Dual specificity protein kinase TTK

Overview
NameDual specificity protein kinase TTK
Smed IDSMED30006226
Length (bp)2260
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity protein kinase TTK (SMED30006226) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity protein kinase TTK (SMED30006226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity protein kinase TTK (SMED30006226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity protein kinase TTK (SMED30006226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006226h1SMcG0018098 SmedASXL_016241SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006226h1SMcG0018098 dd_Smed_v4_13043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006226h1SMcG0018098 dd_Smed_v4_13043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006226h1SMcG0018098 dd_Smed_v6_13043_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006226h1SMcG0018098 dd_Smed_v4_13043_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Match: K1P9K3 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10015285 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.535e-80
Identity = 153/470 (32.55%), Postives = 269/470 (57.23%), Query Frame = 1
Query:  157 YADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFI-DGQDKIAKDQYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIHSTNASTV---DPT-AESSKWKHWFDSIHHINPIS-PQD 1548
            Y  WL +    I  SK+WN+F+ +LHDA+  QL+E+++  F +L + EK + M +A ++L GG SY  +  ++S  +D  +N E  R + L+ +P  T+++ I+ +A EG +S+L +WPD++ KL    N  LP  LR   W+  L +++V   Y  ++  N + AIS+YD +ISQ C++LLN+E    ++KGSVG FYGMKAVLSY  +S     +L+  D+L V+P V V  + +  +EPP  +V+ +LV+E+ T    +     F+ D   ++  ++ R F  +V   + +    S +++++   PS++ IVATE     +  E +  +  P++ SLFV YL   +LL+VWD Y++G D   F  + W  I  + +  + + +I    ++ +    + +L+TE  +L    FQ+++ + +Y ++  +I   + + +   DPT A+   W+HW++ +  I P + PQD
Sbjct:    9 YPKWLLNCKQGINDSKDWNIFVRELHDAIQQQLTESHVQYFSDLSEAEKELFMQRATKALEGGTSYNNMMKKVSVVMDQSLNEEVSRQL-LEESPMDTKSDLIIESAEEGTLSLLKKWPDMKEKLQVCLNQPLPTQLRQVAWRLYLSDTKVRKKYIDLLNTNPRAAISQYDYEISQKCDQLLNSEPTFADLKGSVGNFYGMKAVLSYHHSSQKTQNRLRDVDHLLVVPFVEVARSSMPKKEPPAGRVVALLVEEFETF---MKQRPGFVEDSGSELHNEEVRAFIDKVATMLTAKYPESVKNIVEKFSPSKEKIVATEAGNQAVLREGLMAICRPMLRSLFVSYLNPNTLLYVWDNYIIGLDTPGFTTE-WLAIVLVTILALTKDKI---KEATSPASLEKILKTESCRLTVPQFQYEVKQHYYKDLFSMITRDSKAAIPVLDPTQAQHPPWRHWYNDV--IPPFTKPQD 468          
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Match: A0A267H4N0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024223g2 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 7.040e-78
Identity = 158/521 (30.33%), Postives = 271/521 (52.02%), Query Frame = 1
Query:  166 WLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKD--------QYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDM--AGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIH-STNASTVDPTAESSK----------WKHWFDSIHHINPISPQDRNDMRILREKEREKFNDLQMKLEAVKTDKLKMQQNLEVQ 1665
            WLN S  ++  +KEWN F+ +L DA+  QL E+++  F +L + EK +   K L+ LSGG +++ + + +S+A +  +N +  +   L+ +P+QTR+E I     EGI+S+L +WPDL+S+  +  N +LP  LRLHVW+    N  VL  Y RI+ +N + AIS  D  IS+ C+++L+ E  L +M GS G +Y MKAVLSY+ A      +L  S+ L + P + V+ ++++  EPP   V+EVLVQEYFT          F+ G+ K   D          ++F  +V       D          + P +++      +  DM  AG ++  L+  L+   FVG L M++LLF+WDQY++  D    +E++  +    +  L+            N+   +  L+TEG+KL   DFQ+ IN+ ++ ++ R+I+    A  +DPT   +           W+ W       + +   +R   R+ RE ++++   L+ +L   +  +   ++ L ++
Sbjct:   12 WLNKSVDDVATTKEWNGFLGELQDAIQQQLVESHVQQFTDLSEAEKILFEEKGLRMLSGGETHQQLFHALSRATETNLNDQVSKEFELN-SPYQTRSEAIHAGVVEGIVSLLYKWPDLKSQFVRFLNQSLPLGLRLHVWRVYFNNEYVLQQYHRILHSNPQQAISIDDYGISERCKQILSKEPSLKDMHGSTGAWYAMKAVLSYYHAMKSSQQRLTDSEILLIAPFLQVIQHRIARHEPPPTAVVEVLVQEYFT----------FMSGRPKFMVDTGHEENESALKHFTARVIALARQADAEIINVFAAALAPGREHGADFSDQDDDMYLAGAMM-PLMKTLLKPFFVGILGMDALLFIWDQYVVSLDMPGLQEEFVAIAVACYFILMK----APLKAGANLAAFEKALKTEGLKLLARDFQYLINRFYFSDLYRLINFDKTAPILDPTQNPNTGRVDGGIQPNWRQWLVEEGRTDRVRSDEREHRRVQREADKQRIFGLEDELHRSEVKREAAEEALRIE 516          
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Match: A0A267GSL7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024223g1 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 6.433e-77
Identity = 158/521 (30.33%), Postives = 271/521 (52.02%), Query Frame = 1
Query:  166 WLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKD--------QYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDM--AGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIH-STNASTVDPTAESSK----------WKHWFDSIHHINPISPQDRNDMRILREKEREKFNDLQMKLEAVKTDKLKMQQNLEVQ 1665
            WLN S  ++  +KEWN F+ +L DA+  QL E+++  F +L + EK +   K L+ LSGG +++ + + +S+A +  +N +  +   L+ +P+QTR+E I     EGI+S+L +WPDL+S+  +  N +LP  LRLHVW+    N  VL  Y RI+ +N + AIS  D  IS+ C+++L+ E  L +M GS G +Y MKAVLSY+ A      +L  S+ L + P + V+ ++++  EPP   V+EVLVQEYFT          F+ G+ K   D          ++F  +V       D          + P +++      +  DM  AG ++  L+  L+   FVG L M++LLF+WDQY++  D    +E++  +    +  L+            N+   +  L+TEG+KL   DFQ+ IN+ ++ ++ R+I+    A  +DPT   +           W+ W       + +   +R   R+ RE ++++   L+ +L   +  +   ++ L ++
Sbjct:   12 WLNKSVDDVATTKEWNGFLGELQDAIQQQLVESHVQQFTDLSEAEKILFEEKGLRMLSGGETHQQLFHALSRATETNLNDQVSKEFELN-SPYQTRSEAIHAGVVEGIVSLLYKWPDLKSQFVRFLNQSLPLGLRLHVWRVYFNNEYVLQQYHRILHSNPQQAISIDDYGISERCKQILSKEPSLKDMHGSTGAWYAMKAVLSYYHAMKSSQQRLTDSEILLIAPFLQVIQHRIARHEPPPTAVVEVLVQEYFT----------FMSGRPKFMVDTGHEENESALKHFTARVIALARQADAEIINVFAAALAPGREHGADFSDQDDDMYLAGAMM-PLMKTLLKPFFVGILGMDALLFIWDQYVVSLDMPGLQEEFVAIAVACYFILMK----APLKAGANLAAFEKALKTEGLKLLARDFQYLINRFYFSDLYRLINFDKTAPILDPTQNPNTGRVDGGIQPNWRQWLVEEGRTDRVRSDEREHRRVQREADKQRIFGLEDELHRSEVKREAAEEALRIE 516          
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Match: A0A1S3HB64 (uncharacterized protein LOC106153737 OS=Lingula unguis OX=7574 GN=LOC106153737 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 3.486e-76
Identity = 148/460 (32.17%), Postives = 259/460 (56.30%), Query Frame = 1
Query:  139 MSLDVIYADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKDQYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIH---STNASTVDPT-AESSKWKHW 1506
            M+    +  WL      I +S++W  F+A+LH+ +  QL+E+++  F +L D EK + M +A  +L GG +Y+ +  ++S  +D  +++E  R + L+ +P  T+T+ IL  A EG + IL +WPDL+SKL   FN +LP  LR  VW+  L +++    Y  I+  N + A+S+ D +ISQ CE LLN+E+ + E++GSVG FYGMKAVLSY+ +     + L   +Y+ ++P++Y     +S R+PP   V+ +LV+EY +L    S     +D    I  ++ + F  +V + I   D   A  L    IPS+  I+ TE     +  E +  L+ P + +LFVG+L ++++L++WDQY++G D   +  +  P+ T +++ L+  +  + R   ++ + T  +L+     +K   FQ+ +N+ FY ++  +++    T    +DPT  +   W HW
Sbjct:    1 MAAKGGFPSWLLDGKERISSSQDWKAFVAELHEVIQQQLTESHVQQFTDLSDAEKTLFMERAAMALQGGQAYDALYAKVSLTMDQCLSNEIAREL-LEESPINTKTDLILNNAKEGSVGILKKWPDLKSKLHVCFNQSLPWALRHIVWRLFLSSTKARKEYVDILSTNPRAAMSELDLEISQKCENLLNSETTVEELRGSVGAFYGMKAVLSYYHSRKQSRVSLTDIEYMLMLPLIYTASKSISRRDPPPSHVVAMLVEEYISLME--SRPGYVVDSGSDIHDEEMKSFTFKVAQIIQERDSDLAIKLGQACIPSE-KIITTEAARQSVFEEGLTTLVRPCIKALFVGFLNIDTVLYIWDQYIIGLDVPGYHTECLPVFTVVYLMLL--KDQLMRCDDISAMET--VLKEGSRNIKTSQFQYLVNRFFYRDLYGLLNKDEKTGLPVLDPTQTKYPPWHHW 452          
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Match: A0A1I8JC30 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 4.410e-75
Identity = 158/521 (30.33%), Postives = 271/521 (52.02%), Query Frame = 1
Query:  166 WLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKD--------QYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDM--AGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIH-STNASTVDPTAESSK----------WKHWFDSIHHINPISPQDRNDMRILREKEREKFNDLQMKLEAVKTDKLKMQQNLEVQ 1665
            WLN S  ++  +KEWN F+ +L DA+  QL E+++  F +L + EK +   K L+ LSGG +++ + + +S+A +  +N +  +   L+ +P+QTR+E I     EGI+S+L +WPDL+S+  +  N +LP  LRLHVW+    N  VL  Y RI+ +N + AIS  D  IS+ C+++L+ E  L +M GS G +Y MKAVLSY+ A      +L  S+ L + P + V+ ++++  EPP   V+EVLVQEYFT          F+ G+ K   D          ++F  +V       D          + P +++      +  DM  AG ++  L+  L+   FVG L M++LLF+WDQY++  D    +E++  +    +  L+            N+   +  L+TEG+KL   DFQ+ IN+ ++ ++ R+I+    A  +DPT   +           W+ W       + +   +R   R+ RE ++++   L+ +L   +  +   ++ L ++
Sbjct:   12 WLNKSVDDVATTKEWNGFLGELQDAIQQQLVESHVQQFTDLSEAEKILFEEKGLRMLSGGETHQQLFHALSRATETNLNDQVSKEFELN-SPYQTRSEAIHAGVVEGIVSLLYKWPDLKSQFVRFLNQSLPLGLRLHVWRVYFNNEYVLQQYHRILHSNPQQAISIDDYGISERCKQILSKEPSLKDMHGSTGAWYAMKAVLSYYHAMKSSQQRLTDSEILLIAPFLQVIQHRIARHEPPPTAVVEVLVQEYFT----------FMSGRPKFMVDTGHEENESALKHFTARVIALARQADAEIINVFAAALAPGREHGADFSDQDDDMYLAGAMM-PLMKTLLKPFFVGILGMDALLFIWDQYVVSLDMPGLQEEFVAIAVACYFILMK----APLKAGANLAAFEKALKTEGLKLLARDFQYLINRFYFSDLYRLINFDKTAPILDPTQNPNTGRVDGGIQPNWRQWLVEEGRTDRVRSDEREHRRVQREADKQRIFGLEDELHRSEVKREAAEEALRIE 516          
BLAST of Dual specificity protein kinase TTK vs. Planmine SMEST
Match: SMESG000038939.1 (SMESG000038939.1)

HSP 1 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 483/484 (99.79%), Postives = 483/484 (99.79%), Query Frame = 1
Query:  139 MSLDVIYADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKDQYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIHSTNASTVDPTAESSKWKHWFDSIHHINPISPQDRNDMRILREKEREK 1590
            MSLDVIYADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLS GLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKDQYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIHSTNASTVDPTAESSKWKHWFDSIHHINPISPQDRNDMRILREKEREK
Sbjct:    1 MSLDVIYADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNLLDHEKAIMMNKALQSLSSGLSYEIIQNRISQALDVQINHEAERIIRLDVNPFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKAILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGSVGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPTIKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKDQYRYFCQQVYRNIVSVDVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYLPMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVNVVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIHSTNASTVDPTAESSKWKHWFDSIHHINPISPQDRNDMRILREKEREK 484          
BLAST of Dual specificity protein kinase TTK vs. Planmine SMEST
Match: SMESG000038940.1 (SMESG000038940.1)

HSP 1 Score: 313.923 bits (803), Expect = 1.237e-102
Identity = 202/205 (98.54%), Postives = 203/205 (99.02%), Query Frame = 1
Query: 1642 MQQNLEVQAQIYMSNYETVVNXXXXXXXXXXXDIEQLXXXXXXXXXTVQTLRDELEKTKQMILRSSTVENLRGLVXXXXXXXXXXXXXXXXXXXYENYFPDQSLMLTEDFVTQLANNYQIILHGEGKEKFELNDETMKFLNLYEEDKKEAEVELFDRVLNPEELERLDNANDGYYSQKIYQEIAKKTNDRRQKSNNLANAFDPNL 2256
            MQQNLEVQAQIYMSNYETVVNKYKSDTKKLKKDIEQLNNENN+ANNTVQTLRDELEKTKQMILRSSTVENLRGLVPPPVSPRSHISSRRRSPGSYENYF DQS MLTEDFVTQLANNYQIILHGEGKEKFELNDETMKFLNLYEEDKKEAEVELFDRVLNPEELERLDNANDGYYSQKIYQEIAKKTNDRRQKSNNLANAFDPNL
Sbjct:    1 MQQNLEVQAQIYMSNYETVVNKYKSDTKKLKKDIEQLNNENNDANNTVQTLRDELEKTKQMILRSSTVENLRGLVPPPVSPRSHISSRRRSPGSYENYFTDQSPMLTEDFVTQLANNYQIILHGEGKEKFELNDETMKFLNLYEEDKKEAEVELFDRVLNPEELERLDNANDGYYSQKIYQEIAKKTNDRRQKSNNLANAFDPNL 205          
The following BLAST results are available for this feature:
BLAST of Dual specificity protein kinase TTK vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1P9K31.535e-8032.55Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A267H4N07.040e-7830.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GSL76.433e-7730.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3HB643.486e-7632.17uncharacterized protein LOC106153737 OS=Lingula un... [more]
A0A1I8JC304.410e-7530.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dual specificity protein kinase TTK vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000038939.10.000e+099.79SMESG000038939.1[more]
SMESG000038940.11.237e-10298.54SMESG000038940.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006226 ID=SMED30006226|Name=Dual specificity protein kinase TTK|organism=Schmidtea mediterranea sexual|type=transcript|length=2260bp
GTTACTTTAGCATTAAAATTTTGTATATCTTTTAAATAGAAAGTTTTCAT
TGACAATTCATTTCTAATATTATTTAAGTTTATATAATAGAAAATATTAA
TATTACGAAGTTATAAATAATATATAAATAAAATAATAATGAGTTTAGAT
GTCATTTATGCTGACTGGTTAAATTCTTCTTTCCACAATATTTTAGCATC
AAAAGAATGGAACGTTTTCATAGCAGACTTACACGATGCAGTAGATCATC
AGTTATCGGAAAACAACATCGACAATTTCCATAATCTATTAGACCATGAA
AAAGCAATAATGATGAACAAGGCATTACAGTCATTGTCCGGCGGTCTCAG
TTATGAAATCATTCAAAATCGAATATCGCAAGCTCTTGATGTGCAAATCA
ATCACGAAGCCGAAAGAATAATTCGATTGGATGTCAATCCGTTTCAAACG
AGAACCGAAACAATTTTAACTGCGGCTTTCGAAGGAATTATTTCGATTCT
TAATAGATGGCCCGATTTAAGAAGTAAACTATCGAAAATGTTCAATCTTA
ATCTGCCTAATCATTTGCGACTACACGTTTGGAAAGCAATTCTTGAAAAT
TCTGAAGTCCTTTCTACGTACCAAAGAATAATGCGGGCCAATTCTAAAAA
TGCAATATCTAAATATGATAAAGACATTTCTCAATACTGCGAAAGACTCC
TTAATAATGAATCATATCTTTTCGAAATGAAGGGAAGTGTTGGCTGTTTC
TATGGAATGAAAGCTGTTTTATCCTATTTTCAAGCATCGACTATGGACAA
TCTAAAGCTGCAAAAGTCGGATTATTTATTTGTCATTCCGATCGTTTATG
TTTTGCATAATAAATTATCCTTGCGAGAACCACCGACAATTAAAGTGATG
GAAGTGCTTGTGCAAGAATATTTCACCTTACGACATGTAATTTCAGTAGA
TTTCCCATTCATAGATGGACAGGATAAAATTGCCAAGGACCAATATCGAT
ACTTTTGTCAACAGGTTTATAGAAACATCGTCTCAGTTGACGTAAGCTCA
GCTCAAAGTTTGATGGATCACATGATTCCTTCTCAAGACAATATAGTTGC
TACAGAAGTGAAGCTTTTTGACATGGCTGGTGAAATTATTGAAAAGCTTT
TATGGCCCTTAGTGTCATCATTATTTGTGGGTTATCTACCAATGGAATCT
TTGCTTTTCGTTTGGGACCAATACCTACTCGGATTTGACAAACAGGCTTT
CCGAGAAAAGTATTGGCCAATGATAACTGGGATTTTTGTAGAACTGATAG
TCCGTCGACGAATCATTAATCGGAATCAATCCGTAAATGTTGTTCTGACA
GATGATTTATTAAGAACGGAAGGAATGAAATTAAAACCATTTGATTTCCA
ATTTCAAATAAACAAAAGTTTTTATGTTGAAATGATGCGTATTATCCATT
CTACCAATGCCTCTACGGTTGATCCAACTGCAGAATCCTCAAAATGGAAA
CACTGGTTCGATTCGATTCATCATATCAATCCAATATCACCACAAGATCG
AAATGATATGAGAATTCTCCGAGAAAAAGAAAGAGAAAAGTTTAATGATC
TCCAAATGAAACTGGAAGCCGTCAAAACGGACAAATTGAAAATGCAACAG
AATTTAGAGGTTCAAGCTCAGATTTACATGTCAAATTATGAAACAGTGGT
GAATAAATATAAAAGTGACACAAAAAAATTGAAAAAGGACATTGAACAAC
TGAATAATGAAAATAATGAGGCAAATAACACAGTTCAAACTTTGAGAGAT
GAACTAGAAAAAACTAAACAAATGATATTAAGAAGTTCAACGGTAGAAAA
TTTGCGAGGCCTTGTGCCTCCTCCCGTTAGTCCAAGAAGTCATATTTCCA
GTAGACGCCGTTCACCTGGAAGCTACGAGAACTATTTCCCCGACCAATCA
CTTATGCTTACCGAGGATTTCGTTACTCAATTGGCCAATAATTATCAAAT
AATACTTCACGGAGAAGGAAAAGAAAAATTTGAATTAAACGATGAGACCA
TGAAATTTTTAAATTTATATGAGGAGGATAAAAAAGAAGCTGAGGTGGAA
TTATTTGATCGAGTTCTGAATCCAGAAGAATTGGAACGGCTGGATAATGC
AAATGATGGATATTATTCACAGAAAATCTATCAAGAAATAGCAAAGAAGA
CAAATGATAGAAGACAAAAATCAAACAATTTAGCGAATGCCTTTGACCCA
AACCTTTGAG
back to top

protein sequence of SMED30006226-orf-1

>SMED30006226-orf-1 ID=SMED30006226-orf-1|Name=SMED30006226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=707bp
MSLDVIYADWLNSSFHNILASKEWNVFIADLHDAVDHQLSENNIDNFHNL
LDHEKAIMMNKALQSLSGGLSYEIIQNRISQALDVQINHEAERIIRLDVN
PFQTRTETILTAAFEGIISILNRWPDLRSKLSKMFNLNLPNHLRLHVWKA
ILENSEVLSTYQRIMRANSKNAISKYDKDISQYCERLLNNESYLFEMKGS
VGCFYGMKAVLSYFQASTMDNLKLQKSDYLFVIPIVYVLHNKLSLREPPT
IKVMEVLVQEYFTLRHVISVDFPFIDGQDKIAKDQYRYFCQQVYRNIVSV
DVSSAQSLMDHMIPSQDNIVATEVKLFDMAGEIIEKLLWPLVSSLFVGYL
PMESLLFVWDQYLLGFDKQAFREKYWPMITGIFVELIVRRRIINRNQSVN
VVLTDDLLRTEGMKLKPFDFQFQINKSFYVEMMRIIHSTNASTVDPTAES
SKWKHWFDSIHHINPISPQDRNDMRILREKEREKFNDLQMKLEAVKTDKL
KMQQNLEVQAQIYMSNYETVVNKYKSDTKKLKKDIEQLNNENNEANNTVQ
TLRDELEKTKQMILRSSTVENLRGLVPPPVSPRSHISSRRRSPGSYENYF
PDQSLMLTEDFVTQLANNYQIILHGEGKEKFELNDETMKFLNLYEEDKKE
AEVELFDRVLNPEELERLDNANDGYYSQKIYQEIAKKTNDRRQKSNNLAN
AFDPNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 478..505
NoneNo IPR availableCOILSCoilCoilcoord: 521..562
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..706