVDSGWIPILAEAMKSPYVIQSSHAARVLANLDRDSVNEK----YPDGIYVLHPQYRSSQPIRADILFIHGLLGAAFKTWRQQDRDEPLDESAALEDDYTECWPKSWLATDSPDLRILSIEYDTQLSDWKARCPADNNRKSLDYRSRNLLKKLKAAGVGERPIIWVSHSMGGLLVKKMLLKASQDEDMKDLVNNTKGVAFYSVPHHGSQ--LAEYSISARLLLFPSIEVKELSTDSPELKKLNDEFLQFSKNKDFKIISFAELLPTRVGRMMKLHIVPLESADLGIGKLIPVDVNHLNICKPKSKDSFIYQCTLQFIHDVLA 613          
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Match: SERAC1 (serine active site containing 1 [Source:NCBI gene;Acc:101730273])

HSP 1 Score: 145.591 bits (366), Expect = 1.550e-36
Identity = 105/328 (32.01%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  622 ELLNFECVNS----LLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTS-----EKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL---HLNED-NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            E L+ E V+S    +L    K   ++ + +  ++ +N+     N++    YP  +++L       +    DI+FI+G+LG+ + TWRQ D +  +D S     + T+CWP+ WL+   P  R++ I    +   W      D   +S++ R++ +  KLK A VG RPI+WV+HS GG+L+K +L     +ED  +L ++TKG+ F S PH G+Q  L  Y    +  L P  E K L T+S  L  LN  F  F K K  +I++  E  PT++ +     IVP    +    + + +  NHL I KPKS+   IY   L F+   L 
Sbjct:  330 ENLHSEIVDSGWIPILAEAMKSPYVIQSSHAARVLANLDRDSVNEK----YPDGIYVLHPQYRSSQPIRADILFIHGLLGAAFKTWRQQDRDEPLDESAALEDDYTECWPKSWLATDSPDLRILSIEYDTQLSDWKARCPADNNRKSLDYRSRNLLKKLKAAGVGERPIIWVSHSMGGLLVKKMLLKASQDEDMKDLVNNTKGVAFYSVPHHGSQ--LAEYSISARLLLFPSIEVKELSTDSPELKKLNDEFLQFSKNKDFKIISFAELLPTRVGRMMKLHIVPLESADLGIGKLIPVDVNHLNICKPKSKDSFIYQCTLQFIHDVLA 651          
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Match: SERAC1 (serine active site containing 1 [Source:NCBI gene;Acc:101730273])

HSP 1 Score: 145.206 bits (365), Expect = 1.632e-36
Identity = 105/328 (32.01%), Postives = 167/328 (50.91%), Query Frame = 1
Query:  622 ELLNFECVNS----LLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTS-----EKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL---HLNED-NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            E L+ E V+S    +L    K   ++ + +  ++ +N+     N++    YP  +++L       +    DI+FI+G+LG+ + TWRQ D +  +D S     + T+CWP+ WL+   P  R++ I    +   W      D   +S++ R++ +  KLK A VG RPI+WV+HS GG+L+K +L     +ED  +L ++TKG+ F S PH G+Q  L  Y    +  L P  E K L T+S  L  LN  F  F K K  +I++  E  PT++ +     IVP    +    + + +  NHL I KPKS+   IY   L F+   L 
Sbjct:  299 ENLHSEIVDSGWIPILAEAMKSPYVIQSSHAARVLANLDRDSVNEK----YPDGIYVLHPQYRSSQPIRADILFIHGLLGAAFKTWRQQDRDEPLDESAALEDDYTECWPKSWLATDSPDLRILSIEYDTQLSDWKARCPADNNRKSLDYRSRNLLKKLKAAGVGERPIIWVSHSMGGLLVKKMLLKASQDEDMKDLVNNTKGVAFYSVPHHGSQ--LAEYSISARLLLFPSIEVKELSTDSPELKKLNDEFLQFSKNKDFKIISFAELLPTRVGRMMKLHIVPLESADLGIGKLIPVDVNHLNICKPKSKDSFIYQCTLQFIHDVLA 620          
BLAST of Protein SERAC1 vs. Ensembl Mouse
Match: Serac1 (serine active site containing 1 [Source:MGI Symbol;Acc:MGI:2447813])

HSP 1 Score: 133.65 bits (335), Expect = 1.124e-32
Identity = 98/317 (30.91%), Postives = 160/317 (50.47%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNE------CEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVN 1563
            SL+    K S+I+   +  +  +N+   ++   EK  Y   V++L       +    D++FI+G++G+ + TWRQHD++        +D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++ +KL+ A VG RP++W++HS GG+L+K +L       E N L ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET+PT I       +VP    +    + + +  NHL I KPK++   +Y   L F+ +TL  
Sbjct:  312 SLMAEALKSSHIMEASHAARTLANLD--RETVGEK--YQDGVYVLHPQCRTSQPIKADVLFIHGLMGAAFKTWRQHDSQRALTESAVVDEDRYTTCWPKTWLAKDCPSLRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLSKLRAAGVGDRPMIWISHSMGGLLVKKMLLEASKKPELNALINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKTKDAFLYQRTLQFICETLAR 620          
BLAST of Protein SERAC1 vs. Ensembl Mouse
Match: Serac1 (serine active site containing 1 [Source:MGI Symbol;Acc:MGI:2447813])

HSP 1 Score: 133.265 bits (334), Expect = 1.866e-32
Identity = 98/317 (30.91%), Postives = 160/317 (50.47%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNE------CEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVN 1563
            SL+    K S+I+   +  +  +N+   ++   EK  Y   V++L       +    D++FI+G++G+ + TWRQHD++        +D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++ +KL+ A VG RP++W++HS GG+L+K +L       E N L ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET+PT I       +VP    +    + + +  NHL I KPK++   +Y   L F+ +TL  
Sbjct:  342 SLMAEALKSSHIMEASHAARTLANLD--RETVGEK--YQDGVYVLHPQCRTSQPIKADVLFIHGLMGAAFKTWRQHDSQRALTESAVVDEDRYTTCWPKTWLAKDCPSLRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLSKLRAAGVGDRPMIWISHSMGGLLVKKMLLEASKKPELNALINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKTKDAFLYQRTLQFICETLAR 650          
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Match: sp|Q5SNQ7|SRAC1_DANRE (Protein SERAC1 OS=Danio rerio OX=7955 GN=serac1 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.823e-32
Identity = 85/263 (32.32%), Postives = 143/263 (54.37%), Query Frame = 1
Query:  820 DIIFINGMLGSVYFTWRQHDNECEIDTSEK--------TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNEDNNLAS---STKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNR 1566
            D++F++G+LG+ + TWRQ D  C++   EK        T+CWP+ WL+   P  R++ +        WN    ++   +S+  R++++  KLK A VG RP++WV HS GG+L+K  +L   +D +L+S   +TKGI+F S PH G  + +  Y    +Y L P  E K L  +S  L +LN+ F +  K+++ ++L+  ET PT I      ++VP    +    + +++  +HL I KP+ +   +Y   L F+   L  R
Sbjct:  397 DVLFVHGLLGAAFKTWRQKD--CDVTDDEKLEGVREDYTECWPKSWLAADCPNLRILSVEYDTHLSDWNSKCPVENQRKSLAFRSQELLRKLKDAGVGERPVIWVAHSMGGLLVKKMLLDAAKDPDLSSLIKNTKGILFYSVPHHG--TFMAEYSVSVRYLLFPSIEVKELCRDSPALRDLNENFLNIAKDREFKVLSFAETVPTYIGPMLKILVVPAHSADLGIGDLIQVDVDHLNICKPEKKDTFLYKRTLQFIQDALGGR 655          
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Match: sp|Q3U213|SRAC1_MOUSE (Protein SERAC1 OS=Mus musculus OX=10090 GN=Serac1 PE=2 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.305e-31
Identity = 98/317 (30.91%), Postives = 160/317 (50.47%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNE------CEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVN 1563
            SL+    K S+I+   +  +  +N+   ++   EK  Y   V++L       +    D++FI+G++G+ + TWRQHD++        +D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++ +KL+ A VG RP++W++HS GG+L+K +L       E N L ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET+PT I       +VP    +    + + +  NHL I KPK++   +Y   L F+ +TL  
Sbjct:  342 SLMAEALKSSHIMEASHAARTLANLD--RETVGEK--YQDGVYVLHPQCRTSQPIKADVLFIHGLMGAAFKTWRQHDSQRALTESAVVDEDRYTTCWPKTWLAKDCPSLRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLSKLRAAGVGDRPMIWISHSMGGLLVKKMLLEASKKPELNALINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETQPTFIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKTKDAFLYQRTLQFICETLAR 650          
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Match: sp|Q96JX3|SRAC1_HUMAN (Protein SERAC1 OS=Homo sapiens OX=9606 GN=SERAC1 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.594e-30
Identity = 94/316 (29.75%), Postives = 157/316 (49.68%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            S++    K  +I+ + +  +I +N+   ++  +EK  Y   V++L       +    D++FI+G++G+ + TWRQ D+E  +      D    T CWP+ WL+   P  R+I +        W     +++  +SI  R+ ++  KL+ A VG RP++W++HS GG+L+K +L       E + + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L   ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+ + L 
Sbjct:  342 SIMAEAMKSPHIMESSHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSQPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEDEDRYTTCWPKTWLAKDCPALRIISVEYDTSLSDWRARCPMER--KSIAFRSNELLRKLRAAGVGDRPVVWISHSMGGLLVKKMLLEASTKPEMSTVINNTRGIIFYSVPHHG--SRLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLNFVETLPTYIGSMIKLHVVPVESADLGIGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIREALA 649          
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Match: sp|Q2TBM9|SRAC1_BOVIN (Protein SERAC1 OS=Bos taurus OX=9913 GN=SERAC1 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 9.044e-30
Identity = 86/259 (33.20%), Postives = 134/259 (51.74%), Query Frame = 1
Query:  820 DIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLV 1560
            D++FI+G++G+ + TWRQ DN+ ++      D ++ T CWP+ WL+   P  R+I +        W      ++  +SI  R+ ++  KL+ A VG RP++WV+HS GG+L+K +L       E N + ++T+GI+F S PH G  S L  Y    +Y L P  E K L  +S  L  L   F  F K+K  ++L+  ET PT I       +VP    +    + + +  NHL I KPK +   +Y   L F+   L 
Sbjct:  395 DVLFIHGLMGAAFKTWRQQDNDQDLTEKVSEDETKYTTCWPKSWLARDCPALRIISVEYDTSLSDWRARCPTER--KSIAFRSNELLRKLRAAGVGDRPVVWVSHSMGGLLVKKMLLEASKRPEMNTIINNTRGIIFYSVPHHG--SHLAEYSVNIRYLLFPSLEVKELSKDSPALKTLQDDFLEFAKDKNFQVLSFVETLPTYIGSMIKLHVVPLDSADLGLGDLIPVDVNHLNICKPKKKDAFLYQRTLQFIRDALA 649          
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Match: sp|Q95JR3|SRAC1_MACFA (Protein SERAC1 OS=Macaca fascicularis OX=9541 GN=SERAC1 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 5.973e-7
Identity = 30/115 (26.09%), Postives = 56/115 (48.70%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEI------DTSEKTKCWPRDWLSVALPRARVIGIN 975
            S++    K   I+   +  +I +N+   ++  +EK  Y   V++L            D++FI+G++G+ + TWRQ D+E  +      +    T CWP+ WL+   P  R+I + 
Sbjct:  342 SIMAEAMKSDRIMEASHAARILANLD--RETVQEK--YQDGVYVLHPQYRTSRPIKADVLFIHGLMGAAFKTWRQQDSEQAVIEKPMEEEDRYTTCWPKTWLAKDCPALRIISVE 452          
BLAST of Protein SERAC1 vs. TrEMBL
Match: A0A430QLP4 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0004959 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.295e-48
Identity = 93/205 (45.37%), Postives = 134/205 (65.37%), Query Frame = 1
Query:  565 ISMPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNI--------SELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHL 1155
            I + ++  LANISQ   S  L N+E +N L+  W+  +++ LNL  +KI  N+        S    +     IY PDV+ L+   NI E  D+DIIF+NGMLGSV++TWRQHD+    + ++ TKCWPRDWLS   P+AR+IG++  L+PFVW+ +  + K+ R++ +RA  I  +LK A+VG RPI+W+THSAGGIL+K +L L
Sbjct:  200 IHLLVANFLANISQHPSSSVLNNYEDINKLISLWKVSTSLHLNLFGSKIDHNLKIHSKIINSSCSDSLNSYPIYCPDVYNLNDSNNINEDYDFDIIFVNGMLGSVFYTWRQHDSMLANNATQYTKCWPRDWLSHRFPQARIIGVDTSLKPFVWHSICPLQKLRRTLNERAVDIMKQLKKAEVGRRPIIWITHSAGGILVKEMLRL 404          

HSP 2 Score: 100.138 bits (248), Expect = 2.710e-18
Identity = 57/125 (45.60%), Postives = 87/125 (69.60%), Query Frame = 1
Query: 1171 LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFV 1545
            LASST+ ++FMSTPH G QS+  LY  PF++ LTPEA  LE NS  LL+L+ WF  +    K++IL++ E+  T IN+F+S +IVP+   + +  + ++I S+HLYISKP + SD  Y ++++F+
Sbjct:  540 LASSTQAVVFMSTPHRGNQSVHTLYRRPFRWALTPEAIQLEKNSNYLLDLHVWFNLWAYSHKLQILSMVESRVTPINRFWSVLIVPEDVKDREMGKLVRIDSDHLYISKPMNPSDLSYTSIVHFI 664          
BLAST of Protein SERAC1 vs. TrEMBL
Match: A0A068YKI8 (Protein serac1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001049400 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 5.896e-48
Identity = 141/469 (30.06%), Postives = 205/469 (43.71%), Query Frame = 1
Query:  577 LSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKI------------------------------------------FSNISELKQNQR--EKKIYPPDVFLLDHHKNIL--EIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSE----------------------KTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPIL--------------------WVTHSAGGIL---------LKHI----------LHLNEDNNLASS-----------------------------------TKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
             +  LAN+S   E++  L+  C+ S L+ W    ++ L L  TKI                                          F ++S   QN+      IY PDVF LD   +         DIIF+NGMLGSV+ TWRQ D+ C  ++ E                      + +CWP+ WLS   P AR++GINA LRPFVWNP+   +K  R I+ RA+ I  +L +A VG RPI+                    W+  S+  +L         L H           LH NE  + ASS                                   TKGI+F+S PH G QSM+ LYYFP  + LTPEAK L+ N+  +++L+ WF  +V    +++L L E   T IN++YS  +V     + +  E + + +NH  I KP++Q D++YV V +F+ + +
Sbjct:  262 FASFLANLSLLPEAVATLSQPCLKSWLEMWSTSQDVRLQLLSTKIQHNLLAHKYLSSEHSDGVQGEEGNFGNSPDGKRSRFYLPSSTFHDVSTPSQNENLDPPVIYGPDVFKLDKRDDGPGSPPPKIDIIFVNGMLGSVFHTWRQRDS-CNAESEESLTESGDDSSSDIDKLSPSFPGQIRCWPQAWLSEEFPEARILGINANLRPFVWNPICPAEKTKRRIDQRARDILQQLLLAGVGRRPIVWVAHSAGGILTKEVLKLSATWIPESSATVLSHYEESSDSLLHATDFAVSVAQNLHANEYVDPASSDTALLDCGFGGRVNVATIAMDSAVDMEVPTAVAHQTKGIIFLSVPHRGNQSMMFLYYFPMVFTLTPEAKQLQQNNASIISLHNWFLEWVSNCPLQVLNLVEDRETVINRWYSVHLVQPEPQDTEFSEVVLVDTNHTDICKPRNQQDEVYVRVTSFIRRLM 729          
BLAST of Protein SERAC1 vs. TrEMBL
Match: A0A094ZQM7 (Protein SERAC1 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_03557 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 7.995e-48
Identity = 93/205 (45.37%), Postives = 134/205 (65.37%), Query Frame = 1
Query:  565 ISMPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNI--------SELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHL 1155
            I + ++  LANISQ   S  L N+E +N L+  W+  +++ LNL  +KI  N+        S    +     IY PDV+ L+   NI E  D+DIIF+NGMLGSV++TWRQHD+    + ++ TKCWPRDWLS   P+AR+IG++  L+PFVW+ +  + K+ R++ +RA  I  +LK A+VG RPI+W+THSAGGIL+K +L L
Sbjct:  290 IHLLVANFLANISQHPSSSVLNNYEDINKLISLWKVSTSLHLNLFGSKIDHNLKIHSKIIDSSCSDSLNSYPIYCPDVYNLNDSNNINEDYDFDIIFVNGMLGSVFYTWRQHDSMLANNATQYTKCWPRDWLSHRFPQARIIGVDTSLKPFVWHSICPLQKLRRTLNERAVDIMKQLKKAEVGRRPIIWITHSAGGILVKEMLRL 494          

HSP 2 Score: 101.293 bits (251), Expect = 1.107e-18
Identity = 58/125 (46.40%), Postives = 87/125 (69.60%), Query Frame = 1
Query: 1171 LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFV 1545
            LASST+ ++FMSTPH G QS+  LY  PF++ LTPEA  LE NS  LL+L+ WF  +    K++IL++ E+  T IN+F+S +IVP+   + +  + ++I S+HLYISKP + SD  Y +++NF+
Sbjct:  630 LASSTQAVVFMSTPHRGNQSVHTLYRRPFRWALTPEAIQLEKNSNYLLDLHVWFNLWAYSHKLQILSMVESRVTPINRFWSVLIVPEDVKDREMGKLVRIDSDHLYISKPMNLSDLSYTSIVNFI 754          
BLAST of Protein SERAC1 vs. TrEMBL
Match: A0A183LDE5 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS1820 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.806e-47
Identity = 92/205 (44.88%), Postives = 134/205 (65.37%), Query Frame = 1
Query:  565 ISMPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNI--------SELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHL 1155
            I + ++  LANISQ   S  L N+E +N L+  W+  +++ LNL  +KI  N+        +    +     IY PDV+ L+   NI E  D+DIIF+NGMLGSV++TWRQHD+    + ++ TKCWPRDWLS   P+AR+IG++  L+PFVW+ +  + K+ R++ +RA  I  +LK A+VG RPI+W+THSAGGIL+K +L L
Sbjct:  282 IHLLVANFLANISQHPSSSVLNNYEDINKLINLWKVSTSLHLNLFGSKIDHNLKIHSKIIDTSCSDSLNSYPIYCPDVYNLNDSNNINEDYDFDIIFVNGMLGSVFYTWRQHDSMLNNNATQYTKCWPRDWLSHRFPQARIIGVDTSLKPFVWHSICPLQKLRRTLNERAVDIMKQLKKAEVGHRPIIWITHSAGGILVKEMLRL 486          

HSP 2 Score: 102.449 bits (254), Expect = 5.924e-19
Identity = 59/125 (47.20%), Postives = 87/125 (69.60%), Query Frame = 1
Query: 1171 LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFV 1545
            LASST+ I+FMSTPH G QS+  LY  PF++ LTPEA  LE NS  LL+L+ WF  +    K++IL++ E+  T IN+F+S +IVP+   + +  + ++I S+HLYISKP + SD  Y +++NF+
Sbjct:  625 LASSTQAIVFMSTPHRGNQSVHTLYRRPFRWALTPEAIQLEKNSNYLLDLHVWFNLWAYSHKVQILSMVESRVTPINRFWSVLIVPEDVKDREMGKLVRIDSDHLYISKPMNPSDLSYTSIVNFI 749          
BLAST of Protein SERAC1 vs. TrEMBL
Match: G4VGU6 (Putative ribonuclease p/mrp subunit OS=Schistosoma mansoni OX=6183 GN=Smp_029160 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.139e-46
Identity = 91/205 (44.39%), Postives = 133/205 (64.88%), Query Frame = 1
Query:  565 ISMPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNI--------SELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHL 1155
            I + ++  LANISQ   S  L N+E +N L+  W+  +++ LNL  +KI  N+             +     IY PDV+ L+   +I E  D+DIIF+NGMLGSV++TWRQHD+    + ++ TKCWPRDWLS   P+AR+IG++  L+PFVW+ +  + K+ R+++ RA  I  +LK A+VG RPI+W+THSAGGIL+K +L L
Sbjct:  135 IHLLVANFLANISQHPSSSVLNNYEDINKLISLWKVSASLHLNLFGSKIDHNLKIHSKITDGSCSDSLNSYPIYCPDVYNLNDSNDINENYDFDIIFVNGMLGSVFYTWRQHDSMLTNNPTQYTKCWPRDWLSHRFPQARIIGVDTSLKPFVWHSICPLQKLRRTLDKRAVDIMKQLKKAEVGCRPIIWITHSAGGILVKEMLRL 339          

HSP 2 Score: 99.3673 bits (246), Expect = 4.046e-18
Identity = 56/125 (44.80%), Postives = 87/125 (69.60%), Query Frame = 1
Query: 1171 LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFV 1545
            LAS+T+ ++FMSTPH G QS+  LY  PF++ LTPEA  LE +S  LL+L+ WF  +    K++IL++ E+  T IN+F+S +IVP+   + +  + ++I S+HLYISKP + SD  Y +++NF+
Sbjct:  478 LASNTQAVVFMSTPHRGNQSVHTLYRRPFRWALTPEAIQLEKDSNYLLDLHVWFNLWAYNHKVQILSMAESRVTPINRFWSVLIVPEDVKDREMGKLVRIDSDHLYISKPMNPSDLSYTSIVNFI 602          
BLAST of Protein SERAC1 vs. Ensembl Cavefish
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:103044342])

HSP 1 Score: 129.798 bits (325), Expect = 1.952e-31
Identity = 91/317 (28.71%), Postives = 160/317 (50.47%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEK--------TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHIL----HLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            S+L    +  +I+   +  +  +N+    + Q+    Y   V++L  H    +    DI+F++G+LG+ + TWRQ D  C++   EK        T+CWP+ WL+   P  R++ +        W     ++   +S+  R+ ++  KLK A VG RP++WV HS GG+L+K +L       E + L  +TKG++F S PH G  + +  Y    +Y L P  E K L  +S  L +LN+ F +  K+++ ++L+  ET+PT +       +VP    +    + +K+  +HL I KP+ +   +Y   L F+  +L
Sbjct:  327 SVLAEMVQSPHIMQASHAARALANLDRDTEVQK----YQDGVYVLHPHCRTNQPIKADILFVHGLLGAAFKTWRQKD--CDLTEDEKSVGVREDYTECWPKSWLAADCPNLRILSVEYDTHLSDWRAKCPVENQRKSLVYRSGELLKKLKAAGVGERPVIWVAHSMGGLLVKKMLLDASKDPELSPLVKNTKGVLFYSVPHFG--TFMAEYSVNVRYLLFPSIEVKELCRDSPALRDLNENFINIAKDQEFKVLSFAETQPTSVGPMIKMTVVPAQSADLGIGDLIKVDVDHLNICKPEKKDTFLYKRSLQFIRDSL 635          
BLAST of Protein SERAC1 vs. Ensembl Cavefish
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:103044342])

HSP 1 Score: 129.798 bits (325), Expect = 2.452e-31
Identity = 91/317 (28.71%), Postives = 162/317 (51.10%), Query Frame = 1
Query:  649 SLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEK--------TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNEDNNLA---SSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            S+L    +  +I+   +  +  +N+    + Q+    Y   V++L  H    +    DI+F++G+LG+ + TWRQ D  C++   EK        T+CWP+ WL+   P  R++ +        W     ++   +S+  R+ ++  KLK A VG RP++WV HS GG+L+K  +L  ++D  L+    +TKG++F S PH G  + +  Y    +Y L P  E K L  +S  L +LN+ F +  K+++ ++L+  ET+PT +       +VP    +    + +K+  +HL I KP+ +   +Y   L F+  +L
Sbjct:  373 SVLAEMVQSPHIMQASHAARALANLDRDTEVQK----YQDGVYVLHPHCRTNQPIKADILFVHGLLGAAFKTWRQKD--CDLTEDEKSVGVREDYTECWPKSWLAADCPNLRILSVEYDTHLSDWRAKCPVENQRKSLVYRSGELLKKLKAAGVGERPVIWVAHSMGGLLVKKMLLDASKDPELSPLVKNTKGVLFYSVPHFG--TFMAEYSVNVRYLLFPSIEVKELCRDSPALRDLNENFINIAKDQEFKVLSFAETQPTSVGPMIKMTVVPAQSADLGIGDLIKVDVDHLNICKPEKKDTFLYKRSLQFIRDSL 681          
BLAST of Protein SERAC1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001680.1 (pep scaffold:Pmarinus_7.0:GL486332:502:12744:1 gene:ENSPMAG00000001513.1 transcript:ENSPMAT00000001680.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 8.174e-21
Identity = 79/282 (28.01%), Postives = 136/282 (48.23%), Query Frame = 1
Query:  790 HKNILEIKDYDIIFINGMLGSVYFTWRQHDNEC----EIDTSEK-TKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHI-------------LHLNEDNNLASSTKGIM----FMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRG 1569
            H++  E+   D++F++G+LG  + TWRQ D E     E   SE  T CWP+ WL+   P  R++ ++       W      ++  RS+  R+ ++  KL++A VG RP++WV HS G +LL+ +             L L  D    S + GI+    F+       Q +LGL  FP  +  TP       +S  L  L+  F + V+ +++ +L+  ET  T ++     ++VP    +    + + +  NHL + KP S+   +Y   ++F+ +  VN G
Sbjct:  103 HRSSEEVS-ADVLFVHGLLGGGFKTWRQQDVEAAPPKEGPESEAYTHCWPKAWLAPDCPGIRILSLDYDTHLSDWKTKCPAEQHRRSLASRSVEMLEKLRLAGVGDRPLVWVAHSMGVLLLRRLRYKMMICDDGEVMLELPPDICWYSGSHGIIPEKVFI-------QILLGL--FP-DFITTPPP----LDSPRLKELHAAFTALVQRRRLRVLSFGETRATPVHGLIRMLVVPLHSSDPGVGQFVALDVNHLNVCKPPSRDSLLYQRTMSFI-RDCVNEG 368          
BLAST of Protein SERAC1 vs. Ensembl Nematostella
Match: EDO41515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S443])

HSP 1 Score: 70.0922 bits (170), Expect = 1.816e-14
Identity = 39/125 (31.20%), Postives = 72/125 (57.60%), Query Frame = 1
Query:  916 CWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNN--LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAK 1284
            CWP+ WL+   P+ R++ +        W      +   +S+   ++++ +KL+ A +G RP++W+THS GG+L+K +L L  D+   ++ +++GI+F STPH G  S++  Y    +Y L P  +
Sbjct:    1 CWPKAWLASDFPQTRLLMVEYDTSLSHWVSQCPSEPETQSMSFCSEELMHKLRKAGIGKRPVIWITHSMGGLLVKQLLLLASDSEECMSDNSRGIIFYSTPHQG--SIVASYSSQARYLLLPSVQ 123          
BLAST of Protein SERAC1 vs. Ensembl Nematostella
Match: EDO28472 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6D3])

HSP 1 Score: 56.225 bits (134), Expect = 4.947e-10
Identity = 30/81 (37.04%), Postives = 54/81 (66.67%), Query Frame = 1
Query: 1048 AKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNN--LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAK 1284
            ++++ +KL+ A +G RP++W+THS GG+L+K +L L  D+   ++ +++GI+F STPH G  S++  Y    +Y L P  +
Sbjct:    8 SEELMHKLRKAGIGKRPVIWITHSMGGLLVKQLLLLASDSEECMSDNSRGIIFYSTPHQG--SIVASYSSQARYLLLPSVQ 86          
BLAST of Protein SERAC1 vs. Ensembl Medaka
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:101162648])

HSP 1 Score: 129.798 bits (325), Expect = 2.093e-31
Identity = 89/301 (29.57%), Postives = 156/301 (51.83%), Query Frame = 1
Query:  697 NVTKIFSNISELKQNQREKKI--YPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDN-----ECEIDT-SEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNED---NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            +VT++      L    RE  +  Y   V++L       +    D++FI+G+LG+ + TWRQ D+     E E+++ S+ T+CWP+ WL+   P  RV+ +        W      +   +S+  R++++  KLK A VG RP++WV HS GG+L+K  +L  +ED     L  +T+G++F S PH G  + +  Y    +Y L P  E + L  +S  L +LN+ F +  KE   ++++  E++ T +      ++VPK   +    E +++  +HL I KP+ +   +Y   L F+ + L
Sbjct:  378 HVTQVSFAARALANLDRESVVEKYQDGVYILHPQTRNGQPVKADVLFIHGILGAAFKTWRQKDSSLQQEETEMESRSDYTECWPKSWLAEDCPNLRVLSVEYDSHLSDWMSKCPAENQRKSLAYRSQELLKKLKQAGVGERPVVWVAHSMGGLLVKKMLLDASEDPEMKGLLKNTRGVLFYSVPHHG--TFMAEYSVNVRYLLFPSIEVRELCKDSPALSSLNESFVNIAKENDFKVMSFAESQATNVGPMIKIVVVPKQSADLGIGELVEVNVDHLNICKPEKKDSFLYKRSLQFIQEAL 676          
BLAST of Protein SERAC1 vs. Ensembl Medaka
Match: serac1 (serine active site containing 1 [Source:NCBI gene;Acc:101162648])

HSP 1 Score: 129.413 bits (324), Expect = 2.615e-31
Identity = 89/301 (29.57%), Postives = 156/301 (51.83%), Query Frame = 1
Query:  697 NVTKIFSNISELKQNQREKKI--YPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDN-----ECEIDT-SEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKH-ILHLNED---NNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTP--EAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTL 1557
            +VT++      L    RE  +  Y   V++L       +    D++FI+G+LG+ + TWRQ D+     E E+++ S+ T+CWP+ WL+   P  RV+ +        W      +   +S+  R++++  KLK A VG RP++WV HS GG+L+K  +L  +ED     L  +T+G++F S PH G  + +  Y    +Y L P  E + L  +S  L +LN+ F +  KE   ++++  E++ T +      ++VPK   +    E +++  +HL I KP+ +   +Y   L F+ + L
Sbjct:  355 HVTQVSFAARALANLDRESVVEKYQDGVYILHPQTRNGQPVKADVLFIHGILGAAFKTWRQKDSSLQQEETEMESRSDYTECWPKSWLAEDCPNLRVLSVEYDSHLSDWMSKCPAENQRKSLAYRSQELLKKLKQAGVGERPVVWVAHSMGGLLVKKMLLDASEDPEMKGLLKNTRGVLFYSVPHHG--TFMAEYSVNVRYLLFPSIEVRELCKDSPALSSLNESFVNIAKENDFKVMSFAESQATNVGPMIKIVVVPKQSADLGIGELVEVNVDHLNICKPEKKDSFLYKRSLQFIQEAL 653          
BLAST of Protein SERAC1 vs. Planmine SMEST
Match: SMESG000001897.1 (SMESG000001897.1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 406/489 (83.03%), Postives = 407/489 (83.23%), Query Frame = 1
Query:  121 MASFLSIIKASSAIGMFCGAAYVYFSKSNLKFLQVQKTNNVLNNVSQDIKSEILDRLSDIEILSKKICEEVMLVTPPDXXXXXXXXXXXXXXXXXXYNIHKNLEGTLNSLSVRTKNDDFLTKFVSKNGXXXXXXXXXYTNHGECLTDDISMPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN 1587
            MASFLSIIKA+SAIGMFCGAAYVYFSKSNLKFLQVQK                                 VMLVTPPDTLKKSLSSTLLEKLNSNNYNIHKNLEGTLNSLSVRTK                                                 ESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVKEKKIEILTLTETEPTKINKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN
Sbjct:    1 MASFLSIIKATSAIGMFCGAAYVYFSKSNLKFLQVQK---------------------------------VMLVTPPDTLKKSLSSTLLEKLNSNNYNIHKNLEGTLNSLSVRTK-------------------------------------------------ESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVKEKKIEILTLTETEPTKINKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN 407          
BLAST of Protein SERAC1 vs. Planmine SMEST
Match: SMESG000001897.1 (SMESG000001897.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 327/328 (99.70%), Postives = 328/328 (100.00%), Query Frame = 1
Query:  604 QKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVXXXXXXXXXXXXXXXXXXNKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN 1587
            +KKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVKEKKIEILTLTETEPTKINKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN
Sbjct:   16 KKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSNISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWRQHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNLNQWFKSFVKEKKIEILTLTETEPTKINKFYSTIIVPKCDGEFDGHEQLKIKSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN 343          
BLAST of Protein SERAC1 vs. Planmine SMEST
Match: SMESG000062155.1 (SMESG000062155.1)

HSP 1 Score: 138.272 bits (347), Expect = 1.574e-34
Identity = 74/114 (64.91%), Postives = 81/114 (71.05%), Query Frame = 1
Query:  937 SVALPRARVIGINALLRPFVWNPMSDIDKINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNNLASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPE 1278
            S  LP + +    +L + F  N MSDIDKINR IEDR  QIS   KIA+VG +PILWV HSA GILLKHIL+LNE NNLAS TKGIMFMST       M GLYYFPFKYFLT E
Sbjct:  498 SKNLPDSNMWTWQSLEKSFACNSMSDIDKINRYIEDRVNQISKNWKIAEVGIQPILWVAHSAEGILLKHILYLNEYNNLASLTKGIMFMST-------MSGLYYFPFKYFLTSE 604          
The following BLAST results are available for this feature:
BLAST of Protein SERAC1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERAC11.027e-3029.75serine active site containing 1 [Source:HGNC Symbo... [more]
SERAC11.187e-3029.75serine active site containing 1 [Source:HGNC Symbo... [more]
SERAC11.325e-3029.75serine active site containing 1 [Source:HGNC Symbo... [more]
SERAC11.581e-3029.75serine active site containing 1 [Source:HGNC Symbo... [more]
SERAC17.727e-2729.92serine active site containing 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F17H10.18.386e-2330.56pep chromosome:WBcel235:X:13105184:13108543:1 gene... [more]
F17H10.18.386e-2330.56pep chromosome:WBcel235:X:13105241:13108543:1 gene... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG103831.584e-1727.67gene:FBgn0032699 transcript:FBtr0089628[more]
CG103831.584e-1727.67gene:FBgn0032699 transcript:FBtr0343117[more]
CG54558.254e-1330.46gene:FBgn0039430 transcript:FBtr0085016[more]
CG54558.254e-1330.46gene:FBgn0039430 transcript:FBtr0085015[more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
serac19.039e-3332.32serine active site containing 1 [Source:NCBI gene;... [more]
serac19.039e-3332.32serine active site containing 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERAC18.851e-3732.01serine active site containing 1 [Source:NCBI gene;... [more]
SERAC19.519e-3732.01serine active site containing 1 [Source:NCBI gene;... [more]
SERAC11.390e-3632.01serine active site containing 1 [Source:NCBI gene;... [more]
SERAC11.550e-3632.01serine active site containing 1 [Source:NCBI gene;... [more]
SERAC11.632e-3632.01serine active site containing 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Serac11.124e-3230.91serine active site containing 1 [Source:MGI Symbol... [more]
Serac11.866e-3230.91serine active site containing 1 [Source:MGI Symbol... [more]
back to top
BLAST of Protein SERAC1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SNQ7|SRAC1_DANRE6.823e-3232.32Protein SERAC1 OS=Danio rerio OX=7955 GN=serac1 PE... [more]
sp|Q3U213|SRAC1_MOUSE1.305e-3130.91Protein SERAC1 OS=Mus musculus OX=10090 GN=Serac1 ... [more]
sp|Q96JX3|SRAC1_HUMAN7.594e-3029.75Protein SERAC1 OS=Homo sapiens OX=9606 GN=SERAC1 P... [more]
sp|Q2TBM9|SRAC1_BOVIN9.044e-3033.20Protein SERAC1 OS=Bos taurus OX=9913 GN=SERAC1 PE=... [more]
sp|Q95JR3|SRAC1_MACFA5.973e-726.09Protein SERAC1 OS=Macaca fascicularis OX=9541 GN=S... [more]
back to top
BLAST of Protein SERAC1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QLP45.295e-4845.37Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A068YKI85.896e-4830.06Protein serac1 OS=Echinococcus multilocularis OX=6... [more]
A0A094ZQM77.995e-4845.37Protein SERAC1 (Fragment) OS=Schistosoma haematobi... [more]
A0A183LDE52.806e-4744.88Uncharacterized protein OS=Schistosoma margrebowie... [more]
G4VGU61.139e-4644.39Putative ribonuclease p/mrp subunit OS=Schistosoma... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
serac11.952e-3128.71serine active site containing 1 [Source:NCBI gene;... [more]
serac12.452e-3128.71serine active site containing 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001680.18.174e-2128.01pep scaffold:Pmarinus_7.0:GL486332:502:12744:1 gen... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SERAC1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO415151.816e-1431.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284724.947e-1037.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein SERAC1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
serac12.093e-3129.57serine active site containing 1 [Source:NCBI gene;... [more]
serac12.615e-3129.57serine active site containing 1 [Source:NCBI gene;... [more]
back to top
BLAST of Protein SERAC1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000001897.10.000e+083.03SMESG000001897.1[more]
SMESG000001897.10.000e+099.70SMESG000001897.1[more]
SMESG000062155.11.574e-3464.91SMESG000062155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006241 ID=SMED30006241|Name=Protein SERAC1|organism=Schmidtea mediterranea sexual|type=transcript|length=1652bp
TTTTCGATATTTAACTAAATCAAATTTTAATTGATTTTAAAATTTTTAAC
TGATTTCAAACAGATTATCATATTTCTTTACTATTCGAATATTTATTCAT
AATATACTTATTGATTTACAATGGCTTCATTTCTAAGCATTATTAAAGCG
TCATCAGCTATCGGGATGTTTTGTGGTGCTGCTTACGTTTATTTTTCAAA
ATCTAATTTAAAATTTTTACAAGTTCAAAAAACTAATAATGTCTTAAATA
ATGTTTCCCAAGATATTAAATCCGAAATATTAGATAGACTATCTGATATT
GAAATTCTGTCCAAAAAAATTTGTGAGGAGGTAATGCTCGTTACTCCACC
AGACACTTTGAAGAAATCTTTATCATCAACATTACTTGAAAAATTAAACA
GTAACAATTATAATATCCACAAGAATCTCGAAGGAACTCTTAATTCGTTA
TCAGTTCGTACTAAAAATGATGATTTCCTCACAAAATTTGTTTCAAAAAA
TGGTTTACTAATGCTCAAAGATTTATTACTTTATACAAATCATGGTGAAT
GCCTGACTGATGACATATCCATGCCTCTCAGTGAAATTTTGGCAAATATT
TCTCAAAAAAAGGAGTCAATCGAATTATTAAACTTTGAATGCGTCAACAG
TTTGCTCAAATCTTGGCAGAAAGATAGCAATATTGTGCTCAATCTAAATG
TGACTAAGATATTTTCAAACATATCAGAACTTAAACAAAACCAAAGAGAG
AAAAAAATATATCCACCAGATGTATTTCTCCTCGATCATCATAAAAATAT
ATTAGAAATTAAAGATTATGATATAATATTTATAAATGGAATGCTTGGCA
GTGTATATTTTACTTGGCGGCAGCATGATAACGAGTGTGAGATTGATACC
TCGGAGAAAACGAAATGTTGGCCAAGAGATTGGCTATCTGTTGCTCTACC
AAGAGCTCGGGTAATTGGAATCAATGCTCTTTTAAGACCTTTCGTTTGGA
ATCCAATGTCAGACATTGATAAGATCAACCGATCCATAGAAGATCGAGCT
AAGCAAATTTCTAATAAATTGAAAATAGCCCAAGTTGGAAGTCGACCGAT
ATTGTGGGTTACACATTCTGCTGGAGGGATTCTGCTAAAACACATTTTGC
ATTTAAACGAGGATAATAATCTGGCATCATCCACTAAAGGAATAATGTTT
ATGAGTACTCCCCACAGTGGCGCTCAATCTATGTTAGGATTGTACTATTT
TCCATTCAAATATTTTTTAACACCAGAAGCGAAACATTTAGAAACAAACT
CTCAAGTGTTATTGAACCTCAACCAGTGGTTTAAATCATTTGTCAAAGAA
AAGAAAATAGAAATTCTAACTTTAACTGAAACTGAACCAACCAAAATCAA
TAAATTTTATTCCACAATTATTGTGCCAAAATGTGATGGAGAATTCGATG
GCCATGAGCAACTGAAAATCAAATCCAATCATTTGTATATTAGCAAACCG
AAAAGCCAATCAGATCAGATCTACGTCGCAGTCTTGAATTTCGTAATGAA
GACATTGGTGAATCGTGGTGATTTTGACGCGATTAATTGAATATATTTTC
CAAAACTGTTTCTTCGATTCTTTCTCTACAATTTATAACTCGTTATCATT
TG
back to top

protein sequence of SMED30006241-orf-1

>SMED30006241-orf-1 ID=SMED30006241-orf-1|Name=SMED30006241-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MASFLSIIKASSAIGMFCGAAYVYFSKSNLKFLQVQKTNNVLNNVSQDIK
SEILDRLSDIEILSKKICEEVMLVTPPDTLKKSLSSTLLEKLNSNNYNIH
KNLEGTLNSLSVRTKNDDFLTKFVSKNGLLMLKDLLLYTNHGECLTDDIS
MPLSEILANISQKKESIELLNFECVNSLLKSWQKDSNIVLNLNVTKIFSN
ISELKQNQREKKIYPPDVFLLDHHKNILEIKDYDIIFINGMLGSVYFTWR
QHDNECEIDTSEKTKCWPRDWLSVALPRARVIGINALLRPFVWNPMSDID
KINRSIEDRAKQISNKLKIAQVGSRPILWVTHSAGGILLKHILHLNEDNN
LASSTKGIMFMSTPHSGAQSMLGLYYFPFKYFLTPEAKHLETNSQVLLNL
NQWFKSFVKEKKIEILTLTETEPTKINKFYSTIIVPKCDGEFDGHEQLKI
KSNHLYISKPKSQSDQIYVAVLNFVMKTLVNRGDFDAIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029058AB_hydrolase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane