slc18a-5

Overview
Nameslc18a-5 (AKN21540.1)
Smed IDSMED30006235
Length (bp)1500
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc18a-5 (SMED30006235) t-SNE clustered cells

Violin plots show distribution of expression levels for slc18a-5 (SMED30006235) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc18a-5 (SMED30006235) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc18a-5 (SMED30006235) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006235

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006235h1SMcG0021137 SmedASXL_000496SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006235h1SMcG0021137 dd_Smed_v4_13278_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006235h1SMcG0021137 dd_Smed_v6_13278_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006235h1SMcG0021137 dd_Smed_v4_13278_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc18a-5 vs. Ensembl Human
Match: SLC18A3 (solute carrier family 18 member A3 [Source:HGNC Symbol;Acc:HGNC:10936])

HSP 1 Score: 68.9366 bits (167), Expect = 8.256e-12
Identity = 75/334 (22.46%), Postives = 132/334 (39.52%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGS-VGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKER-KLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKM 1278
            ++ +L+ +K I Q++V+   G  +DR+     LLIG+ +   + VL+     Y  L   R  +G+ S     S  A IA K+  +  R +  G V+L     GS V P +GG +Y++  K + FL++     F    L++L V K      + R  L      H                                 R +LDPY  +   +     +    L  T+  ++K     +E++ G+ W    V ++LG  L   L  +  + +     + L V   +S IV A   +      +C +     + D    P L+ + + +H   YG +
Sbjct:  123 KIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALG-VALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDA--LLLLAVAKPFSAAARARANLPVGTPIH---------------------------------RLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV 420          
BLAST of slc18a-5 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 58.9214 bits (141), Expect = 1.426e-8
Identity = 85/393 (21.63%), Postives = 169/393 (43.00%), Query Frame = 1
Query:  256 SGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            +GF + + +++ +L+ +K + Q++V+  +G + +RIG    +  G ++  ++ V++     Y +L + R  +GI S+    +    +A  +     RG+  G     + L   VG  +G  +Y++  K+  FL++            + L++  L + + +   V+  S                              KG+ +  LL DPY L+A  S     M   IL  TLP ++ +     ++Q GL +   +V YL+G  L  +L  K+  R    L+ +L V +    +  A   + +   P   +     + D    PI+  + + +H   YG +  +      +  +I  S G  ++K IG   L +I   +N++Y PL ++L+ 
Sbjct:  129 TGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLIL----------AFLALLDGALQLCILQPSKVSPES-----------------------------AKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKM-GRWLCSLIGMLVVGTSLLCVPLAHNIFGLIG-PNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS 480          
BLAST of slc18a-5 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 58.9214 bits (141), Expect = 1.426e-8
Identity = 85/393 (21.63%), Postives = 169/393 (43.00%), Query Frame = 1
Query:  256 SGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            +GF + + +++ +L+ +K + Q++V+  +G + +RIG    +  G ++  ++ V++     Y +L + R  +GI S+    +    +A  +     RG+  G     + L   VG  +G  +Y++  K+  FL++            + L++  L + + +   V+  S                              KG+ +  LL DPY L+A  S     M   IL  TLP ++ +     ++Q GL +   +V YL+G  L  +L  K+  R    L+ +L V +    +  A   + +   P   +     + D    PI+  + + +H   YG +  +      +  +I  S G  ++K IG   L +I   +N++Y PL ++L+ 
Sbjct:  129 TGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLIL----------AFLALLDGALQLCILQPSKVSPES-----------------------------AKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKM-GRWLCSLIGMLVVGTSLLCVPLAHNIFGLIG-PNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS 480          
BLAST of slc18a-5 vs. Ensembl Human
Match: SLC18A2 (solute carrier family 18 member A2 [Source:HGNC Symbol;Acc:HGNC:10935])

HSP 1 Score: 56.9954 bits (136), Expect = 5.682e-8
Identity = 59/265 (22.26%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            Q+ +L+ +K   Q+I +  IG + +RIG    +  G  +  V+ +++   S Y  L++ R  +GI S+    +    +A  +   + RG   G     + +   VGP +G  +Y++  KT  FL++            ++L++  + + V +   V   S                              KG+ +  LL DPY LIA  S     M   +L   LP ++ +     ++Q G+ +   ++ YL+G  +  IL  K+
Sbjct:  130 QVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVL----------AALVLLDGAIQLFVLQPSRVQPES-----------------------------QKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKM 355          
BLAST of slc18a-5 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 50.0618 bits (118), Expect = 5.620e-6
Identity = 60/274 (21.90%), Postives = 119/274 (43.43%), Query Frame = 1
Query:  256 SGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            +GF + + +++ +L+ +K + Q++V+  +G + +RIG    +  G ++  ++ V++     Y +L + R  +GI S+    +    +A  +     RG+  G     + L   VG  +G  +Y++  K+  FL++            + L++  L + + +   V+  S                              KG+ +  LL DPY L+A  S     M   IL  TLP ++ +     ++Q GL +   +V YL+G  L  +L  K+
Sbjct:  129 TGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLIL----------AFLALLDGALQLCILQPSKVSPES-----------------------------AKGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLANKM 363          
BLAST of slc18a-5 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710585:-1 gene:WBGene00000295.1 transcript:W01C8.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.882e-15
Identity = 89/393 (22.65%), Postives = 166/393 (42.24%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGF-ILGNILNTKLQNRRHYV-LVVILF----VNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
             + +++G+K + Q++V+  IG + +RIG    +  G ++   + +L+  G  YF L L R  +G+ S     S    +A  +     RG   G     + L   VGP YGG +YQ+  K L F+L+ +   F          +  +   V + K+                                   +GS I+ L  DPY ++A  +  +  +   +L  +LP ++ + +G    ++G  +   ++ YL+G  I G + +   +    ++ LVVI F    + S TSV    +P+  +  F + +I        MF  P++  + + +H   YG +  +         ++       L+K +G   +  II  ++ LY PL+F LK+  V
Sbjct:   96 HVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALF----------DGSIQFMVLQPKIDRGEP------------------------------EGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLERGAAFLPASISYLIGTNIFGPLAHRIGRWLSSFIGLVVIGFSLLSIPSATSVAGLIIPH-ALLGFSIGMIDAS-----MF--PLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKNPPV 440          
BLAST of slc18a-5 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710625:-1 gene:WBGene00000295.1 transcript:W01C8.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.457e-15
Identity = 89/393 (22.65%), Postives = 166/393 (42.24%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGF-ILGNILNTKLQNRRHYV-LVVILF----VNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
             + +++G+K + Q++V+  IG + +RIG    +  G ++   + +L+  G  YF L L R  +G+ S     S    +A  +     RG   G     + L   VGP YGG +YQ+  K L F+L+ +   F          +  +   V + K+                                   +GS I+ L  DPY ++A  +  +  +   +L  +LP ++ + +G    ++G  +   ++ YL+G  I G + +   +    ++ LVVI F    + S TSV    +P+  +  F + +I        MF  P++  + + +H   YG +  +         ++       L+K +G   +  II  ++ LY PL+F LK+  V
Sbjct:  159 HVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALF----------DGSIQFMVLQPKIDRGEP------------------------------EGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLERGAAFLPASISYLIGTNIFGPLAHRIGRWLSSFIGLVVIGFSLLSIPSATSVAGLIIPH-ALLGFSIGMIDAS-----MF--PLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKNPPV 503          
BLAST of slc18a-5 vs. Ensembl Celegans
Match: unc-17 (Vesicular acetylcholine transporter unc-17 [Source:UniProtKB/Swiss-Prot;Acc:P34711])

HSP 1 Score: 56.225 bits (134), Expect = 3.367e-8
Identity = 32/126 (25.40%), Postives = 60/126 (47.62%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLI 660
            +L  L+ +K + Q+ V+   G+I+DR+G    +++G+     +  ++ +G  Y VL+  R  +G  S     S  A IA +F  ++ R    G     +     V P +G  +Y    K + FL++
Sbjct:  101 ELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERSAALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLIL 226          
BLAST of slc18a-5 vs. Ensembl Fly
Match: VAChT (gene:FBgn0270928 transcript:FBtr0083671)

HSP 1 Score: 80.4925 bits (197), Expect = 9.167e-16
Identity = 100/476 (21.01%), Postives = 195/476 (40.97%), Query Frame = 1
Query:   49 STRDVTEILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSSFNSS-------DNVSG------FDKFDY-SQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
              R+V +I+ +       +N+R   IL+I  +      L+ +  MV  PI P  +   + + SF+         DN++G       D     S   IL+ +K I Q++V+   G ++D+IG    ++IG+ +   +  ++  GS Y VL   R  +G  S     +  A IA +F  ++ R +  G     +     V P +GG +YQ+  K + FL++          L+ LL    L++ +K  K     S  ++  V                            R L+DPY  +   +  +  +    L  T+  +++       ++ G++W      ++LG ++   +  K    +  +    L +  F+  I+     + M   P+C+I     + D    P L  + + ++   YG +  +     SI  ++   +   +++ IG   LN +I   NL Y+P++  L++
Sbjct:   12 EVREVKDIVWEKIQE--PVNQR-RLILVIVSIA---LLLDNMLYMVIVPIIPDYL---REIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILA---------LVCLLDGLMLLLVMKPVKEAMKQSKDVQDQVIPIW------------------------RLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWKIGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRN 445          
BLAST of slc18a-5 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0310062)

HSP 1 Score: 68.1662 bits (165), Expect = 9.346e-12
Identity = 59/265 (22.26%), Postives = 110/265 (41.51%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            ++ +L+ +K   Q++V+  +G +  RIG    +  G ++  ++ +++  G  Y VL + R  +GI S+    S    +A +F     RG   G     + L   +GP +GG +Y++  K+  FL L  + +   L+ L +L        +   +K  T+                                  S    + DPY LIA  +     M   +L  +LP ++    G T ++QG+ +   ++ YL+G  L   L  K+
Sbjct:  238 EVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFML--------QPSIQKAETEPP--------------------------------SLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKI 462          
BLAST of slc18a-5 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091491)

HSP 1 Score: 68.1662 bits (165), Expect = 9.346e-12
Identity = 59/265 (22.26%), Postives = 110/265 (41.51%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            ++ +L+ +K   Q++V+  +G +  RIG    +  G ++  ++ +++  G  Y VL + R  +GI S+    S    +A +F     RG   G     + L   +GP +GG +Y++  K+  FL L  + +   L+ L +L        +   +K  T+                                  S    + DPY LIA  +     M   +L  +LP ++    G T ++QG+ +   ++ YL+G  L   L  K+
Sbjct:  238 EVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFML--------QPSIQKAETEPP--------------------------------SLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKI 462          
BLAST of slc18a-5 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091493)

HSP 1 Score: 68.1662 bits (165), Expect = 9.346e-12
Identity = 59/265 (22.26%), Postives = 110/265 (41.51%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            ++ +L+ +K   Q++V+  +G +  RIG    +  G ++  ++ +++  G  Y VL + R  +GI S+    S    +A +F     RG   G     + L   +GP +GG +Y++  K+  FL L  + +   L+ L +L        +   +K  T+                                  S    + DPY LIA  +     M   +L  +LP ++    G T ++QG+ +   ++ YL+G  L   L  K+
Sbjct:  238 EVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFML--------QPSIQKAETEPP--------------------------------SLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKI 462          
BLAST of slc18a-5 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091492)

HSP 1 Score: 67.781 bits (164), Expect = 1.016e-11
Identity = 59/265 (22.26%), Postives = 110/265 (41.51%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            ++ +L+ +K   Q++V+  +G +  RIG    +  G ++  ++ +++  G  Y VL + R  +GI S+    S    +A +F     RG   G     + L   +GP +GG +Y++  K+  FL L  + +   L+ L +L        +   +K  T+                                  S    + DPY LIA  +     M   +L  +LP ++    G T ++QG+ +   ++ YL+G  L   L  K+
Sbjct:  238 EVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFML--------QPSIQKAETEPP--------------------------------SLKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKI 462          
BLAST of slc18a-5 vs. Ensembl Zebrafish
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 91.6633 bits (226), Expect = 3.153e-19
Identity = 96/469 (20.47%), Postives = 192/469 (40.94%), Query Frame = 1
Query:   58 DVTEILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSS-----FNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            ++ E   Q  +      R+   IL+I CV      L+ +  MV  PI P  +   ++ S       NSS N++  + FD  Q+ +L+ +K I Q++V+   G  +DR+G    LLIG+ +  V+  ++     Y  L + R  +G+ S     S  A IA K+  +  R +  G     +       P +GG +Y++  K   F+ L  + +   ++ L +L   K    + +E                                    M  G+ I + ++DPY  +   +     +    L  T+  ++++    +++Q G+ W      ++LG  L   L  K  + + +   + + +   +S IV A   +     P+C +     + D    P L+ + + +H   YG +  +      +  ++   +   ++  +G  +LN+ +   N+LY P +  L++ S+
Sbjct:   19 EMGERTKQLGNAIQDPERQRRIILVIVCVA---LLLDNMLYMVIVPIVPDYLAHLESESEQAHVKGNSSINITQNENFDL-QIGVLFASKAILQLLVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATLFMARSLQGLGSAFADTSGIAMIADKYAEESERSRALGIALAFISFGSLAAPPFGGVLYEFAGKRFPFIALACVCLADGILCLTVL---KPFSSRTREN-----------------------------------MPVGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMNASQWQIGITWLPAFFPHILGVYLTVKLAAKYPHLQWFYGALGMVIIGASSCIVPACKNFEQLIIPLCGVCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYALGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNVSL 445          
BLAST of slc18a-5 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 69.707 bits (169), Expect = 3.171e-12
Identity = 87/415 (20.96%), Postives = 171/415 (41.20%), Query Frame = 1
Query:  202 SVIFKWQNLSSFNSSDNVSGFDKFDYSQ-----LSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            SV   + N SS +S++   G +  D+ +     + +L+ +K + Q++V+  +G + +RIG    +  G ++  V+ +++     Y +L   R  +GI S+    +    +A  +     RG   G     + +   +G  +G  +Y++ SK+  FL++            + + +  L + + +   ++  S                            M        L DPY LI+  S     M   +L  TLP ++ +     ++Q G+ +   +V YL+G  L  IL  K+   R    +V +F+   + + V      +    P   +     + D     I+  + + +H   YG +  +      +  ++  S G  L++ IG   L +II  +N+LY PL FFLK+
Sbjct:  111 SVSLNFTNFSSASSTNENLGVNNSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVL----------AFLAMFDGALQLCILQPSKISPTS----------------------------MEGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMG--RWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKN 485          
BLAST of slc18a-5 vs. Ensembl Zebrafish
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 66.6254 bits (161), Expect = 2.575e-11
Identity = 63/285 (22.11%), Postives = 119/285 (41.75%), Query Frame = 1
Query:  226 LSSFNSSDNVSGFDKF--DYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            +S  N SD     D+   +  ++ +L+ +K   Q+I +  IG + +RIG    +  G  +  V+ +++   S Y +L L R  +G+ S+    +    +A  +   + RG   G     + +   VGP +G  +Y++  KT  FL++ +        L +L   +R+ I      L + +S+   T                           S I  + DPY LIA  S     M   +L   LP ++ +     ++Q G+ +   ++ YL+G  +  +L  K+
Sbjct:   99 VSPQNQSDCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFVSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLILAV--------LAVLDGGERINIC----SLKSQDSSQKGT---------------------------SLITLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCPRKWQLGIAFVPASISYLIGTNIFAVLAHKM 344          
BLAST of slc18a-5 vs. Ensembl Zebrafish
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 65.4698 bits (158), Expect = 6.654e-11
Identity = 60/285 (21.05%), Postives = 117/285 (41.05%), Query Frame = 1
Query:  226 LSSFNSSDNVSGFDKF--DYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            +S  N SD     D+   +  ++ +L+ +K   Q+I +  IG + +RIG    +  G  +  V+ +++   S Y +L L R  +G+ S+    +    +A  +   + RG   G     + +   VGP +G  +Y++  KT  FL++           ++ +++  L + V +   V   S    +L                            I  + DPY LIA  S     M   +L   LP ++ +     ++Q G+ +   ++ YL+G  +  +L  K+
Sbjct:  157 VSPQNQSDCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFVSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLIL----------AVLAVLDGALQLFVLQPSKVEPESQKGTSL----------------------------ITLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCPRKWQLGIAFVPASISYLIGTNIFAVLAHKM 403          
BLAST of slc18a-5 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 65.4698 bits (158), Expect = 6.783e-11
Identity = 88/425 (20.71%), Postives = 171/425 (40.24%), Query Frame = 1
Query:  202 SVIFKWQNLSSFNSSDNVSGFDK--FDYS-------------QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            SV   + N SS +S++   G +    DY              ++ +L+ +K + Q++V+  +G + +RIG    +  G ++  V+ +++     Y +L   R  +GI S+    +    +A  +     RG   G     + +   +G  +G  +Y++ SK+  FL++            + + +  L + + +   ++  S                            M        L DPY LI+  S     M   +L  TLP ++ +     ++Q G+ +   +V YL+G  L  IL  K+   R    +V +F+   + + V      +    P   +     + D     I+  + + +H   YG +  +      +  ++  S G  L++ IG   L +II  +N+LY PL FFLK+
Sbjct:   85 SVSLNFTNFSSASSTNENLGVNSSSADYGCKEDSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVL----------AFLAMFDGALQLCILQPSKISPTS----------------------------MEGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAPKWQLGVAFLPASVSYLIGTNLFGILANKMG--RWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKN 469          
BLAST of slc18a-5 vs. Ensembl Xenopus
Match: slc18a3 (solute carrier family 18 (vesicular acetylcholine transporter), member 3 [Source:NCBI gene;Acc:780320])

HSP 1 Score: 87.0409 bits (214), Expect = 1.473e-17
Identity = 101/465 (21.72%), Postives = 188/465 (40.43%), Query Frame = 1
Query:   79 QFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVI----FKWQNLSSFNSSD---NVSGFDKFDYS------QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            Q  +   + + +   ILII CV    F    +  ++ PI P  I       ++  S NSS    N S   +  Y       Q+ +L+ +K I Q++++   G  +DR+G    LLIG+++   + V++     Y  L + R  +G+ S     S  A IA  +  +  R K  G     +     V P +GG +YQ+  K + FL++    +  LI  ++LL    L+IK    +   +                              M  G+ I R ++DPY  +   +     +    L  T+  ++K     +E+Q GL W      ++LG  +   L     + + +   + + +   +S  V A   +W    P+C I     + D    P L+ + + +H   YG +  +      +  ++   +   ++   G  +LN+ +   N+LY P + FL++
Sbjct:   27 QIGTAIKEPHHQRRIILIIVCVA--LFLDNMLYMVIVPIIPDYIQNLRADREHAKSINSSSQYRNKSFAIRPQYPAENEDMQIGVLFASKAILQLLINPLSGTFIDRVGYDIPLLIGLVVLFFSTVIFAFAENYATLFVARSLQGLGSAFADTSGIAMIADTYTEEAERSKALGIALAFISFGSLVAPPFGGILYQFVGKRMPFLVL---ASIALIDGVLLL----LVIKPFTNRTRAN------------------------------MPIGTPIHRLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMKTTMDASEWQMGLTWLPAFFPHVLGVYITVKLAANYPHYQWFYGAIGMVIIGASSCTVPACKNFWELIVPLCGICFGIALVDTALLPTLALLVDVRHVSVYGSVYAIADISYCVAYALGPVVASQIVHTTGFTQLNLGMGLANVLYAPALLFLRN 452          
BLAST of slc18a-5 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 59.3066 bits (142), Expect = 8.267e-9
Identity = 79/386 (20.47%), Postives = 152/386 (39.38%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFH-LIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIV--CAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            ++ +L   K   Q++ +  +G +V RIG    +  G ++  V+ +L+   + Y +L + R F+GI S+         +A  F     RGK  G     + +    GP +G  +Y++  K+  FL I        ++ L IL   +   + V                                           Y   L+DPY L+A     +  +T+ +L  TLP  + +      +Q GL +    V Y   FI  N+     Q    ++ +++  +    SVI    A+  +++   P   +   F + +    P+++ + + +H   YG +  +      I  ++    G  + K +G   L II+  +NL++ PL   L++
Sbjct:  118 RVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPATP---------------------------------------YKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAY---FICLNVFAELAQKIGRWLCIMLGMLILGISVICMPLALNIYYLIG-PSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRN 460          
BLAST of slc18a-5 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 58.5362 bits (140), Expect = 1.229e-8
Identity = 79/406 (19.46%), Postives = 161/406 (39.66%), Query Frame = 1
Query:  238 NSSDNVSGFDKFDY-SQLSILYG----TKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFH-LIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIV--CAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            ++ +    +++ DY ++ ++L G     K + Q++ +  +G I++R G    L  G ++  ++ +++     Y  L + R  +GI S+         +A+ F     RGK  G     + +    GP +G  +Y++  K+  FL I        ++ L IL   +   + V                                           Y   L+DPY L+A     +  +T+ +L  TLP  + +      +Q GL +    V Y   FI  N+     Q    ++ +++  +    SVI    A+  +++   P   +   F + +    P+++ + + +H   YG +  +      I  ++    G  + K +G   L II+  +NL++ PL   L++
Sbjct:   50 SAGNQTQCYEEKDYLNEENVLVGLLLAIKALLQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYAFLCVARGLQGIGSSFTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPATP---------------------------------------YKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAPRYQLGLCFLPCIVAY---FICLNVFAELAQKIGRWLCIMLGMLILGISVICMPLALNIYYLIG-PSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRN 412          
BLAST of slc18a-5 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 53.1434 bits (126), Expect = 7.268e-7
Identity = 41/161 (25.47%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKE---RKLVTD 756
            ++ +L   K   Q++ +  +G +V RIG    +  G ++  V+ +L+   + Y +L + R F+GI S+         +A  F     RGK  G     + +    GP +G  +Y++  K+  FL+I           + LL   + I+ V E   R L+TD
Sbjct:  118 RVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSSPFLVIAA---------LALLDGGKKILHVPETPYRVLLTD 269          
BLAST of slc18a-5 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 52.7582 bits (125), Expect = 7.680e-7
Identity = 41/161 (25.47%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKE---RKLVTD 756
            ++ +L   K   Q++ +  +G +V RIG    +  G ++  V+ +L+   + Y +L + R F+GI S+         +A  F     RGK  G     + +    GP +G  +Y++  K+  FL+I           + LL   + I+ V E   R L+TD
Sbjct:   96 RVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSSPFLVIAA---------LALLDGGKKILHVPETPYRVLLTD 247          
BLAST of slc18a-5 vs. Ensembl Mouse
Match: Slc18a3 (solute carrier family 18 (vesicular monoamine), member 3 [Source:MGI Symbol;Acc:MGI:1101061])

HSP 1 Score: 69.707 bits (169), Expect = 3.245e-12
Identity = 73/334 (21.86%), Postives = 133/334 (39.82%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGS-VGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKER-KLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKM 1278
            ++ +L+ +K I Q++V+   G  +DR+     LLIG+ +   + V++     Y  L   R  +G+ S     S  A IA K+  +  R +  G V+L     GS V P +GG +Y++  K + FL++     F    L++L V K      + R  L      H                                 R +LDPY  +   +     +    L  T+  ++K     +E++ G++W    V ++LG  L   L  +  + +     + L V   +S +V A   +      +C +     + D    P L+ + + +H   YG +
Sbjct:  123 KIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALG-VALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDA--LLLLAVAKPFSAAARARANLPVGTPIH---------------------------------RLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV 420          
BLAST of slc18a-5 vs. Ensembl Mouse
Match: Slc18a2 (solute carrier family 18 (vesicular monoamine), member 2 [Source:MGI Symbol;Acc:MGI:106677])

HSP 1 Score: 56.6102 bits (135), Expect = 5.045e-8
Identity = 58/265 (21.89%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLL-DPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
            Q+ +L+ +K   Q++ +  IG + +RIG    +  G  +  ++ V++   S Y  L++ R  +GI S+    +    +A  +   + RG   G     + +   VGP +G  +Y++  KT  FL++            ++L++  + + V +   V   S                              KG+ +  LL DPY LIA  S     M   +L   LP ++ +     ++Q G+ +   ++ YL+G  +  IL  K+
Sbjct:  133 QVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVL----------AALVLLDGAIQLFVLQPSRVQPES-----------------------------QKGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKM 358          
BLAST of slc18a-5 vs. UniProt/SwissProt
Match: sp|Q08C75|VACHA_DANRE (Probable vesicular acetylcholine transporter-A OS=Danio rerio OX=7955 GN=slc18a3a PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.380e-18
Identity = 96/469 (20.47%), Postives = 192/469 (40.94%), Query Frame = 1
Query:   58 DVTEILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSS-----FNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            ++ E   Q  +      R+   IL+I CV      L+ +  MV  PI P  +   ++ S       NSS N++  + FD  Q+ +L+ +K I Q++V+   G  +DR+G    LLIG+ +  V+  ++     Y  L + R  +G+ S     S  A IA K+  +  R +  G     +       P +GG +Y++  K   F+ L  + +   ++ L +L   K    + +E                                    M  G+ I + ++DPY  +   +     +    L  T+  ++++    +++Q G+ W      ++LG  L   L  K  + + +   + + +   +S IV A   +     P+C +     + D    P L+ + + +H   YG +  +      +  ++   +   ++  +G  +LN+ +   N+LY P +  L++ S+
Sbjct:   19 EMGERTKQLGNAIQDPERQRRIILVIVCVA---LLLDNMLYMVIVPIVPDYLAHLESESEQAHVKGNSSINITQNENFDL-QIGVLFASKAILQLLVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATLFMARSLQGLGSAFADTSGIAMIADKYAEESERSRALGIALAFISFGSLAAPPFGGVLYEFAGKRFPFIALACVCLADGILCLTVL---KPFSSRTREN-----------------------------------MPVGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMNASQWQIGITWLPAFFPHILGVYLTVKLAAKYPHLQWFYGALGMVIIGASSCIVPACKNFEQLIIPLCGVCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYALGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNVSL 445          
BLAST of slc18a-5 vs. UniProt/SwissProt
Match: sp|P59845|VACHB_DANRE (Probable vesicular acetylcholine transporter-B OS=Danio rerio OX=7955 GN=slc18a3b PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.872e-17
Identity = 85/417 (20.38%), Postives = 174/417 (41.73%), Query Frame = 1
Query:  181 MVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLK 1428
            ++ PI P  +   +     +S+D        D  Q+ +L+ +K + Q++V+   G  +DR+G    LLIG+++  ++  ++     Y  L   R  +G+ S     S  A IA KF  +  R +  G     +     V P +GG +Y++  K + F+++            + L +  L++ V   K  +D +                            M  G+ I R ++DPY  +   +  V  +    L  T+  +++     +++Q GL+W    + ++LG  +   L  +   R+ +   + + +   +S  V A   +    FP+C I     + D    P L+ + + +H   YG +  +     S+  ++   +   ++  +G  +LN+ +  VN+LY P +  L+
Sbjct:   58 VIVPIIPDYLADLRGERGNSSAD-------LDI-QIGVLFASKALLQLLVNPLSGTFIDRVGYDLPLLIGLLVMFLSTCIFAFAENYGTLFAARSLQGLGSAFADTSGIAMIADKFTEEAERSRALGIALAFISFGSLVAPPFGGILYEFAGKRVPFIVL----------ACVCLADGVLLLTVV--KPFSDRTREN-------------------------MPVGTPIHRLMVDPYIAVVAGALTVCNIPLAFLEPTIANWMESTMDASKWQMGLVWLPAFLPHVLGVYITVRLAARYPERQWFYGALGMVIIGASSCTVPACKTFGELVFPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYAMGPVVAGQIVHNLGFVQLNLGMGLVNVLYAPALLLLR 429          
BLAST of slc18a-5 vs. UniProt/SwissProt
Match: sp|P81721|VACHT_TETCF (Vesicular acetylcholine transporter OS=Tetronarce californica OX=7787 PE=2 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 1.870e-16
Identity = 81/384 (21.09%), Postives = 160/384 (41.67%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            Q+ +L+ +K I Q++ +   G  +DR+G    LLIG+ +   + + +  G  Y VL   R  +G+ S     S  A IA K+  +  R +  G     +     V P +GG +YQ+  K + FL  ++     L  +++L+V      + +E  L                                   +G+ I + ++DPY  +   +     +    L  T+  ++KK    +E+Q G+ W      ++LG  +   L  K  N + +   V L +   +S  + A   +     P+C +     + D    P L+ + + ++   YG +  +     S+  ++   +   ++  +G  +LN+ +  VN+LY P + FL++
Sbjct:  110 QIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAVLFAARSLQGLGSAFADTSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFL--VLSFVCLLDGILLLMVVTPFASRTRENML-----------------------------------QGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTISNWMKKTMNASEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWFYGAVGLVIIGASSCTIPACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALGPIMAGQIVHDLGFVQLNLGMGLVNILYAPALLFLRN 456          
BLAST of slc18a-5 vs. UniProt/SwissProt
Match: sp|O17444|VACHT_DROME (Vesicular acetylcholine transporter OS=Drosophila melanogaster OX=7227 GN=VAChT PE=2 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 9.189e-15
Identity = 100/476 (21.01%), Postives = 195/476 (40.97%), Query Frame = 1
Query:   49 STRDVTEILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSSFNSS-------DNVSG------FDKFDY-SQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
              R+V +I+ +       +N+R   IL+I  +      L+ +  MV  PI P  +   + + SF+         DN++G       D     S   IL+ +K I Q++V+   G ++D+IG    ++IG+ +   +  ++  GS Y VL   R  +G  S     +  A IA +F  ++ R +  G     +     V P +GG +YQ+  K + FL++          L+ LL    L++ +K  K     S  ++  V                            R L+DPY  +   +  +  +    L  T+  +++       ++ G++W      ++LG ++   +  K    +  +    L +  F+  I+     + M   P+C+I     + D    P L  + + ++   YG +  +     SI  ++   +   +++ IG   LN +I   NL Y+P++  L++
Sbjct:   12 EVREVKDIVWEKIQE--PVNQR-RLILVIVSIA---LLLDNMLYMVIVPIIPDYL---REIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILA---------LVCLLDGLMLLLVMKPVKEAMKQSKDVQDQVIPIW------------------------RLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWKIGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRN 445          
BLAST of slc18a-5 vs. UniProt/SwissProt
Match: sp|Q91498|VACHT_TORMA (Vesicular acetylcholine transporter OS=Torpedo marmorata OX=7788 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.114e-14
Identity = 83/384 (21.61%), Postives = 161/384 (41.93%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            Q+ +L+ +K I Q++ +   G  +DR+G    LLIG+ +   + + +  G  Y +L   R  +G+ S     S  A IA K+  +  R +  G     +     V P +GG +YQ+  K + FL++       L+  I+LL+   ++     R  V        TL                        +G+ I + ++DPY  +   +     +    L  T+  ++KK    +E+Q G+ W      ++LG  +   L  K  N +     V L +   +S  + A   +     P+C +     + D    P L+ + + ++   YG +  +     S+  ++   +   ++  +G  +LN+ +  VN+LY P + FL++
Sbjct:  106 QIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAILFAARSLQGLGSAFADTSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFLVLSF---VCLLDGILLLM---VVTPFASRTRV-------NTL------------------------QGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTISNWMKKTMNASEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWLYGAVGLVIIGASSCTIPACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALGPIMAGQIVHDLGFVQLNLGMGLVNILYAPGLLFLRN 452          
BLAST of slc18a-5 vs. TrEMBL
Match: A0A0H3YF28 (Slc18a-5 OS=Schmidtea mediterranea OX=79327 GN=slc18a-5 PE=2 SV=1)

HSP 1 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 446/446 (100.00%), Postives = 446/446 (100.00%), Query Frame = 1
Query:  103 MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVNSNKNSSSNIANIKENIKSEVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMLTGTSITSSIWSSLGPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV
Sbjct:    1 MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVNSNKNSSSNIANIKENIKSEVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMLTGTSITSSIWSSLGPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 446          
BLAST of slc18a-5 vs. TrEMBL
Match: A0A0H3YK86 (Slc18a-3 OS=Schmidtea mediterranea OX=79327 GN=slc18a-3 PE=2 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 6.121e-89
Identity = 175/476 (36.76%), Postives = 273/476 (57.35%), Query Frame = 1
Query:  124 ILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLS----SFNSSDNVSGFDK-FDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLV----NKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIR------------------------------FLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDF 1434
            +LII+ +   K+ + FIT MV PIFP++I K  N S    + N S  +S  +  F+Y QLSIL+ TKNICQ+++S  +G+   R+G L  L  G+ LQ V+++ YG G+ YF+LI+GRIFE ++S  I C+VS+++AY++      G  +G   L + + G+ GP+YGG+V+QY+ K + FL +L   T   I ++ L++    NK   I+  +  L  + +  +E   ++    S        +    V+   S+                                FL DPYF+I + ++PV++ + ++ YATLP ++K  FG +E QQG+IW L  VGY +GF+LGN LN K    RH VL+V ++V++  ++ +  MP WW  A P+CLI  Q LVF++   P+L+ I  K+H+ ++G MAG+++   ++TSS  S LGPIL  KIG   LNII+  + L+Y PL+  LK F
Sbjct:   10 LLIIFSISLAKYSVGFITGMVIPIFPTLIDKHFNESLPVPAANFSSEISVLNSSFNYQQLSILFATKNICQILLSPWMGYFCGRLGSLNILFSGVGLQTVSILFYGFGNKYFLLIIGRIFEALASGAINCAVSSFVAYRYTDHKKLGLVYGIGGLGLCIGGASGPAYGGWVFQYHGKLMVFLTVLSMTTVEAILILSLMIANKSNKSHHIETIKNPLCAEINEIVENKFDNEIIISMPNNISISSEGVNVLLDNSFKEPKFGSLLNENGNENNHLSVEKSKPEHNIFYFLSDPYFMICLGAFPVMYFSLFVYYATLPHFMKVTFGASESQQGVIWLLNLVGYFIGFLLGNFLNAKFAKSRHIVLMVTVYVHAIGALCISLMPSWWSIAIPLCLIVNQHLVFEIIIAPLLTSIVAKRHESKFGLMAGIIMMAIALTSSCGSFLGPILFSKIGFLYLNIIVAVMGLVYGPLLLMLKQF 485          
BLAST of slc18a-5 vs. TrEMBL
Match: A4KWG5 (Vesicular acetylcholine transporter OS=Branchiostoma floridae OX=7739 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.833e-22
Identity = 116/468 (24.79%), Postives = 206/468 (44.02%), Query Frame = 1
Query:   79 QFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKW------QNLSSFNSSDNVS-------GFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLI--ILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLI-FTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            +F         + + +L+I C+      L+ +  MV  PI P  +         Q  +++N +DN +       G++  D + +  L+ +K I Q+IV+   G ++DR G  + ++IG+ +  ++  ++  GS Y VL + R  +G+ S     +  A IA +F  +  R K  G     +     V P +GG +YQY  K + FL      T   I L+  ILL    L +   +R+   DN     TLV +                          + L+DPY  IA  +  +  ++   L  T+  ++K+    TE++ G++W    + Y++G  L   L  K  + +  + +V L V   ++ IV     + +   PV  I F + LV      P L+ I + +H   YG +  +     S+  ++   L   ++  +G  +LNI I  VN+LY P++ FLK+
Sbjct:   17 RFMEKIQDPKSQRKLVLVIVCIA---LLLDNMLYMVIVPIIPDYLHSIGAFEPIQEKTAWNGTDNKTYWNTTTVGYENEDIN-IGFLFASKAIVQLIVNPLSGTLIDRTGYEKPMVIGISVMFISTAVFAFGSSYTVLFIARSLQGVGSAFADSAGLAMIADRFTEEGERSKALGIALAFISFGCLVAPPFGGILYQYAGKRVPFL------TLSFICLVDGILL----LFVTRPDRESGKDN-----TLVGTPMW-----------------------KLLIDPYIAIAGGALVMCNVSLAFLEPTIAIWMKETMHSTEWEMGIVWLPCFIPYIVGVCLTVWLAGKYWHYQWLLALVGLVVQGLSTFIVPEATSFAVLILPVAGICFGEALVSTAML-PTLAYIVDVRHTSVYGSIYAIADISYSLAYAMGPMLAGKIMHDLGFLQLNIGIGLVNILYAPVLLFLKN 441          
BLAST of slc18a-5 vs. TrEMBL
Match: T1EMB8 (MFS domain-containing protein OS=Helobdella robusta OX=6412 GN=20197718 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 5.278e-20
Identity = 96/395 (24.30%), Postives = 180/395 (45.57%), Query Frame = 1
Query:  256 SGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLI-LIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVI-LFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            SG +  D +++ IL+ +K + Q+ +S   G ++DRIG    ++IG+ +   +  ++  G  Y +L + R  +G+ S     S  A IA ++K    R K  G     +       P +GGF Y+Y  K + FLL+ LI +   ++   + LV+K    K KE++ + DN                            +  KG+ I + +LDPY  +   +  +  ++   L  T+ R++K+     EFQ G++W    + ++LG  +  +   KL  +  +++  + L +   + +I+     + M   P+ +      + D    P L+ + + +H   YG +  +     S+  +    L   + +KIG F LN  I+  N+LY PL+ FLK+
Sbjct:  100 SGDESTD-ARVGILFASKALVQLFISPISGTVIDRIGYETPMIIGLSIIFFSTTIFAFGRSYALLFIARSLQGVGSAFADTSGLAMIADRYKENAARSKAQGIALAFISFGCLFAPPFGGFFYKYAGKAVPFLLLSLIALADGVM---LKLVSKP--AKKKEKQTLCDNG---------------------------LEKKGTPIYKLILDPYIALCAGALVMANVSLAFLEPTIARWMKETMKADEFQIGVVWLPPFIPHVLGVYV-TVRLAKLYPKHQWLITAVGLSLEGISCLIIPFCSNFKMVILPLMIDCFGIALVDTAILPSLAYLVDHRHVSVYGSVYAIADISYSLAYAFGPILADEIYQKIGFFWLNFGIFLSNVLYAPLLIFLKN 460          
BLAST of slc18a-5 vs. TrEMBL
Match: A0A4D9E5M6 (5'-AMP-activated protein kinase subunit beta-1 OS=Platysternon megacephalum OX=55544 GN=DR999_PMT11645 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.022e-18
Identity = 98/470 (20.85%), Postives = 194/470 (41.28%), Query Frame = 1
Query:   67 EILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFD--------------KFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            E   Q  +    ++R+   IL+I CV    F    +  ++ PI PS +  W+   S  S  N  G +              + +  ++ +L+ +K I Q++V+   G  +DR+G    LLIG+ +  ++ +++ +   Y  L   R  +G+ S     S  A IA K+  +  R +  G     +     V P +GG +Y++  + L F L+L  +      L++ ++ K    + +E  LV                                   G+ I R ++DPY  +   +     +    L  T+  ++KK  G +E++ G+ W      ++LG  +   L  K  + + +   + + +   +S  V A   +     P+C I     + D    P L+ + + +H   YG +  +     S+  ++   +   ++  +G  +LN+ +   N+LY P++ FLK+
Sbjct:   23 EKTKQLGTAMQDVHRQRRLILVIVCVA--LFLDNMLYMVIVPIMPSYLAMWEAQESNASGANARGANASWAKSVLGPGYPPENEDIKIGVLFASKAILQLLVNPLSGTFIDRVGYDIPLLIGLTVMFLSTIIFALAENYATLFAARSLQGLGSAFADTSGIAMIADKYTEESERSRALGIALAFISFGSLVAPPFGGILYEFAGRRLPF-LVLASVCLLDGLLLLTVI-KPFGSRARENMLV-----------------------------------GTPIHRLMIDPYIAVVAGALTTCNIPLAFLEPTIATWMKKTMGASEWEMGVTWLPAFFPHVLGVYITVKLAAKYPHLQWFYGALGMVIIGASSCTVPACRNFGQLIVPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVASQIVHSLGFVQLNLGMGLANVLYAPVLLFLKN 453          
BLAST of slc18a-5 vs. Ensembl Cavefish
Match: slc18a3b (solute carrier family 18 member 3b [Source:NCBI gene;Acc:394082])

HSP 1 Score: 73.1738 bits (178), Expect = 1.773e-13
Identity = 91/446 (20.40%), Postives = 178/446 (39.91%), Query Frame = 1
Query:  106 NRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQD-NRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI---RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLK 1428
             R+   IL+I CV      L+ +  MV  PI P  +     +S  N           D  ++ +L+ +K I Q+ V+   G  +DR+G    LLIG+M+  ++  ++     Y  L   R  +G+ S     S  A IA ++  ++  R +  G     +     V P +GG +Y+   K + FL++            + L +  L++ V     V   SN                            N+ + +   R ++DPY  +   +  V  +    L  T+  +++     T++Q GL W  +   ++LG  L   L  +  + + +   V + +   +S +V A   +     P+C I     + D    P ++ + + ++   YG +  +     S+  ++       ++  +G  +LN+ +   N+LY P +  L+
Sbjct:   20 KRQRTVILVIVCVA---LLLDNMLYMVIVPIIPDYLAGASPVSKTN----------LDV-KIGVLFASKAILQLAVNPLSGPFIDRVGYDLPLLIGLMVMFMSTCVFAFAETYATLFAARSLQGLGSAFADTSGIAMIADRYGDEETERSRALGLALAFISFGSLVAPPFGGILYELAGKRVPFLVL----------ACVCLADGCLLLAV-----VKPFSNQGAR-----------------------QNQPAGVPLHRLIMDPYIAVVAGALTVCNIPLAFLEPTIAGWMENTMHATKWQIGLAWLPSFFPHVLGVYLTVKLAERYPSMQWFYGAVGMLIIGASSCVVPACKSFSQLMLPLCGICFGIALVDTALLPTMAFLVDVRYASVYGSVYAIADISYSVAYALGPVAAGHIVHTMGFAQLNLGMGLANVLYAPALLALR 413          
BLAST of slc18a-5 vs. Ensembl Cavefish
Match: slc18a2 (synaptic vesicular amine transporter [Source:NCBI gene;Acc:103032219])

HSP 1 Score: 69.707 bits (169), Expect = 2.782e-12
Identity = 90/409 (22.00%), Postives = 166/409 (40.59%), Query Frame = 1
Query:  241 SSDNVSGFDKFDYS------QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPV-CLIFTQFLV------FDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLK 1428
            S+ N S   K D        ++ +L+ +K   Q+I +  IG + +RIG    +  G  +  ++ +++   S Y +L L R  +G+ S+    +    +A  +   + RG   G     + +   VGP +G  +Y++  KT  FL++           ++ +++  L + V +   V   S    +L                            +  + DPY LIA  S     M   +L   LP ++ +     ++Q G+ +   +V YL+G  +  +L  K+  R    L+ +L V     + +  +P    FA  +  LI   F V       D    PI+  + + +H   YG +  +      +  +   S G  + + IG   L  II  V++L+ PL FFL+
Sbjct:  108 SAPNASNCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFLSTIMFAFSSSYTLLFLARSMQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLIL----------AVLAVLDGALQLFVLQPSKVEPESQKGTSL----------------------------MTLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETMCARKWQLGVAFLPASVSYLIGTNIFAVLANKM-GRWLCALIGMLLVG----ISILCVP----FAKDIYGLILPNFGVGFAIGMVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMGFAFGPSAGGAIARSIGFPWLMTIIGIVDILFAPLCFFLR 469          
BLAST of slc18a-5 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 64.6994 bits (156), Expect = 1.011e-10
Identity = 88/426 (20.66%), Postives = 174/426 (40.85%), Query Frame = 1
Query:  166 EFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFH-LIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            E  +++  P  PS        +  +  D+    D+ +  ++ +L+ +K + Q++V+  +G + +RIG    +  G ++  V+ +++     Y +L   R  +GI S+    +    +A  +   + RG   G     + +   +G  +G  +Y++  K+  FL++     F   + L IL  +K     V+   L+T                                        L DPY LI+  S     M   IL  TLP ++ +     ++Q G+ +   +V YL+G  L  +L  K+   R    ++ +F+   + + V      +    P   +     + D     I+  + + +H   YG +  +      +  +I  S G  +++ IG   L ++I  VN+LY PL +FLK+ +V
Sbjct:   88 ESPSNLSDPSTPSPPETGLKGNKSDCKDDTEFLDE-ENVRVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSVEGTPLLT---------------------------------------LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMG--RWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKNPAV 471          
BLAST of slc18a-5 vs. Ensembl Cavefish
Match: slc18a3a (solute carrier family 18 member A3 [Source:NCBI gene;Acc:103044616])

HSP 1 Score: 59.6918 bits (143), Expect = 4.135e-9
Identity = 80/416 (19.23%), Postives = 159/416 (38.22%), Query Frame = 1
Query:   58 DVTEILLQFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLSSFNSSDNVS-------------GFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFL-LILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKH 1257
            ++ E   Q  +      R+   IL+I CV      L+ +  MV  PI P  + + ++ S    S +V                +  D  Q+ +L+ +K I Q+IV+   G  +DR+G    LLIG+ +  V+  ++     Y  + + R  +G+ S     +  A IA  +  +  R +  G     +       P +GG +YQ+  K + F+ L  + +   ++ L +L   K    + +E                                    M  G  I + ++DPY  +   +     +    L  T+  ++++    +++Q GL W      ++LG  +   L  +  + + +   + + +   +S  V A   +     P+C I     + D    P L+ + + +H
Sbjct:   19 EMGERTKQLGTAIQDPERQRRIILVIVCVA---LLLDNMLYMVIVPIVPDYLARLESQS--EQSHHVVLSNSTNSSSQTNFPAENLDL-QVGVLFASKAILQLIVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATMFVARSMQGLGSAFADTAGIAMIADTYTEEAERSRALGIALAFISFGSLAAPPFGGVLYQFAGKRVPFIALACVCLADGILCLTVL---KPFSSRTREN-----------------------------------MPVGPPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMDSSQWQIGLTWLPAFFPHVLGVYITVKLAAQYPHLQWFYGALGMVIIGASSCTVPACKNFEQLIIPLCGICFGIALVDTALLPTLAFLVDVRH 390          
BLAST of slc18a-5 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 55.0694 bits (131), Expect = 1.170e-7
Identity = 84/393 (21.37%), Postives = 162/393 (41.22%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIG------DLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFH-LIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            ++ +L+ +K + Q++V+  +G + +RIG       L T+++ +M   +  +L+     Y +L   R  +GI S+    +    +A  +   + RG   G     + +   +G  +G  +Y++  K+  FL++     F   + L IL  +K     V+   L+T                                        L DPY LI+  S     M   IL  TLP ++ +     ++Q G+ +   +V YL+G  L  +L  K+   R    ++ +F+   + + V      +    P   +     + D     I+  + + +H   YG +  +      +  +I  S G  +++ IG   L ++I  VN+LY PL +FLK+ +V
Sbjct:  129 RVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFILATVIM-IMFAFIYNILFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSVEGTPLLT---------------------------------------LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSQKWQLGVAFLPASVSYLIGTNLFGLLANKMG--RWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKNPAV 479          
BLAST of slc18a-5 vs. Ensembl Sea Lamprey
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 90.8929 bits (224), Expect = 9.249e-20
Identity = 81/389 (20.82%), Postives = 166/389 (42.67%), Query Frame = 1
Query:  265 DKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLK 1428
            D  +  ++ IL+ +K I Q++V+   G  +DR+G    LLIG+ +  ++  ++  G  Y  L   R  +G+ S     +  A IA +F  +  R +  G     +     V P +GG +Y++  K + FL++     F    L++++V K    + +E                                    M +G+ I R ++DPY ++   +  +  +    L  T+  ++KK  G  E+Q+G+ W      ++LG  +   L  K    + +   + L +   +S +V A   +     P+C I     + D    P+L+ + + +H   YG +  +     S+  ++   +   ++  +G  +L++ +   N+LY P++  L+
Sbjct:  110 DADEDIRIGILFASKAIVQLLVNPLTGTFIDRVGYDLPLLIGLSIIFLSTAVFAFGESYATLFAARSLQGLGSAFADTAAIAMIADRFTEEAERSRALGIALAFISFGSLVAPPFGGTLYEFVGKRVPFLVLACVSLFD--GLLLMVVAKPFSSRSREN-----------------------------------MPQGTPIYRLMMDPYIVVVAGALTMANIPLAFLEPTIASWMKKTMGANEWQRGMTWLPAFFPHVLGVYITVKLAAKYPQLQWFYGGLGLVIIGSSSCLVPACRTFEELIAPLCGICFGIALVDTALLPLLAFLVDVRHASVYGSVYAIADISYSLAYAMGPIVAGQIVHTMGFVQLSLGMGLTNVLYAPMLLLLR 461          
BLAST of slc18a-5 vs. Ensembl Sea Lamprey
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 50.447 bits (119), Expect = 6.719e-7
Identity = 27/126 (21.43%), Postives = 59/126 (46.83%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLI 660
            ++ +L+  K   Q++ +  IG + +R+G    +  G ++  ++ +++     Y +L L R  +GI S+    +    +A  +   + RG   G     + +   VGP +G  +Y +  K   FL++
Sbjct:  150 RVGLLFAAKATVQLLANPFIGPLTNRVGYHSPMFAGFIIMFLSTIMFAFAQSYPLLFLARALQGIGSSCSSVAGMGMLASLYPDDEERGNAMGVALGGLAMGVLVGPPFGSIMYDFVGKPAPFLVL 275          
BLAST of slc18a-5 vs. Ensembl Medaka
Match: slc18a3b (probable vesicular acetylcholine transporter-B [Source:NCBI gene;Acc:101163117])

HSP 1 Score: 87.0409 bits (214), Expect = 7.565e-18
Identity = 99/467 (21.20%), Postives = 190/467 (40.69%), Query Frame = 1
Query:   79 QFFSNYSQMNRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQN--------LSSFNSSDNVSGFDKFDYS----QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFS 1437
            Q  +     +++   IL+I CV      L+ +  MV  PI P  +   +N        +   N+S N +  DK + +    Q+ +L+ +K I Q++V+   G  +DR+G    LLIG+ +  ++  ++  G  Y  L   R  +G+ S     S  A IA K+  +  R    G     +     V P +GG +Y++  K + FL++            I L +  L++ V     +   SN                           M  G+ I + ++DPY  +   +  V  +    L  T+  +++     T+++ GL W      ++LG  +   L  K  + + +   + + +   +S  V A   +     P+C I     + D    P L+ + + +H   YG +  +     S+  ++   +   ++  +G  +LN+ +  VN+LY P +  L+  S
Sbjct:   27 QLGTAMRDPHQQRRIILVIVCVA---LLLDNMLYMVIVPIIPDYLADLENEQLEHVHVVMHPNTSGNSTSQDKSNKNNLDLQIGVLFASKAILQLLVNPLSGTFIDRVGYDIPLLIGLTVMFISTCIFAFGENYATLFAARSLQGLGSAFADTSGIAMIADKYTEEAERSTALGIALAFISFGSLVAPPFGGVLYEFAGKRVPFLVL----------ASICLADGVLVLTV-----IKPFSNRTRE----------------------NMPVGTPIYKLMVDPYIAVVAGALTVANIPLAFLEPTIANWMETTMHSTQWEMGLTWLPAFFPHVLGVYITVKLAAKNPHLQWFYGALGMVIIGASSCTVPACKTFGQLIAPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYAMGPIVAGQIVHTLGFVQLNLGMGLVNVLYAPALLLLRTVS 453          
BLAST of slc18a-5 vs. Ensembl Medaka
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 85.1149 bits (209), Expect = 2.914e-17
Identity = 99/459 (21.57%), Postives = 185/459 (40.31%), Query Frame = 1
Query:  106 NRRLEFILIIYCVGSGKFCLEFITSMV-TPIFPSVIFKWQNLS------------SFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYI-RFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRR-HYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFS 1437
             R+   IL+I CV      L+ +  MV  PI P  +   Q  +            S NSS   +    FD  Q+ +L+ +K I Q++V+   G  +DR+G    L IG+ +  ++ + +     Y  L L R  +G+ S     S  A IA ++  +  R K  G     +     V P YGG +Y++  K + FL++            I L++  L + V +     +  N                           M  G+ I + ++DPY  +   +  +  +    L  T+  +++     TE++ G+ W      ++LG  L   L  K  + +  Y  + ++F+ + +S  V A   +     P+C +     + D    P L  + + +H   YG +  +      +  ++   +   ++  +G  +LN+ +   N+LY P +  LK+ S
Sbjct:   39 ERQKRIILVIVCVA---LLLDNMLYMVIVPIIPDYLEGLQKAADNAQHAIVRHSNSTNSSTPKAPTGNFDL-QIGVLFASKAIVQLLVNPISGTFIDRVGYDIPLFIGLNVMFLSTLTFAFAENYATLFLARSIQGLGSAFADTSGIALIADRYTEETERSKALGIALAFISFGSLVAPPYGGVLYEFAGKRVPFLIL----------ACICLIDGVLCLTVLKPFSNQERGN---------------------------MPVGTPIYKLMIDPYIAVVAGALIICNIPLAFLEPTIANWMEDTMQATEWEIGMTWFPAFFPHVLGVYLTVKLAAKHPHLQWFYGAMGMVFIGA-SSCTVPACKNFGQLMIPLCGVCFGIALVDTALLPTLGFLVDVRHVSVYGSVYAIADISYCVAYALGPVVAGQIVHNLGFVQLNLGMGLANVLYAPALLLLKNVS 455          
BLAST of slc18a-5 vs. Ensembl Medaka
Match: slc18a2 (solute carrier family 18 member A2 [Source:NCBI gene;Acc:101158793])

HSP 1 Score: 58.5362 bits (140), Expect = 7.442e-9
Identity = 41/168 (24.40%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  166 EFITSMVTPIFPS-VIFKWQNLSSFNSSDNVSGFDKF--DYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLI 660
             F T    P+ P+ V+ K Q     NSSD      +   +  ++ +L+ +K   Q++ +  IG + +RIG    +  G  +  ++ +++   S Y +L L R  +G+ S+    +    +A  +   + RG   G     + L   VGP +G  +Y +  KT  FL++
Sbjct:   94 NFTTRPADPVPPTLVVTKLQQ----NSSDCPQSSSRLLNENVKVGMLFASKATVQLVTNPFIGPLTNRIGYQLPIFAGFCIMFLSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGHAIGIALGGLALGVLVGPPFGSVMYDFVGKTAPFLIL 257          
BLAST of slc18a-5 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 55.4546 bits (132), Expect = 8.701e-8
Identity = 62/297 (20.88%), Postives = 120/297 (40.40%), Query Frame = 1
Query:  187 TPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFH-LIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKL 1074
             P  P +I +  N S     D+V  F + +   + +L+ +K + Q++V+  +G + +R+G    +  G ++  V+ +++     Y +L   R  +GI S+    +    +A  + + + RG   G     + +   +G  +G  +Y +  K   FL++ +   F   + L IL  +K     V+   L+T                                        L DPY LI+  S     M   IL  TLP ++ +     ++Q G+ +   ++ YL+G  L  +L  K+
Sbjct:   58 NPTPPQLINETANSSCLQ--DSV--FLEEENVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMGIALGGLAMGVLIGAPFGSVMYDFVGKRAPFLILALLAVFDGALQLCILQPSKICPGSVEGTPLLT---------------------------------------LLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSPKWQLGVAFLPASISYLIGTNLFGVLANKM 311          
BLAST of slc18a-5 vs. Planmine SMEST
Match: SMESG000024277.1 (SMESG000024277.1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 438/446 (98.21%), Postives = 443/446 (99.33%), Query Frame = 1
Query:  103 MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 1440
            MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFD+FDYS+LSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQ NRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDN NHMETL+NSNKNSSSNIANIKENIKSEVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLT++GYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMLTGTSITSSIWSSLGPILL KIGLFKLNIIIYCVNLLYIPLIFFLKDFSV
Sbjct:    1 MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDQFDYSRLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQGNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNPNHMETLINSNKNSSSNIANIKENIKSEVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTSIGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMLTGTSITSSIWSSLGPILLNKIGLFKLNIIIYCVNLLYIPLIFFLKDFSV 446          
BLAST of slc18a-5 vs. Planmine SMEST
Match: SMESG000024278.1 (SMESG000024278.1)

HSP 1 Score: 290.426 bits (742), Expect = 1.702e-92
Identity = 175/476 (36.76%), Postives = 273/476 (57.35%), Query Frame = 1
Query:  124 ILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLS----SFNSSDNVSGFDK-FDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLV----NKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIR------------------------------FLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDF 1434
            +LII+ +   K+ + FIT MV PIFP++I K  N S    + N S  +S  +  F+Y QLSIL+ TKNICQ+++S  +G+   R+G L  L  G+ LQ V+++ YG G+ YF+LI+GRIFE ++S  I C+VS+++AY++      G  +G   L + + G+ GP+YGG+V+QY+ K + FL +L   T   I ++ L++    NK   I+  +  L  + +  +E   ++    S        +    V+   S+                                FL DPYF+I + ++PV++ + ++ YATLP ++K  FG +E QQG+IW L  VGY +GF+LGN LN K    RH VL+V ++V++  ++ +  MP WW  A P+CLI  Q LVF++   P+L+ I  K+H+ ++G MAG+++   ++TSS  S LGPIL  KIG   LNII+  + L+Y PL+  LK F
Sbjct:   10 LLIIFSISLAKYSVGFITGMVIPIFPTLIDKHFNESLPVPAANFSSEISVLNSSFNYQQLSILFATKNICQILLSPWMGYFCGRLGSLNILFSGVGLQTVSILFYGFGNKYFLLIIGRIFEALASGAINCAVSSFVAYRYTDHKKLGLVYGIGGLGLCIGGASGPAYGGWVFQYHGKLMVFLTVLSMTTVEAILILSLMIANKSNKSHHIETIKNPLCAEINEIVENKFDNEIIISMPNNISISSEGVNVLLDNSFKEPKFGSLLNENGNENNHLSVEKSKPEHNIFYFLSDPYFMICLGAFPVMYFSLFVYYATLPHFMKVTFGASESQQGVIWLLNLVGYFIGFLLGNFLNAKFAKSRHIVLMVTVYVHAIGALCISLMPSWWSIAIPLCLIVNQHLVFEIIIAPLLTSIVAKRHESKFGLMAGIIMMAIALTSSCGSFLGPILFSKIGFLYLNIIVAVMGLVYGPLLLMLKQF 485          
BLAST of slc18a-5 vs. Planmine SMEST
Match: SMESG000069017.1 (SMESG000069017.1)

HSP 1 Score: 93.2041 bits (230), Expect = 6.351e-20
Identity = 114/465 (24.52%), Postives = 213/465 (45.81%), Query Frame = 1
Query:  112 RLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQ-----------LSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVL-YGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVT------DNSNHMETLV-----XXXXXXXXXXXXXXXXXXXXVMNKGS--------YIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPL 1413
            R +++L+I  VG   F +    S +  I P    K+ +  +F   +N S     + S            +S+++ +KN+  + ++  IG I+DR+ +   L+   +L GV+V+L Y   +   + I+GRI +   ++ I  +V + I+  F     R K++G+V+   +++ S+GP YG  V + + K+  FLL LIPI + +  L   L+++R+    K +K V       +N N  +T V      S     S  +   E IK ++ NK S          + L DP  L  +    V+ +  + L  TLP ++  +   +E QQG++WS   +GY+LG  L  I++      R+   V    +     +++     W     P+  ++    V +    P+ + +++  ++  YG M+ L     ++ S I S     + +K G   L I +  +NL + P+
Sbjct:   97 RSDYLLVIIVVGLNFFMMVIEESSLYTILP----KYLSNRTFGEINNYSRIYASNLSMKCVSKDPPYVIISMIFLSKNLATIFINPIIGMILDRMNNFIILIFAQIL-GVSVLLVYAFSNSILMYIIGRIIDAFVTSVIFLAVYSIISQMFLETRIRSKYYGFVNTLFFVSHSLGPVYGASVDEKFGKSAVFLL-LIPI-WSISLLFTYLLHRRIKTINKNKKGVPRFLEIMENHNWNDTRVDSPNNESKNLILSESSEKNETIKVKIENKQSGNHRTLFTIFKMLKDPKVLACLVQIFVVNLCMFSLPPTLPSWMAFKLCSSELQQGIVWSFGFLGYILGVSLVIIIDAYAPRFRNLAPVAGQIIIGIQLIMIPFTRDWRFLFLPIIGMYISVGVVEQIILPLTTYLSDSLYNSNYGTMSSLTSQSLNLCSVISSLCSGPIAEKYGFTTLAIALGIINLSFSPI 554          
BLAST of slc18a-5 vs. Planmine SMEST
Match: SMESG000070401.1 (SMESG000070401.1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.230e-17
Identity = 79/403 (19.60%), Postives = 181/403 (44.91%), Query Frame = 1
Query:  283 QLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYY--SKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMET------------LVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFA-----FPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDF 1434
            ++S + G++++  +I +   G +++  G ++   IG+  +    ++ G  + Y +LI+G+  EG  S+ +  +    I+ KF   + +    G  S+ + L   V P   G +Y+ +     +A  L ++   F  I LI +++NK+ +     +  + + +N +E             L+    +  S    ++    + V       + L+DPY  I +       + +Y L  TL  +L + FG+ E  QGL+W  + +  +  ++LG +L   + ++ +  +++   ++  +++ +  +P WW+       F + L   +FL+      P++  I++ +H+  +G +A ++     I ++        ++ + G   LN+ +     +Y     FLK F
Sbjct:   32 RISFIMGSRSLVHLIFTPIWGILINIFGPIQFGYIGLTTEIFGCLMLGFANTYIMLIIGKCIEGFGSSLVTVAALTIISLKFHDYEEKSCIMGLTSISIVLGNYVSPFVAGILYENFKLDGQMAVYLSMVFCKFINI-LIYVVINKKSVEVEDFKDSIINRNNSIEPDRRSSSLKGTYHLLEKIGSGESLGMMMESEFITHVTETTPIYKLLIDPYIAICILGIIACHLPHYSLLTTLSIWLHERFGVNETIQGLVWVPSFIFNIFTYLLGLVLVKYVPHQGYIFVIISFIISGASNIALPFLPSWWLVMIVLSNFALNLTLVKFLLL-----PLVVMISDLRHNSVHGSVAAIINESMHIGAAFSFFAAGSIVNRFGFLVLNLSVATTAFIYCIFGLFLKPF 428          
BLAST of slc18a-5 vs. Planmine SMEST
Match: SMESG000051356.1 (SMESG000051356.1)

HSP 1 Score: 75.485 bits (184), Expect = 3.174e-14
Identity = 85/422 (20.14%), Postives = 172/422 (40.76%), Query Frame = 1
Query:  181 MVTPIFPSVIFKWQNLSSFNSSDNVSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQGVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGKWFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIILLVNKRLIIKVKERKLVTDNSNHMETLVXXXXXXXXXXXXXXXXXXXXVMNKGSYIRFL-LDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGI-TEFQQGLIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMPYWWMFAF---PVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMXXXXXXXXXXXXXXXPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKD 1431
            ++ PI P  +   +N    N+        +   +Q+ +L+  K I Q++++   G ++DRIG    ++IG+++  V+   +  G    V+ L R  +G+ S     S  A IA +F  + +R    G     +     V P +G  +YQY  K   F  +          L++++   RL     ER+ +    N                           + KG+ I+ L +DPY  I   +  +  ++   L  T+  ++     + +E   GLIW      ++ G  +   L  K    +  +  + L +   + + +   P+   F +   P+ L+     + D    P L  + + +H   YG +  +     S+  +I   +   ++  IG   LNII++ V++ Y P+++ +++
Sbjct:  133 VIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRL-----ERREMKAEGN---------------------------LPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFI---PFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 519          
The following BLAST results are available for this feature:
BLAST of slc18a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC18A38.256e-1222.46solute carrier family 18 member A3 [Source:HGNC Sy... [more]
SLC18A11.426e-821.63solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A11.426e-821.63solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A25.682e-822.26solute carrier family 18 member A2 [Source:HGNC Sy... [more]
SLC18A15.620e-621.90solute carrier family 18 member A1 [Source:HGNC Sy... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cat-11.882e-1522.65pep chromosome:WBcel235:X:5705719:5710585:-1 gene:... [more]
cat-12.457e-1522.65pep chromosome:WBcel235:X:5705719:5710625:-1 gene:... [more]
unc-173.367e-825.40Vesicular acetylcholine transporter unc-17 [Sourc... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAChT9.167e-1621.01gene:FBgn0270928 transcript:FBtr0083671[more]
Vmat9.346e-1222.26gene:FBgn0260964 transcript:FBtr0310062[more]
Vmat9.346e-1222.26gene:FBgn0260964 transcript:FBtr0091491[more]
Vmat9.346e-1222.26gene:FBgn0260964 transcript:FBtr0091493[more]
Vmat1.016e-1122.26gene:FBgn0260964 transcript:FBtr0091492[more]
back to top
BLAST of slc18a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a3a3.153e-1920.47solute carrier family 18 member 3a [Source:NCBI ge... [more]
SLC18A13.171e-1220.96solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a22.575e-1122.11solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
slc18a26.654e-1121.05solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
SLC18A16.783e-1120.71solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a31.473e-1721.72solute carrier family 18 (vesicular acetylcholine ... [more]
ddx428.267e-920.47DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx421.229e-819.46DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx427.268e-725.47DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
ddx427.680e-725.47DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slc18a33.245e-1221.86solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a25.045e-821.89solute carrier family 18 (vesicular monoamine), me... [more]
back to top
BLAST of slc18a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08C75|VACHA_DANRE2.380e-1820.47Probable vesicular acetylcholine transporter-A OS=... [more]
sp|P59845|VACHB_DANRE1.872e-1720.38Probable vesicular acetylcholine transporter-B OS=... [more]
sp|P81721|VACHT_TETCF1.870e-1621.09Vesicular acetylcholine transporter OS=Tetronarce ... [more]
sp|O17444|VACHT_DROME9.189e-1521.01Vesicular acetylcholine transporter OS=Drosophila ... [more]
sp|Q91498|VACHT_TORMA1.114e-1421.61Vesicular acetylcholine transporter OS=Torpedo mar... [more]
back to top
BLAST of slc18a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF280.000e+0100.00Slc18a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YK866.121e-8936.76Slc18a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A4KWG51.833e-2224.79Vesicular acetylcholine transporter OS=Branchiosto... [more]
T1EMB85.278e-2024.30MFS domain-containing protein OS=Helobdella robust... [more]
A0A4D9E5M62.022e-1820.855'-AMP-activated protein kinase subunit beta-1 OS=... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a3b1.773e-1320.40solute carrier family 18 member 3b [Source:NCBI ge... [more]
slc18a22.782e-1222.00synaptic vesicular amine transporter [Source:NCBI ... [more]
SLC18A11.011e-1020.66solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a3a4.135e-919.23solute carrier family 18 member A3 [Source:NCBI ge... [more]
SLC18A11.170e-721.37solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc18a3a9.249e-2020.82solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18a26.719e-721.43solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc18a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc18a3b7.565e-1821.20probable vesicular acetylcholine transporter-B [So... [more]
slc18a3a2.914e-1721.57solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18a27.442e-924.40solute carrier family 18 member A2 [Source:NCBI ge... [more]
SLC18A18.701e-820.88solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024277.10.000e+098.21SMESG000024277.1[more]
SMESG000024278.11.702e-9236.76SMESG000024278.1[more]
SMESG000069017.16.351e-2024.52SMESG000069017.1[more]
SMESG000070401.13.230e-1719.60SMESG000070401.1[more]
SMESG000051356.13.174e-1420.14SMESG000051356.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006235
GenBankAKN21540.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006235 ID=SMED30006235|Name=slc18a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1500bp
CAGTTACGTTTGCATAGGCTACTTTCTGTTCATTTGTAATCAATAATTTC
TACTCGAGATGTAACTGAAATTTTATTACAATTCTTTTCAAACTACTCAC
AAATGAATCGCAGATTAGAATTCATATTAATCATATATTGTGTTGGAAGT
GGCAAATTTTGCTTGGAATTTATAACATCAATGGTAACTCCAATATTTCC
AAGCGTGATTTTCAAATGGCAAAATCTGTCATCATTCAACAGTTCAGACA
ATGTTTCTGGATTTGACAAATTCGATTATAGTCAACTTTCAATTCTATAC
GGAACGAAAAACATTTGCCAAGTGATAGTCAGTATGACAATCGGTTTCAT
TGTCGATCGAATTGGAGATCTTGAAACTTTGCTCATTGGAATGATGCTTC
AAGGTGTTGCTGTTGTTTTGTATGGGGTTGGATCGGTTTATTTTGTTTTG
ATTCTGGGTCGAATATTTGAAGGAATAAGCTCCACCACAATCCAATGCTC
AGTTTCCGCCTATATAGCTTATAAGTTCAAATCCCAAGACAATCGAGGAA
AATGGTTTGGTTATGTCTCACTATGTATGTATTTGGCAGGATCGGTTGGG
CCAAGTTATGGTGGATTTGTCTATCAATATTATAGCAAAACGTTAGCATT
TCTTTTAATTTTAATTCCTATTACTTTTCACTTGATACCTTTGATCATAT
TGTTGGTTAATAAAAGGCTAATAATCAAAGTAAAAGAACGCAAATTAGTT
ACAGATAACTCAAATCACATGGAAACTTTGGTTAACTCAAATAAGAATTC
ATCGAGCAACATTGCAAATATTAAAGAAAACATTAAATCTGAAGTAATGA
ACAAAGGTAGCTATATCCGATTTTTACTTGATCCTTATTTTCTGATTGCT
ATGAATAGTTACCCCGTTCTTTTTATGACCTATTACATACTTTATGCTAC
TTTGCCAAGGTATTTGAAGAAAGAGTTTGGAATTACAGAGTTTCAGCAAG
GATTGATTTGGTCTTTGACAGCAGTAGGGTATTTGTTAGGATTTATTCTG
GGAAACATTTTGAATACAAAACTGCAAAATCGTCGACATTATGTTTTGGT
TGTGATTTTATTCGTCAATTCGTTTACGAGCGTAATCGTTTGTGCGATGC
CCTATTGGTGGATGTTTGCCTTTCCGGTCTGTCTTATTTTCACACAATTT
TTAGTTTTCGATATGTTTTGTCCGCCGATTTTGTCGAAAATAACAGAAAA
GAAACATGATAAACAATATGGAAAAATGGCAGGTTTGATGTTAACAGGAA
CCTCAATCACTTCATCAATATGGTCATCATTAGGTCCGATTTTATTAAAG
AAAATAGGGTTGTTTAAGTTGAATATCATAATATATTGTGTGAATCTTTT
ATATATTCCTTTGATATTCTTTTTGAAAGATTTTTCTGTAAAATAGAATT
TTATTTTTAGAAAGATTATTAGGATAGATTTCGAAAATATTTTATTTTTG
back to top

protein sequence of SMED30006235-orf-1

>SMED30006235-orf-1 ID=SMED30006235-orf-1|Name=SMED30006235-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
KNKIFSKSILIIFLKIKFYFTEKSFKKNIKGIYKRFTQYIMIFNLNNPIF
FNKIGPNDDHIDEVIEVPVNIKPAIFPYCLSCFFSVIFDKIGGQNISKTK
NCVKIRQTGKANIHQ*
back to top

protein sequence of SMED30006235-orf-2

>SMED30006235-orf-2 ID=SMED30006235-orf-2|Name=SMED30006235-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MNRRLEFILIIYCVGSGKFCLEFITSMVTPIFPSVIFKWQNLSSFNSSDN
VSGFDKFDYSQLSILYGTKNICQVIVSMTIGFIVDRIGDLETLLIGMMLQ
GVAVVLYGVGSVYFVLILGRIFEGISSTTIQCSVSAYIAYKFKSQDNRGK
WFGYVSLCMYLAGSVGPSYGGFVYQYYSKTLAFLLILIPITFHLIPLIIL
LVNKRLIIKVKERKLVTDNSNHMETLVNSNKNSSSNIANIKENIKSEVMN
KGSYIRFLLDPYFLIAMNSYPVLFMTYYILYATLPRYLKKEFGITEFQQG
LIWSLTAVGYLLGFILGNILNTKLQNRRHYVLVVILFVNSFTSVIVCAMP
YWWMFAFPVCLIFTQFLVFDMFCPPILSKITEKKHDKQYGKMAGLMLTGT
SITSSIWSSLGPILLKKIGLFKLNIIIYCVNLLYIPLIFFLKDFSVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 17..406
e-value: 4.2E-30
score: 104.9
NoneNo IPR availablePANTHERPTHR23506FAMILY NOT NAMEDcoord: 8..442
NoneNo IPR availableCDDcd17325MFS_MdtG_SLC18_likecoord: 19..442
e-value: 1.73537E-23
score: 99.1876
NoneNo IPR availableTMHMMTMhelixcoord: 258..280
NoneNo IPR availableTMHMMTMhelixcoord: 419..441
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 329..346
NoneNo IPR availableTMHMMTMhelixcoord: 393..415
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 151..170
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 10..446
score: 12.845
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 11..442