Cyclin dependent kinase like 1

Overview
NameCyclin dependent kinase like 1
Smed IDSMED30006225
Length (bp)1501
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclin dependent kinase like 1 (SMED30006225) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclin dependent kinase like 1 (SMED30006225) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclin dependent kinase like 1 (SMED30006225) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclin dependent kinase like 1 (SMED30006225) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006225

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006225SMESG000038932.1 SmedASXL_009288SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30006225SMESG000038932.1 dd_Smed_v4_13082_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006225SMESG000038932.1 dd_Smed_v6_13082_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30006225SMESG000038932.1 SMED30006225smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Match: CDKL1 (cyclin dependent kinase like 1 [Source:HGNC Symbol;Acc:HGNC:1781])

HSP 1 Score: 353.984 bits (907), Expect = 1.281e-118
Identity = 175/335 (52.24%), Postives = 236/335 (70.45%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP-RWHCEANRKQILFTDQNKKVAKLPSL 1257
            M +KYE++ K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+     + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G ++P+P +++PLE  F      IS   + +L GC  MDP +R+TC+ LL   YF N+   E + +  N P R     +RK   FT+ + K+  LP L
Sbjct:    1 MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPN----ISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETS-KLQYLPQL 330          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Match: CDKL4 (cyclin dependent kinase like 4 [Source:HGNC Symbol;Acc:HGNC:19287])

HSP 1 Score: 342.428 bits (877), Expect = 1.077e-113
Identity = 172/377 (45.62%), Postives = 238/377 (63.13%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFT 1395
            +KYE+L K GEG+YG VFKCR K +G++VA+K+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  +    +KS+L+Q +Q + +CH  N IHRDIKPENIL+T+   +KICDFGFA+ L   + YTDYVATRWYR+PELLVGD  YG  VD+WAIGCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  F+ N +F G  +PEP +++ LEE F   + +     +  + GC +M+P  R+TC  LL+ SYF +   ++   +  N  R     NR++     Q    +  P L       Q+  +   T+ N            ++LP  P++Q    T
Sbjct:    2 EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRKARNEGR-----NRRR----QQQAPKSAFPRLFLKTKICQVQRNETQTSGN------------QILPNGPILQNSMVT 353          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Match: CDKL4 (cyclin dependent kinase like 4 [Source:HGNC Symbol;Acc:HGNC:19287])

HSP 1 Score: 339.347 bits (869), Expect = 1.821e-113
Identity = 162/317 (51.10%), Postives = 220/317 (69.40%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQIL 1215
            +KYE+L K GEG+YG VFKCR K +G++VA+K+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  +    +KS+L+Q +Q + +CH  N IHRDIKPENIL+T+   +KICDFGFA+ L   + YTDYVATRWYR+PELLVGD  YG  VD+WAIGCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  F+ N +F G  +PEP +++ LEE F   + +     +  + GC +M+P  R+TC  LL+ SYF +   ++   +  N  R      R+Q+L
Sbjct:    2 EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRKARNEGR---NRRRQQVL 311          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Match: CDKL1 (cyclin dependent kinase like 1 [Source:HGNC Symbol;Acc:HGNC:1781])

HSP 1 Score: 318.931 bits (816), Expect = 4.224e-106
Identity = 148/259 (57.14%), Postives = 198/259 (76.45%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNY 1032
            M +KYE++ K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+     + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G ++P+P +++PLE  F   +Y
Sbjct:    1 MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISY 259          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Match: CDKL2 (cyclin dependent kinase like 2 [Source:HGNC Symbol;Acc:HGNC:1782])

HSP 1 Score: 293.123 bits (749), Expect = 5.408e-93
Identity = 150/330 (45.45%), Postives = 215/330 (65.15%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGT-DNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFT--DQNKKVAK 1245
            +KYE L  +GEG+YG V KCR KDTG +VAIK+F E D    +  +A+REI++L+ LRH NLV+L+E+ K+K   +LVF+++DHT+L +LE  P  L+   ++  L+QI+ GI +CH  NIIHRDIKPENIL++++  VK+CDFGFAR L     +YTDYVATRWYR+PELLVGD+ YG  VDVWAIGC+  EM    PL+PG SD+DQL+ I+  LG+L   H++ F +N  F G ++PE    +PLE  + + + ++    I +   C  +DP KR  C  LL   +F  ++G     R+S   +   + + + +  +   QN+K  K
Sbjct:    2 EKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQLYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVV----IDLAKKCLHIDPDKRPFCAELLHHDFF-QMDGFAE--RFSQELQLKVQKDARNVSLSKKSQNRKKEK 324          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 326.25 bits (835), Expect = 3.251e-108
Identity = 152/291 (52.23%), Postives = 202/291 (69.42%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCN 1137
            DKY+RL KLGEG+YG V+KC+ +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV LIE+FKR   +HLVF+  D T+L ELE  P+ +N   +K I+YQ+++ +++CH    IHRD+KPENI LT N QVK+ DFGFAR + T  +YTDYVATRWYRSPELLVGD+ YGPPVD+WA+GCV+AE++    LWPG+SD+DQL+ I  TLG     H   FR N++F G  +PEP +L+PL           S  ++  L  CFEM P +R +C  L+    F N
Sbjct:    2 DKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKLPNA----SSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSN 288          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 327.02 bits (837), Expect = 4.804e-108
Identity = 152/291 (52.23%), Postives = 202/291 (69.42%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCN 1137
            DKY+RL KLGEG+YG V+KC+ +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV LIE+FKR   +HLVF+  D T+L ELE  P+ +N   +K I+YQ+++ +++CH    IHRD+KPENI LT N QVK+ DFGFAR + T  +YTDYVATRWYRSPELLVGD+ YGPPVD+WA+GCV+AE++    LWPG+SD+DQL+ I  TLG     H   FR N++F G  +PEP +L+PL           S  ++  L  CFEM P +R +C  L+    F N
Sbjct:   32 DKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKLPNA----SSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSN 318          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 330.102 bits (845), Expect = 6.508e-108
Identity = 152/291 (52.23%), Postives = 202/291 (69.42%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCN 1137
            DKY+RL KLGEG+YG V+KC+ +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV LIE+FKR   +HLVF+  D T+L ELE  P+ +N   +K I+YQ+++ +++CH    IHRD+KPENI LT N QVK+ DFGFAR + T  +YTDYVATRWYRSPELLVGD+ YGPPVD+WA+GCV+AE++    LWPG+SD+DQL+ I  TLG     H   FR N++F G  +PEP +L+PL           S  ++  L  CFEM P +R +C  L+    F N
Sbjct:  133 DKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLVGLIEVFKRNRKLHLVFELCDRTVLHELEKNPHGVNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMYTDYVATRWYRSPELLVGDVQYGPPVDIWAVGCVYAELLTGEALWPGRSDIDQLYHIRKTLGEFLPRHISIFRTNQFFFGLSIPEPEHLEPLPSKLPNA----SSAQLDFLQKCFEMSPDRRFSCSELMLHGIFSN 419          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 206.068 bits (523), Expect = 3.116e-60
Identity = 105/298 (35.23%), Postives = 176/298 (59.06%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLK-------PLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            + D+Y    +LG+G +G V   +  DTG+ VAIKR  +    +    M++RE++ L+ L HPN++ L E+ +    ++ VF+++   L + ++ +     +S +++I+YQ++QG+ + H++   HRD+KPENI+      VKI DFG AR + +   YTDYV+TRWYR+PE+L+    Y  P+D+WA+GC+ AE+  + PL+PG S++DQLF II+ LG        T  ++++ EG+Q+    N +       P+E    Q    ISKE +K++      +P+KR   +  L+  YF
Sbjct:    7 LADRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKK-KFYSWEEAMSLREVKSLKKLNHPNIIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILG--------TPNKDEWPEGYQLASAMNFRFQQVVATPME----QVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYF 291          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Match: dyf-5 (Serine/threonine-protein kinase dyf-5 [Source:UniProtKB/Swiss-Prot;Acc:B3WFY8])

HSP 1 Score: 205.297 bits (521), Expect = 4.403e-60
Identity = 105/298 (35.23%), Postives = 176/298 (59.06%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLK-------PLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            + D+Y    +LG+G +G V   +  DTG+ VAIKR  +    +    M++RE++ L+ L HPN++ L E+ +    ++ VF+++   L + ++ +     +S +++I+YQ++QG+ + H++   HRD+KPENI+      VKI DFG AR + +   YTDYV+TRWYR+PE+L+    Y  P+D+WA+GC+ AE+  + PL+PG S++DQLF II+ LG        T  ++++ EG+Q+    N +       P+E    Q    ISKE +K++      +P+KR   +  L+  YF
Sbjct:    7 LADRYLMTKRLGDGTFGEVMLAKKIDTGDRVAIKRMKK-KFYSWEEAMSLREVKSLKKLNHPNIIKLREVIRENDILYFVFEFMQENLYELMKDRDRYFPESVIRNIIYQVLQGLAFMHKNGFFHRDMKPENIMCNGTELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEILLRSTSYNSPIDMWALGCIMAELYILRPLFPGTSEMDQLFKIISILG--------TPNKDEWPEGYQLASAMNFRFQQVVATPME----QVVNTISKEGMKLMMDMMLWNPEKRPNANQSLRYKYF 291          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343387)

HSP 1 Score: 335.109 bits (858), Expect = 2.554e-110
Identity = 168/341 (49.27%), Postives = 227/341 (66.57%), Query Frame = 1
Query:  169 QMNTLNSFVRSKQICELPRSLD-RKFNTQKSMR-DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENF---IQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNN 1176
            Q + L   ++  Q+C  P  ++ R++  Q S + D+YE+L +LGEG+YG V+KCR ++TG LVA+KRF E +   +I  +A+REIR+L+ L+HPNLV L+E+F+RK  +HLVF++ + T+L ELE  P    +   K I YQ + G+ YCH+   +HRDIKPENILLT   QVK+CDFGFAR L     YTDYVATRWYR+PELLVGD  YG PVDVWAIGC+FAE++R   LWPG+SD+DQL+LI  TLG L   H   F +N+YF+G  +P P  L+PLE+      QQN +     I  L  C + DP KR +C+ L K SYF +    +  L + N+
Sbjct:   14 QNSFLYRLIQKIQVCNEPDLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLT----IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNS 350          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343388)

HSP 1 Score: 330.102 bits (845), Expect = 9.459e-109
Identity = 161/310 (51.94%), Postives = 211/310 (68.06%), Query Frame = 1
Query:  256 SMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENF---IQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNN 1176
            S  D+YE+L +LGEG+YG V+KCR ++TG LVA+KRF E +   +I  +A+REIR+L+ L+HPNLV L+E+F+RK  +HLVF++ + T+L ELE  P    +   K I YQ + G+ YCH+   +HRDIKPENILLT   QVK+CDFGFAR L     YTDYVATRWYR+PELLVGD  YG PVDVWAIGC+FAE++R   LWPG+SD+DQL+LI  TLG L   H   F +N+YF+G  +P P  L+PLE+      QQN +     I  L  C + DP KR +C+ L K SYF +    +  L + N+
Sbjct:   19 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLT----IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNS 324          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0302950)

HSP 1 Score: 329.331 bits (843), Expect = 3.378e-108
Identity = 161/310 (51.94%), Postives = 211/310 (68.06%), Query Frame = 1
Query:  256 SMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENF---IQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNN 1176
            S  D+YE+L +LGEG+YG V+KCR ++TG LVA+KRF E +   +I  +A+REIR+L+ L+HPNLV L+E+F+RK  +HLVF++ + T+L ELE  P    +   K I YQ + G+ YCH+   +HRDIKPENILLT   QVK+CDFGFAR L     YTDYVATRWYR+PELLVGD  YG PVDVWAIGC+FAE++R   LWPG+SD+DQL+LI  TLG L   H   F +N+YF+G  +P P  L+PLE+      QQN +     I  L  C + DP KR +C+ L K SYF +    +  L + N+
Sbjct:   42 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLT----IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNS 347          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343389)

HSP 1 Score: 328.561 bits (841), Expect = 3.864e-108
Identity = 161/310 (51.94%), Postives = 211/310 (68.06%), Query Frame = 1
Query:  256 SMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENF---IQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNN 1176
            S  D+YE+L +LGEG+YG V+KCR ++TG LVA+KRF E +   +I  +A+REIR+L+ L+HPNLV L+E+F+RK  +HLVF++ + T+L ELE  P    +   K I YQ + G+ YCH+   +HRDIKPENILLT   QVK+CDFGFAR L     YTDYVATRWYR+PELLVGD  YG PVDVWAIGC+FAE++R   LWPG+SD+DQL+LI  TLG L   H   F +N+YF+G  +P P  L+PLE+      QQN +     I  L  C + DP KR +C+ L K SYF +    +  L + N+
Sbjct:   28 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLHLVFEFCELTVLHELERHPQGCPEHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARMLSPGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIGCLFAELVRGEALWPGRSDVDQLYLIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLEDKMPAKSQQNPLT----IDFLKKCLDKDPTKRWSCEKLTKHSYFDDYIAKQRELEHVNS 333          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Match: Cdk7 (gene:FBgn0263237 transcript:FBtr0070756)

HSP 1 Score: 200.675 bits (509), Expect = 1.311e-59
Identity = 108/296 (36.49%), Postives = 171/296 (57.77%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRF---SEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDN-IYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRR-NKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCN 1137
            ++Y +L  LGEG + TV+K R   T ++VA+K+    S  D    I+  A+REI++L+ L+H N++ L+++F +  ++ LVF ++D  L   ++     L ++N+K+     ++G+EY H + I+HRD+KP N+L+  +  +KI DFG A+  G+ N IYT +V TRWYRSPELL G   YG  VD+WA+GC+ AE++   P  PG SDLDQL  I +TLG+  +       + + Y +    P      PL+  F         + I ++   F M+P +R++C   L   YF N
Sbjct:   10 ERYAKLSFLGEGQFATVYKARDTVTNQIVAVKKIKKGSREDARDGINRTALREIKILQELQHENIIGLVDVFGQLSNVSLVFDFMDTDLEVIIKDNKIILTQANIKAYAIMTLKGLEYLHLNWILHRDLKPNNLLVNSDGILKIGDFGLAKSFGSPNRIYTHHVVTRWYRSPELLFGARQYGTGVDMWAVGCILAELMLRVPFMPGDSDLDQLTRIFSTLGTPTEAEWPHLSKLHDYLQFRNFPG----TPLDNIFTAA----GNDLIHLMQRLFAMNPLRRVSCREALSMPYFAN 297          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Match: cdkl1 (cyclin-dependent kinase-like 1 (CDC2-related kinase) [Source:NCBI gene;Acc:445316])

HSP 1 Score: 349.362 bits (895), Expect = 4.576e-117
Identity = 164/302 (54.30%), Postives = 225/302 (74.50%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL-NGSESVLR 1164
            +KYE++ K+GEG+YG VFKCR KDTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI++Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWA+GCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N++F G  VPEP  ++PLE  +   +Y    + + ++ GC  MDP +R++C+ LL++ YF +L   SESV R
Sbjct:    2 EKYEKISKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPIIKKIALREIRMLKQLKHPNLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEHMVKSIIWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAVGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGELIPRHQQVFSTNQFFSGVCVPEPQEMEPLELKYPNLSY----QALSLMKGCLRMDPAERLSCEQLLEQPYFDSLREESESVTR 299          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 244.588 bits (623), Expect = 8.972e-71
Identity = 124/307 (40.39%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP 1179
            +K+E L  +GEGAYG V KCR K+T ELVAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P       ++S ++Q+++ I +CH++ I+HRDIKPEN+L++ N  +K+CDFGFAR L  G+D  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + L+  ++    II+   + ++     ++P +R   +  L    F  L G E     S  P
Sbjct:   11 NKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLG---IINGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTP 313          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 244.588 bits (623), Expect = 8.972e-71
Identity = 124/307 (40.39%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP 1179
            +K+E L  +GEGAYG V KCR K+T ELVAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P       ++S ++Q+++ I +CH++ I+HRDIKPEN+L++ N  +K+CDFGFAR L  G+D  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + L+  ++    II+   + ++     ++P +R   +  L    F  L G E     S  P
Sbjct:   11 NKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLG---IINGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTP 313          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 244.588 bits (623), Expect = 8.972e-71
Identity = 124/307 (40.39%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP 1179
            +K+E L  +GEGAYG V KCR K+T ELVAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P       ++S ++Q+++ I +CH++ I+HRDIKPEN+L++ N  +K+CDFGFAR L  G+D  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + L+  ++    II+   + ++     ++P +R   +  L    F  L G E     S  P
Sbjct:   11 NKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLG---IINGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTP 313          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZDB-GENE-081022-110])

HSP 1 Score: 244.202 bits (622), Expect = 1.485e-70
Identity = 124/307 (40.39%), Postives = 188/307 (61.24%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP 1179
            +K+E L  +GEGAYG V KCR K+T ELVAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P       ++S ++Q+++ I +CH++ I+HRDIKPEN+L++ N  +K+CDFGFAR L  G+D  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + L+  ++    II+   + ++     ++P +R   +  L    F  L G E     S  P
Sbjct:   11 NKFEVLGIVGEGAYGVVLKCRHKETKELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVEKNMLELLEELPNGALPDKVRSYIFQLIKAIHWCHKNEIVHRDIKPENLLISANDILKLCDFGFARNLSEGSDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPPEQMKLFYSNPRFAGLRFPSVSHPQTLDRRYLG---IINGLMLDLMKNLLCLNPTERFLTEQCLNHPVFQGLRGPEQPAVPSPTP 313          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Match: CDKL1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:100496578])

HSP 1 Score: 340.117 bits (871), Expect = 3.291e-113
Identity = 157/290 (54.14%), Postives = 212/290 (73.10%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE++ K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ + IHRD+KPENIL+T +  +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  + G L   H+  F  N++F G  +P+P N++PLE  F      IS + + ++ GC  MDP KR+ C  LL   YF
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRKLHLVFEYCDHTVLHELDKYPRGVPEHLVKSITWQTLQAVNFCHKHHCIHRDVKPENILITRHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDVDQLYLIRKSQGDLIARHQQVFSTNQFFSGVSIPDPENMEPLELRFPN----ISSQALGLMKGCLHMDPAKRLACQQLLDHPYF 287          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Match: CDKL1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:100496578])

HSP 1 Score: 323.168 bits (827), Expect = 1.467e-106
Identity = 151/291 (51.89%), Postives = 207/291 (71.13%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKIL-HGCFEMDPKKRITCDALLKESYF 1131
            +KYE++ K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ + IHRD+KPENIL+T +  +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  + G L   H+  F  N++F G  +P+P N+    +       +++   + +   GC  MDP KR+ C  LL   YF
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRKLHLVFEYCDHTVLHELDKYPRGVPEHLVKSITWQTLQAVNFCHKHHCIHRDVKPENILITRHSVIKLCDFGFARLLTGPSDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDVDQLYLIRKSQGDLIARHQQVFSTNQFFSGVSIPDPENMLISIKKHPGLGILVTGFHLSLQSQGCLHMDPAKRLACQQLLDHPYF 292          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Match: vsx2 (visual system homeobox 2 [Source:Xenbase;Acc:XB-GENE-853775])

HSP 1 Score: 284.263 bits (726), Expect = 7.063e-89
Identity = 145/307 (47.23%), Postives = 201/307 (65.47%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPR 1182
            +KYE L  +GEG+YG V KCR K+ G +VA+K+F E +    +  +A+REI++L+ LRH NLV+L+E+ K+K   +LVF+++D T+L +LE  P  L+ S ++  L+QI++GI +CH  NIIHRDIKPENIL++ +  VK+CDFGFAR L G    YTDYVATRWYR+PELLVGDI YG  VDVWAIGC+  EM+   PL+PG SD+DQL  I+   G+L   H++ F RN  F GF +P+    + LE  + + + I+    + +   C  +DP KR  C  LL    F   + SE   R+S   R
Sbjct:    2 EKYENLGLVGEGSYGMVMKCRNKENGRIVAVKKFLESEDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDRTVLDDLEQFPNGLDFSKVRKYLFQIIRGIGFCHSHNIIHRDIKPENILVSHSGIVKLCDFGFARTLAGPGEDYTDYVATRWYRAPELLVGDIKYGKAVDVWAIGCIVTEMLTAQPLFPGDSDIDQLHHIVKCQGNLTPRHQELFYRNPMFAGFSLPDMKEAESLEWRYPKLSPIM----LDLAKSCLHIDPDKRPACMTLLLHELFTKDSFSE---RFSQEIR 301          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Match: vldlr (very low density lipoprotein receptor [Source:Xenbase;Acc:XB-GENE-971958])

HSP 1 Score: 244.973 bits (624), Expect = 8.301e-71
Identity = 126/318 (39.62%), Postives = 192/318 (60.38%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL----NGSESVLRYSNNPRWHCEAN 1200
            +K+E L  +GEGAYG V KCR K+T E+VAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P  +    + + +YQ+++ I +CH+++I+HRDIKPEN+L++ N  +K+CDFGFAR L  G++  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + LE  ++    IIS   + ++    +++P  R   +  L    F        G  S  R S     H E+N
Sbjct:   11 NKFEVLGVVGEGAYGVVLKCRHKETKEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVTNYIYQLIKAIHWCHKNDIVHRDIKPENLLISYNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGMRFPAVNHPQSLERRYLG---IISSVLLDLMKNLLKLNPSDRFLTEQSLNHPAFQTQRLLDRGGTSPSRSSKRKTHHSESN 324          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Match: vldlr (very low density lipoprotein receptor [Source:Xenbase;Acc:XB-GENE-971958])

HSP 1 Score: 224.172 bits (570), Expect = 5.267e-64
Identity = 120/318 (37.74%), Postives = 182/318 (57.23%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL----NGSESVLRYSNNPRWHCEAN 1200
            +K+E L  +GEGAYG V KCR K    +   +    P          +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P  +    + + +YQ+++ I +CH+++I+HRDIKPEN+L++ N  +K+CDFGFAR L  G++  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + LE  ++    IIS   + ++    +++P  R   +  L    F        G  S  R S     H E+N
Sbjct:   11 NKFEVLGVVGEGAYGVVLKCRHKVRAIIFITEFICPPFLFREFKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVTNYIYQLIKAIHWCHKNDIVHRDIKPENLLISYNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGMRFPAVNHPQSLERRYLG---IISSVLLDLMKNLLKLNPSDRFLTEQSLNHPAFQTQRLLDRGGTSPSRSSKRKTHHSESN 324          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 347.051 bits (889), Expect = 2.872e-116
Identity = 158/289 (54.67%), Postives = 212/289 (73.36%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE+L K+GEG+YG VFKCR K +G++VAIK+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  ++   +KS+L+Q +Q + +CH+ N IHRD+KPENIL+T+   +KICDFGFAR L   + YTDYVATRWYR+PELLVGD  YG  VDVWA+GCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  FR N++F G  +PEP +++ LEE F      +    +  + GC +M+P +R+TC  LL  +YF
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSN----VQPVALSFMKGCLKMNPDERLTCAQLLDSAYF 286          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 347.051 bits (889), Expect = 2.872e-116
Identity = 158/289 (54.67%), Postives = 212/289 (73.36%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE+L K+GEG+YG VFKCR K +G++VAIK+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  ++   +KS+L+Q +Q + +CH+ N IHRD+KPENIL+T+   +KICDFGFAR L   + YTDYVATRWYR+PELLVGD  YG  VDVWA+GCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  FR N++F G  +PEP +++ LEE F      +    +  + GC +M+P +R+TC  LL  +YF
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSN----VQPVALSFMKGCLKMNPDERLTCAQLLDSAYF 286          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Match: Cdkl4 (cyclin-dependent kinase-like 4 [Source:MGI Symbol;Acc:MGI:3587025])

HSP 1 Score: 347.051 bits (889), Expect = 2.872e-116
Identity = 158/289 (54.67%), Postives = 212/289 (73.36%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE+L K+GEG+YG VFKCR K +G++VAIK+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  ++   +KS+L+Q +Q + +CH+ N IHRD+KPENIL+T+   +KICDFGFAR L   + YTDYVATRWYR+PELLVGD  YG  VDVWA+GCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  FR N++F G  +PEP +++ LEE F      +    +  + GC +M+P +R+TC  LL  +YF
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSN----VQPVALSFMKGCLKMNPDERLTCAQLLDSAYF 286          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Match: Cdkl1 (cyclin-dependent kinase-like 1 (CDC2-related kinase) [Source:MGI Symbol;Acc:MGI:1918341])

HSP 1 Score: 343.199 bits (879), Expect = 1.261e-114
Identity = 177/356 (49.72%), Postives = 238/356 (66.85%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYN 1329
            +KYE++ K+GEG+YG VFKCR +DTG++VAIKRF E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+     + +  +K+I +Q +Q + +CH+ N IHRD+KPENIL+T+   +K+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G ++P+P +++ LE  F      IS   +  L GC  MDP +R+TC+ LL+  YF      +S+       R H +  RK +    Q++K   L  L Y P   QLT   I    +N  Y+
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKFPN----ISYSALGFLKGCLHMDPAERLTCEQLLQHPYF------DSIREVGELTRQHDKPARKTL---RQSRK--HLTGLQYLP---QLTSSRILPALDNKKYH 339          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Match: Cdkl2 (cyclin-dependent kinase-like 2 (CDC2-related kinase) [Source:MGI Symbol;Acc:MGI:1858227])

HSP 1 Score: 286.189 bits (731), Expect = 1.033e-89
Identity = 140/292 (47.95%), Postives = 199/292 (68.15%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGT-DNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPE--PCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE L  +GEG+YG V KCR KD+G +VAIK+F E D    +  +A+REI++L+ LRH NLV+L+E+ K+K   +LVF+++DHT+L +L+  P  L+   ++  L+QI+ GI +CH  NIIHRDIKPENIL++++  VK+CDFGFAR L     +YTDYVATRWYR+PELLVGD+ YG  VD+WAIGC+  EM+   PL+PG+SD+DQL  I+  LG+L   H++ F +N  F G ++PE      +PLE  + +    + +  I +   C  +DP KR  C  LL+  +F
Sbjct:    2 EKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVCKKKKRWYLVFEFVDHTILDDLKLFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDIWAIGCLVIEMLMGQPLFPGESDIDQLHHIMTCLGNLIPRHQELFYKNPVFAGVRLPEVKDAEAEPLESRYPK----LPEAVISLAKKCLHIDPDKRPFCADLLRHDFF 289          
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Match: sp|Q00532|CDKL1_HUMAN (Cyclin-dependent kinase-like 1 OS=Homo sapiens OX=9606 GN=CDKL1 PE=1 SV=6)

HSP 1 Score: 354.369 bits (908), Expect = 5.229e-118
Identity = 175/335 (52.24%), Postives = 236/335 (70.45%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNP-RWHCEANRKQILFTDQNKKVAKLPSL 1257
            M +KYE++ K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+     + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G ++P+P +++PLE  F      IS   + +L GC  MDP +R+TC+ LL   YF N+   E + +  N P R     +RK   FT+ + K+  LP L
Sbjct:    1 MMEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVIKLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPN----ISYPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETS-KLQYLPQL 330          
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Match: sp|Q3TZA2|CDKL4_MOUSE (Cyclin-dependent kinase-like 4 OS=Mus musculus OX=10090 GN=Cdkl4 PE=2 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 2.009e-115
Identity = 158/289 (54.67%), Postives = 212/289 (73.36%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE+L K+GEG+YG VFKCR K +G++VAIK+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  ++   +KS+L+Q +Q + +CH+ N IHRD+KPENIL+T+   +KICDFGFAR L   + YTDYVATRWYR+PELLVGD  YG  VDVWA+GCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  FR N++F G  +PEP +++ LEE F      +    +  + GC +M+P +R+TC  LL  +YF
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKHNCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGSSVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIPEPEDMETLEEKFSN----VQPVALSFMKGCLKMNPDERLTCAQLLDSAYF 286          
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Match: sp|Q6AXJ9|CDKL1_DANRE (Cyclin-dependent kinase-like 1 OS=Danio rerio OX=7955 GN=cdkl1 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 7.197e-115
Identity = 163/302 (53.97%), Postives = 224/302 (74.17%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL-NGSESVLR 1164
            +KYE++ K+GEG+YG VFKCR KDTG++VAIK+F E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI++Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTD VATRWYR+PELLVGD  YGPPVDVWA+GCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N++F G  VPEP  ++PLE  +   +Y    + + ++ GC  MDP +R++C+ LL++ YF +L   SESV R
Sbjct:    2 EKYEKISKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPIIKKIALREIRMLKQLKHPNLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEHMVKSIIWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDCVATRWYRAPELLVGDTQYGPPVDVWAVGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGELIPRHQQVFSTNQFFSGVCVPEPQEMEPLELKYPNLSY----QALSLMKGCLRMDPAERLSCEQLLEQPYFDSLREESESVTR 299          
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Match: sp|Q8CEQ0|CDKL1_MOUSE (Cyclin-dependent kinase-like 1 OS=Mus musculus OX=10090 GN=Cdkl1 PE=2 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 8.821e-114
Identity = 177/356 (49.72%), Postives = 238/356 (66.85%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYN 1329
            +KYE++ K+GEG+YG VFKCR +DTG++VAIKRF E +    I  +A+REIRML+ L+HPNLV+L+E+F+RK  +HLVF+Y DHT+L EL+     + +  +K+I +Q +Q + +CH+ N IHRD+KPENIL+T+   +K+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G ++P+P +++ LE  F      IS   +  L GC  MDP +R+TC+ LL+  YF      +S+       R H +  RK +    Q++K   L  L Y P   QLT   I    +N  Y+
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKRFLETEDDPVIKKIALREIRMLKQLKHPNLVNLLEVFRRKRRLHLVFEYCDHTVLHELDRYQRGVPEPLVKNITWQTLQAVNFCHKHNCIHRDVKPENILITKQSAIKLCDFGFARLLTGPGDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSMNQYFSGVKIPDPEDMETLELKFPN----ISYSALGFLKGCLHMDPAERLTCEQLLQHPYF------DSIREVGELTRQHDKPARKTL---RQSRK--HLTGLQYLP---QLTSSRILPALDNKKYH 339          
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Match: sp|Q5MAI5|CDKL4_HUMAN (Cyclin-dependent kinase-like 4 OS=Homo sapiens OX=9606 GN=CDKL4 PE=2 SV=2)

HSP 1 Score: 342.428 bits (877), Expect = 5.170e-113
Identity = 172/377 (45.62%), Postives = 238/377 (63.13%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFT 1395
            +KYE+L K GEG+YG VFKCR K +G++VA+K+F E +    +  +A+REIRML+ L+HPNLV+LIE+F+RK  +HLVF+Y DHTLL ELE  P  +    +KS+L+Q +Q + +CH  N IHRDIKPENIL+T+   +KICDFGFA+ L   + YTDYVATRWYR+PELLVGD  YG  VD+WAIGCVFAE++   PLWPGKSD+DQL+LII TLG L   H+  F+ N +F G  +PEP +++ LEE F   + +     +  + GC +M+P  R+TC  LL+ SYF +   ++   +  N  R     NR++     Q    +  P L       Q+  +   T+ N            ++LP  P++Q    T
Sbjct:    2 EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGIIKICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPV----ALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIKRKARNEGR-----NRRR----QQQAPKSAFPRLFLKTKICQVQRNETQTSGN------------QILPNGPILQNSMVT 353          
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Match: A0A267DKM9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000280g4 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.333e-126
Identity = 191/357 (53.50%), Postives = 251/357 (70.31%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNK 1332
            DKYE+L K+GEGAYG VFKCR + TGELVAIK+F+E +    IH +A+REIRML+ L+H NLV+L+E+FKRK  +HLVFQYIDHTLL E+EAKPY +++  ++ I YQ++  I +CH  N IHRD+KPENIL+T + +VK+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM++  PLWPG+SDLDQL+LII TLG L   HK+ F+ N +F G ++PEP N + LEE F      +S +E++ L  CF+MDP +R TC+ L +  YF + +    V R  +       A R+++   D  K+ A+ PSL      N +T+ I  +  NN+   K
Sbjct:    2 DKYEKLGKIGEGAYGVVFKCRQRFTGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEMEAKPYGMDRGQIRKITYQLLDAISFCHSHNCIHRDVKPENILVTRDTKVKLCDFGFARLLTGPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLKGIPLWPGRSDLDQLYLIIKTLGELLPRHKEIFQENSFFRGLKIPEPENQESLEEKFQHMKEPLSTKELQFLQFCFKMDPVQRATCEDLKRFDYF-DRSMYSDVYRDED-------AGRRRMKALDM-KQRAQWPSL----QQNHMTNPISKSPQNNSKQGK 345          
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Match: A0A267E989 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000280g1 PE=3 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.486e-126
Identity = 191/357 (53.50%), Postives = 251/357 (70.31%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNK 1332
            DKYE+L K+GEGAYG VFKCR + TGELVAIK+F+E +    IH +A+REIRML+ L+H NLV+L+E+FKRK  +HLVFQYIDHTLL E+EAKPY +++  ++ I YQ++  I +CH  N IHRD+KPENIL+T + +VK+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM++  PLWPG+SDLDQL+LII TLG L   HK+ F+ N +F G ++PEP N + LEE F      +S +E++ L  CF+MDP +R TC+ L +  YF + +    V R  +       A R+++   D  K+ A+ PSL      N +T+ I  +  NN+   K
Sbjct:    2 DKYEKLGKIGEGAYGVVFKCRQRFTGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEMEAKPYGMDRGQIRKITYQLLDAISFCHSHNCIHRDVKPENILITRDTKVKLCDFGFARLLTGPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLKGIPLWPGRSDLDQLYLIIKTLGELLPRHKEIFQENSFFRGLKIPEPENQESLEEKFQHMKEPLSTKELQFLQFCFKMDPVQRATCEDLKRFDYF-DRSMYSDVYRDED-------AGRRRMKALDM-KQRAQWPSL----QQNHMTNPISKSPQNNSKQGK 345          
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Match: A0A267ER40 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000458g8 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 1.409e-122
Identity = 173/305 (56.72%), Postives = 230/305 (75.41%), Query Frame = 1
Query:  241 FNTQKSMR-------DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            F+  KS+R       +KYE+L K+GEGAYG VFKCR + +GELVAIK+F+E +    IH +A+REIRML+ L+H NLV+L+E+FKRK  +HLVFQYIDHTLL E+E++P  +++S ++ I YQ++  I +CH  N IHRD+KPENIL+T + +VK+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWA+GCVFAEM++  PLWPG+SDLDQL LII +LG L   H+D F +N YF+G ++PEP     +E+ F+     ++++E++ LH CF+MDP +R TC+ L K  YF
Sbjct:   16 FSNLKSLRSRQPLLMEKYEKLGKIGEGAYGVVFKCRHRFSGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEIESRPSGMDRSQIRKITYQLLDAISFCHLHNCIHRDVKPENILITRDAKVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGTPLWPGRSDLDQLHLIIKSLGDLVPRHRDIFYQNAYFQGLKIPEPEQQDQIEQKFVHMREPLTQKELQFLHFCFKMDPVQRATCEELKKTDYF 320          
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Match: A0A1I8J290 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 2.665e-122
Identity = 169/290 (58.28%), Postives = 224/290 (77.24%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE+L K+GEGAYG VFKCR + +GELVAIK+F+E +    IH +A+REIRML+ L+H NLV+L+E+FKRK  +HLVFQYIDHTLL E+E++P  +++S ++ I YQ++  I +CH  N IHRD+KPENIL+T + +VK+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWA+GCVFAEM++  PLWPG+SDLDQL LII +LG L   H+D F +N YF+G ++PEP     +E+ F+     ++++E++ LH CF+MDP +R TC+ L K  YF
Sbjct:    2 EKYEKLGKIGEGAYGVVFKCRHRFSGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEIESRPSGMDRSQIRKITYQLLDAISFCHLHNCIHRDVKPENILITRDAKVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGTPLWPGRSDLDQLHLIIKSLGDLVPRHRDIFYQNAYFQGLKIPEPEQQDQIEQKFVHMREPLTQKELQFLHFCFKMDPVQRATCEELKKTDYF 291          
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Match: A0A267FJ04 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000458g7 PE=3 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 6.362e-122
Identity = 171/299 (57.19%), Postives = 228/299 (76.25%), Query Frame = 1
Query:  238 KFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            K + Q  + +KYE+L K+GEGAYG VFKCR + +GELVAIK+F+E +    IH +A+REIRML+ L+H NLV+L+E+FKRK  +HLVFQYIDHTLL E+E++P  +++S ++ I YQ++  I +CH  N IHRD+KPENIL+T + +VK+CDFGFAR L G  + YTDYVATRWYRSPELLVGD  YGPPVDVWA+GCVFAEM++  PLWPG+SDLDQL LII +LG L   H+D F +N YF+G ++PEP     +E+ F+     ++++E++ LH CF+MDP +R TC+ L K  YF
Sbjct:   56 KSSRQPLLMEKYEKLGKIGEGAYGVVFKCRHRFSGELVAIKKFTESEEDPLIHKIAMREIRMLKQLKHDNLVNLLEVFKRKKRLHLVFQYIDHTLLNEIESRPSGMDRSQIRKITYQLLDAISFCHLHNCIHRDVKPENILITRDAKVKLCDFGFARLLTGPGDEYTDYVATRWYRSPELLVGDTQYGPPVDVWAVGCVFAEMLKGTPLWPGRSDLDQLHLIIKSLGDLVPRHRDIFYQNAYFQGLKIPEPEQQDQIEQKFVHMREPLTQKELQFLHFCFKMDPVQRATCEELKKTDYF 354          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:103022052])

HSP 1 Score: 340.502 bits (872), Expect = 1.087e-113
Identity = 160/290 (55.17%), Postives = 216/290 (74.48%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE++ K+GEG+YG VFKCR KDTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+LIE+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N++F G  VPEP  ++PLE+ +      IS + + ++ GC  MDP +R++C+ LL+  YF
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHCNLVNLIEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEYLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSNNQFFSGVCVPEPQEMEPLEQKYPN----ISYQALSLMKGCLCMDPAERLSCEQLLEHPYF 287          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000057054.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 335.495 bits (859), Expect = 8.363e-112
Identity = 155/296 (52.36%), Postives = 216/296 (72.97%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGS 1149
            +KYE+L K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF++ + T+L EL+  P  + ++ +KSI++Q +Q + +CH++N IHRD+KPENILLT+   +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGP VDVWA+GCVFAE++   PLWPG+SD+DQL+LI  TLG L   H+  FR N +F G  +PEP  ++PLE+ F    +  S   I ++  C  MDP  R++C+ LL+ +YF    G+
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTMEPLEKRF----HGASPHAIAVMKSCLVMDPAGRLSCEELLELTYFQEEGGA 293          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000052448.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 335.495 bits (859), Expect = 8.363e-112
Identity = 155/296 (52.36%), Postives = 216/296 (72.97%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGS 1149
            +KYE+L K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF++ + T+L EL+  P  + ++ +KSI++Q +Q + +CH++N IHRD+KPENILLT+   +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGP VDVWA+GCVFAE++   PLWPG+SD+DQL+LI  TLG L   H+  FR N +F G  +PEP  ++PLE+ F    +  S   I ++  C  MDP  R++C+ LL+ +YF    G+
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTMEPLEKRF----HGASPHAIAVMKSCLVMDPAGRLSCEELLELTYFQEEGGA 293          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:103022052])

HSP 1 Score: 329.717 bits (844), Expect = 1.426e-109
Identity = 156/290 (53.79%), Postives = 212/290 (73.10%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE++ K+GEG+YG VFKCR KDTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+LIE+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T++  +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N++F G  VPEP  +          + +++ ++  +L GC  MDP +R++C+ LL+  YF
Sbjct:    2 EKYEKIGKIGEGSYGVVFKCRNKDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHCNLVNLIEVFRRKRKLHLVFEYCDHTVLNELDRYPRGVPEYLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKHQVIKLCDFGFARILTGPCDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGAPLWPGKSDVDQLYLIRKTLGDLIPRHQQVFSNNQFFSGVCVPEPQEM---------VSVLVALDKSGLLRGCLCMDPAERLSCEQLLEHPYF 282          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033332.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 317.775 bits (813), Expect = 6.369e-105
Identity = 152/296 (51.35%), Postives = 210/296 (70.95%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGS 1149
            +KYE+L K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF++ + T+L EL+  P  + ++ +KSI++Q +Q + +CH++N IHRD+KPENILLT+   +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGP VDVWA+GCVFAE++   PLWPG+SD+DQL+LI  TLG L   H+  FR N +F G  +PEP  +    E F+   Y +          C  MDP  R++C+ LL+ +YF    G+
Sbjct:    2 EKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVPEAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARILTGPGDDYTDYVATRWYRAPELLVGDTQYGPAVDVWALGCVFAELLNGNPLWPGRSDVDQLYLIRRTLGDLIPRHQQVFRSNVFFSGVSIPEPDTM----ETFM---YCVCS--------CLVMDPAGRLSCEELLELTYFQEEGGA 282          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 209.149 bits (531), Expect = 4.473e-64
Identity = 118/305 (38.69%), Postives = 170/305 (55.74%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELE-AKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGT-DNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGS-----------LPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL 1140
            D ++++ K+GEG YG V+K R K TGE VA+K+         + + AIREI +LR L HPN+V L+ I   +  ++LVF+ +D  L + ++ A P  +    +KS LYQ++QGI +CH   I+HRD+KP+N+L+     +K+ DFG AR  G     YT  V T WYR+PE+L+G  HY   VDVW+IGC+FAEM+    L+PG S++DQLF I  TLG+           LPD +K TF R    E  +V    N                 E   +L    + DP +R+T +  L   +F N+
Sbjct:    2 DNFQKVEKIGEGTYGVVYKARNKLTGEAVALKKIRLDTETEGVPSTAIREISLLRELNHPNIVRLLTIIHSEKKLYLVFELLDQDLKKFMDNATPSGIPLPLVKSYLYQLLQGIAFCHSHRILHRDLKPQNLLINAEGAIKLADFGLARAFGVPQRTYTHEVVTLWYRAPEILLGCKHYSTSVDVWSIGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVSQLPD-YKSTFPRWANQELTKVVPTLNF----------------EGRDLLALMLQYDPNQRVTANMALSHCFFQNV 289          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Match: cdk2 (cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2741])

HSP 1 Score: 204.142 bits (518), Expect = 3.288e-62
Identity = 107/298 (35.91%), Postives = 176/298 (59.06%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELE-AKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGF-QVPE--PCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLN 1143
            D ++++ K+GEG YG V+K R K TG+ VA+K+         + + AIREI +LR L HPN+V L+++   +  ++LVF+++D  L + ++ A P  ++   +KS ++Q++QGI +CH    +HRD+KP+N+L+  +  +K+ DFG AR  G     YT  V T WYR+PE+L+G  +Y   VDVW++GC+FAEM+    L+PG S++DQLF I  TLG+ PD           ++G  Q+P+  P   +   ++  +   ++      +L    + DP +R++  A L   +F NL 
Sbjct:    2 DLFQKVEKIGEGTYGVVYKARHKMTGDTVALKKIRLDTETEGVPSTAIREIALLRELNHPNIVRLLDVIHSETKLYLVFEFLDQDLKKYMDNAPPLGISLPLVKSYMHQLLQGIAFCHAQRTLHRDLKPQNLLINADGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGCKYYSTAVDVWSLGCIFAEMLTRRALFPGDSEIDQLFRIFRTLGT-PD--------ETVWQGITQLPDYKPSFPRWCAQDLTKVVPLLDAAGHDLLMQMLQYDPTRRVSAKAALNHHFFHNLE 290          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Match: cdk7 (cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GENE-010320-2])

HSP 1 Score: 198.749 bits (504), Expect = 2.330e-59
Identity = 114/307 (37.13%), Postives = 167/307 (54.40%), Query Frame = 1
Query:  271 YERLYKLGEGAYGTVFKCRLKDTGELVAIKRFS---EPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDN-IYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGS-----------LPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNG 1146
            Y+++  LGEG + TV+K   K T ++VAIK+       +    I+  A+REI++L+ L HPN++ L++ F  K +I LVF ++D  L   ++     L+ +N+KS +   +QG+EY H   I+HRD+KP N+LL E   +K+ DFG A+  G+ + +YT  V TRWYRSPELL G   YG  VD+WA+GC+ AE++   P  PG SDLDQL  I   LG+           LPD     +   K F G          PLE  F       + + +++L G F   P  R+T    ++  YF N  G
Sbjct:   26 YDKIDFLGEGQFATVYKAMDKVTNKIVAIKKIKLGHRTEAKDGINRTALREIKLLQELNHPNIIGLLDAFGHKSNISLVFDFMDTDLEVIVKDTSLVLSPANIKSFMVMTLQGLEYLHMHWILHRDMKPNNLLLDEQGVLKLADFGLAKSFGSPSRVYTHQVVTRWYRSPELLFGARMYGVGVDMWAVGCILAELLLRTPFLPGDSDLDQLSKIFEALGTPTEELWPGMTNLPD-----YVEYKSFPG---------TPLENIFTAA----TDDLLELLQGLFTFSPAARLTATQAMQMPYFSNRPG 314          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003004.1 (pep scaffold:Pmarinus_7.0:GL476686:67050:81358:1 gene:ENSPMAG00000002741.1 transcript:ENSPMAT00000003004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 1.031e-58
Identity = 107/292 (36.64%), Postives = 169/292 (57.88%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELL--VGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE L  +GEG+YG V KCR +DTG++VAIK+F + +   S+  +A REI+ML+ LRH NLV+L+E+F+RK  ++LVF+++DHT+L ELE  P  L  + ++  L Q+++ + +C+ +N++HR   P N+ L        C F F          ++D     + +SP +   V        VDVWA+GCV  E+    P++PG SD+DQL+ I+   G+L   H++ F +N  F G +VPE   ++PLE    ++   +    + ++  C  MD   R  C  LL+  YF
Sbjct:    2 EKYENLGLVGEGSYGIVLKCRHRDTGQIVAIKKFLDSEDHKSVRKIAAREIKMLKQLRHENLVNLLEVFRRKRRLYLVFEFVDHTVLDELERYPRGLPTARVRPCLLQVLRAVGFCNSNNVVHRWTTPVNVFLRIVDPCYFCIFLFQEASQHPFKCHSDIRLNEYKQSPLMFACVCVCERYRAVDVWAVGCVAVEIQTGEPVFPGDSDIDQLYQIVKCFGNLMPRHRELFYKNPVFTGLKVPEVHAVEPLE----KRLPRLPPLLLDLIKQCLYMDADTRPPCSRLLQHDYF 289          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Match: mak (male germ cell-associated kinase [Source:ZFIN;Acc:ZDB-GENE-030131-7279])

HSP 1 Score: 198.364 bits (503), Expect = 8.483e-57
Identity = 109/299 (36.45%), Postives = 168/299 (56.19%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEG--------FQVPE--PCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            ++Y  + +LG+G YG+V   R  +TGELVAIK+       +    M +RE++ L+ L H N++ L E+ +    ++ VF+Y+   L Q ++ +     +S +++I+YQI+QG+ + H+    HRD+KPEN+L      VKI DFG AR + +   YTDYV+TRWYR PE+L+    Y  P+D+WA+GC+ AE+  + PL+PG S++DQ+F I   LG        T ++N + EG        F+ P+  P NLK L  N        S E I ++      +PKKR      L+  YF
Sbjct:    2 NRYTTIKQLGDGTYGSVLMGRSNETGELVAIKKMKR-KFYSWDECMNLREVKSLKKLNHANVIKLKEVIRENDCLYFVFEYMKENLYQLMKDRNKLFPESMIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRGPEVLLRSTSYSSPIDIWALGCIMAELYTLRPLFPGSSEVDQIFKICQVLG--------TPKKNDWPEGHQLAAAMNFRWPQCVPTNLKTLIPN-------ASNEAIHLMRDMLHWEPKKRPNAVQSLRYPYF 284          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 179.104 bits (453), Expect = 7.904e-53
Identity = 100/310 (32.26%), Postives = 174/310 (56.13%), Query Frame = 1
Query:  256 SMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAK-----PYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGS-----------LPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFC 1134
            S   ++++L KLG G Y TV+K   K TG  VA+K   + D+     + AIREI +++ L+H N+V L ++   ++ + LVF+++D+ L + ++++     P  L  + +K   +Q++QG+ +CH + I+HRD+KP+N+L+ +  Q+K+ DFG AR  G   N ++  V T WYR+P++L+G   Y   +D+W+ GC+ AEMI   PL+PG +D +QL LI + +G+           LP  + +  +R    +  QV +P   +PL+ N +             LHG  +++P  R++    L   +F 
Sbjct:    2 SSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEV-KLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPR-DLRQVLQPHTKEPLDGNLMD-----------FLHGLLQLNPDMRLSAKQALHHPWFA 298          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Match: KIN28 (Serine/threonine protein kinase, subunit of transcription factor TFIIH; involved in transcription initiation at RNA polymerase II promoters; phosphorylates Ser5 residue of the PolII C-terminal domain (CTD) at gene promoters; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002266])

HSP 1 Score: 179.104 bits (453), Expect = 9.809e-53
Identity = 94/292 (32.19%), Postives = 159/292 (54.45%), Query Frame = 1
Query:  268 KYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNL 1140
            +Y +  K+GEG Y  V+      TG  +AIK     +    +   AIRE++ L+ ++HPN++ LI+IF    +++LV +++   L   ++ K      +++K+ +   ++G+ +CHR+ I+HRD+KP N+L + + Q+K+ DFG AR +     I T  V TRWYR+PELL G  HY   +D+W++G +FAE++   P  PG++D+DQ+ +    LG+  D           +   Q+  P +   L + FI      S+  +  + G   M+P+KR T    L+  YF  L
Sbjct:    6 EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELIDIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPADIKAWMLMTLRGVYHCHRNFILHRDLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGVIFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIAA----SEYALDFMCGMLTMNPQKRWTAVQCLESDYFKEL 293          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 172.555 bits (436), Expect = 6.541e-49
Identity = 108/300 (36.00%), Postives = 160/300 (53.33%), Query Frame = 1
Query:  241 FNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRK-HHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLP-DIHKDTFRRN--KYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESY 1128
            F T   + ++Y  L  +G GA+G V       T + VAIK+  +P +   +     RE+++L+ LRH NL+ L +IF      I+ V +     L + L+ +P  L K  ++  LYQI++G++Y H + +IHRD+KP NIL+ EN  +KICDFG AR    D   T YV+TR+YR+PE+++    Y   VD+W+ GC+FAEMI   PL+PGK  + Q  +I + LGS P D+       N  K+       +P    P  E F      +  + + +L      DPKKRIT    L   Y
Sbjct:   13 FGTVFEITNRYNDLNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTELQGTDLHRLLQTRP--LEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARI--QDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVINTICSENTLKFVTSLPHRDPI---PFSERF----KTVEPDAVDLLEKMLVFDPKKRITAADALAHPY 301          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Match: CDC28 (Cyclin-dependent kinase (CDK) catalytic subunit; master regulator of mitotic and meiotic cell cycles; alternately associates with G1, S, G2/M phase cyclins, which provide substrate specificity; regulates metabolism, basal transcription, chromosome dynamics, growth and morphogenesis; transcript induction in osmostress involves antisense RNA; human homologs CDK1, CDK2, CDK3 can complement yeast conditional cdc28 mutants; human CDK1, CDK2 can complement yeast cdc28 null mutant [Source:SGD;Acc:S000000364])

HSP 1 Score: 166.392 bits (420), Expect = 4.928e-48
Identity = 87/223 (39.01%), Postives = 132/223 (59.19%), Query Frame = 1
Query:  271 YERLYKLGEGAYGTVFKC---RLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIF-KRKHHIHLVFQYIDHTLLQELEAKP--YKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGS 918
            Y+RL K+GEG YG V+K    R      +VA+K+         + + AIREI +L+ L+  N+V L +I     H ++LVF+++D  L + +E  P    L    +K  + Q+ +GI YCH   I+HRD+KP+N+L+ ++  +K+ DFG AR  G     YT  + T WYR+PE+L+G   Y   VD W+IGC+FAEM    P++ G S++DQ+F I   LG+
Sbjct:    8 YKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILHRDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRVLGT 230          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 155.992 bits (393), Expect = 1.496e-43
Identity = 97/302 (32.12%), Postives = 157/302 (51.99%), Query Frame = 1
Query:  289 LGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEI-----FKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFAR-----------PLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKD-----TFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            LGEGAYG V     K TGE+VAIK+  EP          +REI++L+  +H N++ +  I     F+  + ++++ + +   L + +  +   L+  +++  +YQ ++ ++  H SN+IHRD+KP N+L+  N  +K+CDFG AR           P G  +  T+YVATRWYR+PE+++    Y   +DVW+ GC+ AE+    P++PG+    QL LI   +G+ P    D     + R  +Y +   +       PLE+ F + N     + I +L      DP KRIT    L+  Y 
Sbjct:   19 LGEGAYGVVCSATHKPTGEIVAIKKI-EPFDKPLFALRTLREIKILKHFKHENIITIFNIQRPDSFENFNEVYIIQELMQTDLHRVISTQ--MLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGT-PHSDNDLRCIESPRAREYIKSLPM---YPAAPLEKMFPRVN----PKGIDLLQRMLVFDPAKRITAKEALEHPYL 309          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Match: EDO49500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB2])

HSP 1 Score: 335.109 bits (858), Expect = 1.715e-112
Identity = 156/293 (53.24%), Postives = 214/293 (73.04%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL----GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +++E+L K+GEG+YG VFKCR K+TG++VAIK+F E +    I  +A+RE++ML+ L+HPNLV+L+E+FKRK  +HLVF+Y D T+L  L+  P  +N+  +K+I+YQ ++ +++CH  N IHRD+KPENIL+T+NY +K+CDFGFAR +    G D  YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPG+SD+DQL+LI  TLG+L   H   F +N +F G Q+PEP   +PLE  +      IS + +  + GC  M+P  R+TC+ LL   YF
Sbjct:    2 ERFEKLGKIGEGSYGVVFKCRHKETGQIVAIKKFVESEDDPLIKKIAMREVKMLKQLKHPNLVNLLEVFKRKRKLHLVFEYCDQTVLNVLDKHPNGVNEDTVKNIIYQTLKAVDFCHSHNCIHRDVKPENILITKNYIIKLCDFGFARLISRYPGED--YTDYVATRWYRAPELLVGDTAYGPPVDVWAIGCVFAELLVGQPLWPGRSDVDQLYLIKKTLGNLIPRHIQIFSQNHFFRGLQIPEPTTREPLEMKYSH----ISTDALSFMKGCLVMEPNDRLTCEELLDHKYF 288          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 304.679 bits (779), Expect = 2.769e-100
Identity = 143/291 (49.14%), Postives = 206/291 (70.79%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +KYE L  +GEG+YG V KCR KD+ ++VAIK+F E +    +  +A+RE+RMLR LRH NLV+LIE+F+RK  + LVF+++DHT+L +LE  P  L+++ ++ +++Q+++ IE+ HR NIIHRD+KPENIL++ +  VK+CDFGFAR L  G    YTDYVATRWYR+PELLVGD  YG  VDVWA+GC+ AEM+   PL+PG SD+DQL+ I+   G+L   H++ F++N  F G ++P+   ++P+E  F +    IS   + +L  C +MDP +R TC  LL   +F
Sbjct:    2 EKYENLGLVGEGSYGMVMKCRHKDSNQIVAIKKFIESEDDKMVKKIAMREVRMLRQLRHENLVNLIEVFRRKKRLFLVFEFVDHTVLDDLERYPNGLDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYRAPELLVGDTKYGRAVDVWAVGCLLAEMLTGEPLFPGDSDIDQLYHIMRCFGNLISRHREIFQKNPLFVGMRLPDIKEVEPMERRFPR----ISPMAVDMLKLCLKMDPSERPTCAQLLNHDFF 288          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Match: EDO41403 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4F0])

HSP 1 Score: 202.986 bits (515), Expect = 1.695e-61
Identity = 109/300 (36.33%), Postives = 172/300 (57.33%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEA-KPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNY-----IISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLN 1143
            + +E++ K+GEG YG V+K R K TG +VA+K+         + + AIREI +L+ L HPN+V L+++   +  ++LVF+++   L + ++   P  ++ S +KS +YQ++ G+ YCH   ++HRD+KP+N+L+ +N  +K+ DFG AR  G     YT  V T WYR+PE+L+G  +Y  PVDVW+IGC+FAEM     L+PG S++DQLF I  TLG+ PD        +K + G  V E  + K     +  Q+       +    I +L       P  RI+  A L   +F ++ 
Sbjct:    2 ENFEKVEKIGEGTYGVVYKARDKTTGRMVALKKIRLDTESEGVPSTAIREISLLKELNHPNVVSLLDVVHNQKSLYLVFEFLSQDLKKYMDCLPPSGISTSLIKSYVYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEVVTLWYRAPEILLGSRYYATPVDVWSIGCIFAEMKTRRALFPGDSEIDQLFRIFRTLGT-PD--------DKVWPG--VSELPDYKTSFPKWPVQSIRHVLPTLDNTAIDLLQKMLTYQPNARISAKAALSHEFFKDVQ 290          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Match: EDO41147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S560])

HSP 1 Score: 196.438 bits (498), Expect = 4.533e-59
Identity = 102/291 (35.05%), Postives = 171/291 (58.76%), Query Frame = 1
Query:  268 KYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYII---SKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +Y+ + +LG+G YG+V   +   TGE VAIK+  +    +    + +RE++ LR L H N+V L E+ +   H++ VF+Y+   L Q ++ +   L +S +++++YQI+QG+ + H+    HRD+KPEN+L T +  VKI DFG AR   +   YTDYV+TRWYR+PE+L+   +Y  P+D+WA+GC+ AE+  + PL+PG S++D++F + + LG          + +++ EG ++    N K  +      + +I   S E I+++      +PKKR T    L   YF
Sbjct:    3 RYQSIKQLGDGTYGSVELAKNIQTGETVAIKKMKK-KYFSWDECINLREVKSLRKLSHTNIVKLKEVIRENDHLYFVFEYMKENLYQMMKNRDKLLPESVIRNVIYQILQGLAFIHKHGYFHRDMKPENLLCTGHELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRSTNYSSPIDIWAVGCIMAELYTLRPLFPGSSEVDEIFKVCSVLGPP--------KPDEWPEGHKLASAMNFKFPQTKATSLHSLIPNASAEAIQLMQEMLFWNPKKRPTAAQALHFPYF 284          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Match: EDO43671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXS1])

HSP 1 Score: 182.956 bits (463), Expect = 9.592e-54
Identity = 110/304 (36.18%), Postives = 161/304 (52.96%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRH-PNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTD-NIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLG-----------SLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCN 1137
            D + ++ K+GEG YG V+K +   TG   A+K+         I + A+REI +L+ LRH PN+V L  I  ++  ++LVF+Y+   L + L+     L+K+ +KS LYQI   I +CH   I+HRD+KP+N+L+     +K+ DFG  R  G     YT  V T WYR+PE+L+G   Y  P+DVW+IG +FAEM+   PL+ G S++DQLF I   LG           SLPD +K TF +    +G +   P                +  + + +L      DP  RI+    LK  YF N
Sbjct:    2 DDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKIRLEVEDEGIPSTAVREISLLKELRHHPNVVELQHILHQEPKLYLVFEYLTCDLKKHLDTTRGMLDKTLVKSYLYQITNAIYFCHARRILHRDLKPQNLLIDSKGLIKLADFGLGRAFGIPVRAYTHEVVTLWYRAPEVLLGGQRYSCPIDVWSIGTIFAEMVTKRPLFHGDSEIDQLFRIFRILGTPTEETWKGVTSLPD-YKPTFPKWA-GDGLKKAVPQ---------------LDSDGLDLLKKMLIYDPALRISAKTSLKHPYFLN 288          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:101159782])

HSP 1 Score: 350.132 bits (897), Expect = 1.217e-116
Identity = 179/365 (49.04%), Postives = 239/365 (65.48%), Query Frame = 1
Query:  250 QKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF-CNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTH-NQLTDHIISTTNNNNLYNKL 1335
            QK M +KYE++ K+GEG+YG VFKCR ++TG++VAIK+F E D    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T+   +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G  VPEP   +PLE+ +      +S++ + +L  C +MDP +R++C  LL+  YF C    S+S     + P                  K A+LP     P H  QLT   I    NN  Y+ L
Sbjct:   56 QKKM-EKYEKIAKIGEGSYGVVFKCRSRETGQIVAIKKFVESDEDPIIRKIALREIRMLKQLKHANLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRHPRGVPEHLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKQQVIKLCDFGFARILTGPGDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDMDQLYLIRKTLGDLIPRHQQVFSTNQYFCGLPVPEPQEREPLEQKYPN----LSQQTLSLLKSCLKMDPSERLSCQQLLQHPYFSCMRERSQSSAPEPDRP----------------GNKRARLPRRPLPPGHLPQLTGSSIFPALNNRKYHDL 399          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Match: cdkl1 (cyclin dependent kinase like 1 [Source:NCBI gene;Acc:101159782])

HSP 1 Score: 346.665 bits (888), Expect = 1.519e-115
Identity = 165/312 (52.88%), Postives = 223/312 (71.47%), Query Frame = 1
Query:  250 QKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF-CNLNGSESVLRYSNNP 1179
            QK M +KYE++ K+GEG+YG VFKCR ++TG++VAIK+F E D    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF+Y DHT+L EL+  P  + +  +KSI +Q +Q + +CH+ N IHRD+KPENIL+T+   +K+CDFGFAR L G  + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  F  N+YF G  VPEP   +PLE+ +      +S++ + +L  C +MDP +R++C  LL+  YF C    S+S     + P
Sbjct:   56 QKKM-EKYEKIAKIGEGSYGVVFKCRSRETGQIVAIKKFVESDEDPIIRKIALREIRMLKQLKHANLVNLMEVFRRKRKLHLVFEYCDHTVLNELDRHPRGVPEHLVKSITWQTLQAVNFCHKQNCIHRDVKPENILITKQQVIKLCDFGFARILTGPGDYYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAELLSGIPLWPGKSDMDQLYLIRKTLGDLIPRHQQVFSTNQYFCGLPVPEPQEREPLEQKYPN----LSQQTLSLLKSCLKMDPSERLSCQQLLQHPYFSCMRERSQSSAPEPDRP 362          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Match: ENSORLT00000001547.2 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:101157382])

HSP 1 Score: 334.339 bits (856), Expect = 2.680e-111
Identity = 156/297 (52.53%), Postives = 215/297 (72.39%), Query Frame = 1
Query:  259 MRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL-GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNG 1146
            M +KYE+L K+GEG+YG VFKCR +DTG++VAIK+F E +    I  +A+REIRML+ L+H NLV+L+E+F+RK  +HLVF++ + T+L EL+  P  + ++ +KSI++Q +Q + +CH+ N IHRD+KPENILLT+   +K+CDFGFAR L G ++ YTDYVATRWYR+PELLVGD  YGPPVDVWA+GCVFAE++   PLWPGKSD+DQL+LI  TLG L   H+  FR N +F G  +P+P   +PLE+ F       S + ++++  C  MDP  R++C  LL+  YF    G
Sbjct:    3 MMEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEEDPVIKKIALREIRMLKQLKHVNLVNLLEVFRRKRRLHLVFEFCEQTVLNELDRHPRGVPEAQLKSIVWQTLQAVNFCHKHNCIHRDVKPENILLTKTGVIKLCDFGFARILTGPEDDYTDYVATRWYRAPELLVGDTQYGPPVDVWALGCVFAELLDGNPLWPGKSDVDQLYLIRKTLGDLIPHHQQIFRSNVFFSGVSIPDPDATEPLEKRFQGA----SPQALQVMKSCLVMDPSLRLSCQELLELPYFQEEAG 295          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Match: ENSORLT00000032275.1 (probable serine/threonine-protein kinase fhkE [Source:NCBI gene;Acc:101170219])

HSP 1 Score: 299.286 bits (765), Expect = 2.325e-91
Identity = 139/292 (47.60%), Postives = 197/292 (67.47%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGT---DNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYF 1131
            +++E L  +GEG+YGTV KCR +++G LVAIK+F + D   ++  +A+REI++LR LRH NLV+L+E++KR+   +LVF+++D TLL +LE  P  LN    +  LYQI++  ++CH+ N+IHRDIKPENIL++    VK+CDFGFAR + +     +YTDYVATRWYR+PELLVGD  YG PVDVWA+GC+  EM+   PL+PG+SDLDQ+  I+   G+L   H++ F RN  F G ++PE      L++ F      I    I +   C EMDP++R  C  LL+   F
Sbjct:    2 ERFESLGPVGEGSYGTVLKCRHRESGRLVAIKKFIDSDDDKTVRKIALREIKLLRQLRHENLVNLLEVWKRRRRWYLVFEFVDRTLLNDLEQNPGGLNLDTARQYLYQILRATDFCHQQNVIHRDIKPENILISHMGVVKLCDFGFARTMTSPPESAVYTDYVATRWYRAPELLVGDFKYGKPVDVWAVGCLIIEMLTSQPLFPGESDLDQIHHIVRCFGNLMTQHQELFYRNPVFSGVKLPECSGSVSLQQRFP----TIPAAGINLAQKCLEMDPERRAQCSELLQNPLF 289          
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Match: cdkl5 (cyclin-dependent kinase-like 5 [Source:NCBI gene;Acc:101174816])

HSP 1 Score: 246.128 bits (627), Expect = 3.507e-71
Identity = 128/316 (40.51%), Postives = 192/316 (60.76%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPL--GTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRK 1206
            +K+E L  +GEGAYG V KCR K+T ELVAIK+F + +    +    +RE++MLR L+  N+V L E F+R+  ++LVF+Y++  +L+ LE  P       ++S +YQ+++ I +CH++ I+HRDIKPEN+L++ N  +K+CDFGFAR L  GTD  YT+YVATRWYRSPELL+G   YG  VD+W++GC+  E+    PL+PG+S++DQLF I   LG LP      F  N  F G + P   + + LE  +     I+S   + ++     ++P +R   +  L    F  L  +E      ++P   C + RK
Sbjct:    2 NKFEVLGIVGEGAYGVVLKCRHKETNELVAIKKFKDSEENEEVKETTLRELKMLRTLKQDNIVELKEAFRRRGKLYLVFEYVERNMLELLEEFPNGALPDKVRSYIYQLIKAINWCHKNEIVHRDIKPENLLISSNDVLKLCDFGFARNLSEGTDANYTEYVATRWYRSPELLLG-APYGKAVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYNNPRFHGIRFPSVTHPQTLERRY---QGILSGLLLDLMKSLLLLNPTERYLTEQSLNHPVFQPLRQAERERTSLSSPNPPCSSKRK 313          
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 410/415 (98.80%), Postives = 412/415 (99.28%), Query Frame = 1
Query:  157 AII*QMNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 1401
             ++ QMNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLN SESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF
Sbjct:  276 VVVSQMNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 690          
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 409/410 (99.76%), Postives = 409/410 (99.76%), Query Frame = 1
Query:  172 MNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 1401
            MNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLN SESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF
Sbjct:    1 MNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 410          
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Match: SMESG000038932.1 (SMESG000038932.1)

HSP 1 Score: 792.341 bits (2045), Expect = 0.000e+0
Identity = 381/383 (99.48%), Postives = 382/383 (99.74%), Query Frame = 1
Query:  253 KSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 1401
            +SMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLN SESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF
Sbjct:    6 RSMRDKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNSSESVLRYSNNPRWHCEANRKQILFTDQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLPVIQTKRFTKF 388          
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Match: SMESG000041875.1 (SMESG000041875.1)

HSP 1 Score: 366.696 bits (940), Expect = 1.408e-123
Identity = 174/315 (55.24%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQ 1209
            DKYE++ ++GEGAYG V+KCR ++TGELVAIK+F+E +    IH +A+REIR L+ L+H NLV+LIE+FKRK  +HLVFQYIDHTLL ELE KP  L++  +  I  Q++  I +CH+ N IHRD+KPENIL+T++ QVK+CDFGFAR L   + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM+R  PLWPG SDLDQ++LII TLG L    K+ F+ N +F G  +PE    +PLE+ F     ++S +EI  +  CF+M+P+ R TCD LLK  YF +    E   + +  P    + NR++
Sbjct:    2 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 316          
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Match: SMESG000041875.1 (SMESG000041875.1)

HSP 1 Score: 367.851 bits (943), Expect = 9.391e-123
Identity = 174/315 (55.24%), Postives = 227/315 (72.06%), Query Frame = 1
Query:  265 DKYERLYKLGEGAYGTVFKCRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIFKRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRSNIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPELLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSLPDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGCFEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQ 1209
            DKYE++ ++GEGAYG V+KCR ++TGELVAIK+F+E +    IH +A+REIR L+ L+H NLV+LIE+FKRK  +HLVFQYIDHTLL ELE KP  L++  +  I  Q++  I +CH+ N IHRD+KPENIL+T++ QVK+CDFGFAR L   + YTDYVATRWYR+PELLVGD  YGPPVDVWAIGCVFAEM+R  PLWPG SDLDQ++LII TLG L    K+ F+ N +F G  +PE    +PLE+ F     ++S +EI  +  CF+M+P+ R TCD LLK  YF +    E   + +  P    + NR++
Sbjct:   90 DKYEKIGQIGEGAYGVVYKCRNRETGELVAIKKFTESEDDPVIHKIAMREIRSLKQLKHENLVNLIEVFKRKRRLHLVFQYIDHTLLNELEQKPNGLDRERICKITSQLLLAIRFCHQHNCIHRDVKPENILVTKSGQVKLCDFGFARILSPGDEYTDYVATRWYRAPELLVGDTQYGPPVDVWAIGCVFAEMLRGQPLWPGMSDLDQIYLIIKTLGDLLPRFKEIFQNNSFFRGISLPESKTQEPLEDKFTSIRPLLSSKEISFMQKCFQMEPQDRYTCDQLLKHEYFDSFPDLEDDSQATERPNRADKQNRRR 404          
The following BLAST results are available for this feature:
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDKL11.281e-11852.24cyclin dependent kinase like 1 [Source:HGNC Symbol... [more]
CDKL41.077e-11345.62cyclin dependent kinase like 4 [Source:HGNC Symbol... [more]
CDKL41.821e-11351.10cyclin dependent kinase like 4 [Source:HGNC Symbol... [more]
CDKL14.224e-10657.14cyclin dependent kinase like 1 [Source:HGNC Symbol... [more]
CDKL25.408e-9345.45cyclin dependent kinase like 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl-13.251e-10852.23Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdkl-14.804e-10852.23Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdkl-16.508e-10852.23Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
dyf-53.116e-6035.23Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
dyf-54.403e-6035.23Serine/threonine-protein kinase dyf-5 [Source:Uni... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG72362.554e-11049.27gene:FBgn0031730 transcript:FBtr0343387[more]
CG72369.459e-10951.94gene:FBgn0031730 transcript:FBtr0343388[more]
CG72363.378e-10851.94gene:FBgn0031730 transcript:FBtr0302950[more]
CG72363.864e-10851.94gene:FBgn0031730 transcript:FBtr0343389[more]
Cdk71.311e-5936.49gene:FBgn0263237 transcript:FBtr0070756[more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl14.576e-11754.30cyclin-dependent kinase-like 1 (CDC2-related kinas... [more]
cdkl58.972e-7140.39cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl58.972e-7140.39cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl58.972e-7140.39cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
cdkl51.485e-7040.39cyclin-dependent kinase-like 5 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDKL13.291e-11354.14cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
CDKL11.467e-10651.89cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
vsx27.063e-8947.23visual system homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
vldlr8.301e-7139.62very low density lipoprotein receptor [Source:Xenb... [more]
vldlr5.267e-6437.74very low density lipoprotein receptor [Source:Xenb... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdkl42.872e-11654.67cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl42.872e-11654.67cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl42.872e-11654.67cyclin-dependent kinase-like 4 [Source:MGI Symbol;... [more]
Cdkl11.261e-11449.72cyclin-dependent kinase-like 1 (CDC2-related kinas... [more]
Cdkl21.033e-8947.95cyclin-dependent kinase-like 2 (CDC2-related kinas... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00532|CDKL1_HUMAN5.229e-11852.24Cyclin-dependent kinase-like 1 OS=Homo sapiens OX=... [more]
sp|Q3TZA2|CDKL4_MOUSE2.009e-11554.67Cyclin-dependent kinase-like 4 OS=Mus musculus OX=... [more]
sp|Q6AXJ9|CDKL1_DANRE7.197e-11553.97Cyclin-dependent kinase-like 1 OS=Danio rerio OX=7... [more]
sp|Q8CEQ0|CDKL1_MOUSE8.821e-11449.72Cyclin-dependent kinase-like 1 OS=Mus musculus OX=... [more]
sp|Q5MAI5|CDKL4_HUMAN5.170e-11345.62Cyclin-dependent kinase-like 4 OS=Homo sapiens OX=... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DKM91.333e-12653.50Protein kinase domain-containing protein OS=Macros... [more]
A0A267E9891.486e-12653.50Protein kinase domain-containing protein OS=Macros... [more]
A0A267ER401.409e-12256.72Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8J2902.665e-12258.28Protein kinase domain-containing protein OS=Macros... [more]
A0A267FJ046.362e-12257.19Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl11.087e-11355.17cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000057054.18.363e-11252.36cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000052448.18.363e-11252.36cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
cdkl11.426e-10953.79cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000033332.16.369e-10551.35cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdk24.473e-6438.69cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk23.288e-6235.91cyclin-dependent kinase 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
cdk72.330e-5937.13cyclin-dependent kinase 7 [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000003004.11.031e-5836.64pep scaffold:Pmarinus_7.0:GL476686:67050:81358:1 g... [more]
mak8.483e-5736.45male germ cell-associated kinase [Source:ZFIN;Acc:... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PHO857.904e-5332.26Cyclin-dependent kinase; has ten cyclin partners; ... [more]
KIN289.809e-5332.19Serine/threonine protein kinase, subunit of transc... [more]
HOG16.541e-4936.00Mitogen-activated protein kinase involved in osmor... [more]
CDC284.928e-4839.01Cyclin-dependent kinase (CDK) catalytic subunit; m... [more]
FUS31.496e-4332.12Mitogen-activated serine/threonine protein kinase ... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495001.715e-11253.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354022.769e-10049.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414031.695e-6136.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411474.533e-5935.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436719.592e-5436.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl11.217e-11649.04cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
cdkl11.519e-11552.88cyclin dependent kinase like 1 [Source:NCBI gene;A... [more]
ENSORLT00000001547.22.680e-11152.53cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSORLT00000032275.12.325e-9147.60probable serine/threonine-protein kinase fhkE [Sou... [more]
cdkl53.507e-7140.51cyclin-dependent kinase-like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Cyclin dependent kinase like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038932.10.000e+098.80SMESG000038932.1[more]
SMESG000038932.10.000e+099.76SMESG000038932.1[more]
SMESG000038932.10.000e+099.48SMESG000038932.1[more]
SMESG000041875.11.408e-12355.24SMESG000041875.1[more]
SMESG000041875.19.391e-12355.24SMESG000041875.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006225 ID=SMED30006225|Name=Cyclin dependent kinase like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1501bp
GGATCGTAATATTTACAGAGTATTTGGAAAATAAATATTGCAGTTCTCAT
TTATGTATAAATAAAAATAAATAAATACAAAAATTACAGTTATTAGCTCA
TTATCAGTTTTCTATTTACAATTTCATTTTTGCTTCGAAATATTTCTCAT
TAGAATGCAATCATATAACAGATGAACACATTGAATAGTTTTGTTCGTTC
CAAACAAATTTGCGAGTTACCTCGCTCACTTGATCGAAAGTTTAATACAC
AAAAGTCAATGCGGGATAAGTATGAAAGACTATACAAACTCGGAGAAGGA
GCATATGGGACTGTCTTTAAATGTCGTTTAAAAGACACAGGTGAATTGGT
TGCCATCAAAAGATTCAGTGAACCAGATACAATAACCAGTATTCATAACA
TGGCCATTAGAGAAATAAGGATGTTACGACTATTGCGTCATCCAAATTTG
GTGCATTTAATTGAAATTTTCAAAAGAAAACATCATATACATCTAGTATT
CCAATACATTGACCATACTTTGCTGCAAGAACTTGAGGCAAAACCATACA
AGTTGAACAAATCCAATATGAAAAGTATTCTTTATCAAATAGTACAAGGA
ATTGAATATTGTCATAGATCAAATATAATTCACCGAGATATTAAACCAGA
AAATATCCTTTTAACAGAAAATTATCAAGTAAAAATTTGTGATTTTGGAT
TTGCTCGTCCATTGGGAACGGATAATATTTATACAGATTACGTAGCTACC
CGGTGGTATCGCAGTCCCGAGTTACTAGTTGGCGATATCCATTATGGGCC
CCCAGTAGATGTATGGGCAATTGGATGTGTGTTTGCTGAAATGATTAGAA
TTTGCCCGCTTTGGCCGGGAAAATCTGACCTTGATCAATTATTTCTTATA
ATAAATACTCTCGGGAGTCTTCCAGACATTCACAAAGACACATTCAGAAG
AAATAAGTACTTTGAAGGATTTCAGGTTCCAGAGCCATGCAATTTGAAAC
CATTGGAAGAGAATTTCATACAACAGAATTACATTATATCCAAAGAAGAA
ATAAAAATATTGCATGGATGCTTTGAAATGGATCCAAAGAAACGAATCAC
GTGTGATGCACTGCTTAAAGAATCATATTTTTGTAATCTCAATGGTTCAG
AATCAGTTTTGCGTTATTCAAATAATCCAAGATGGCATTGCGAAGCAAAC
AGAAAACAAATTTTATTTACAGATCAAAATAAAAAGGTAGCGAAATTGCC
TTCTCTTATTTATTATCCTACCCATAACCAATTAACAGACCACATCATAT
CTACGACAAATAATAACAACTTATATAACAAATTGGAAATAACCGAAAAG
AAGTTGTTACCAAGATTACCGGTCATTCAAACAAAAAGATTTACAAAGTT
TTGATAACATTTCAGTTTATGATTATTTGTCTTCTTGTATTATTAAGAGT
ATTATAAAATTGAAACATTTATTTGGATAATTGAATTGTTTATCTACTTG
C
back to top

protein sequence of SMED30006225-orf-1

>SMED30006225-orf-1 ID=SMED30006225-orf-1|Name=SMED30006225-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=411bp
MNTLNSFVRSKQICELPRSLDRKFNTQKSMRDKYERLYKLGEGAYGTVFK
CRLKDTGELVAIKRFSEPDTITSIHNMAIREIRMLRLLRHPNLVHLIEIF
KRKHHIHLVFQYIDHTLLQELEAKPYKLNKSNMKSILYQIVQGIEYCHRS
NIIHRDIKPENILLTENYQVKICDFGFARPLGTDNIYTDYVATRWYRSPE
LLVGDIHYGPPVDVWAIGCVFAEMIRICPLWPGKSDLDQLFLIINTLGSL
PDIHKDTFRRNKYFEGFQVPEPCNLKPLEENFIQQNYIISKEEIKILHGC
FEMDPKKRITCDALLKESYFCNLNGSESVLRYSNNPRWHCEANRKQILFT
DQNKKVAKLPSLIYYPTHNQLTDHIISTTNNNNLYNKLEITEKKLLPRLP
VIQTKRFTKF*
back to top
Aliases
The feature 'Cyclin dependent kinase like 1' has the following synonyms
Synonym
cdkl1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004693cyclin-dependent protein serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007507heart development
GO:0016310phosphorylation
GO:0051726regulation of cell cycle
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0043231intracellular membrane-bounded organelle
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 34..320
e-value: 5.5E-92
score: 321.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 34..320
e-value: 8.1E-74
score: 248.3
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 34..320
score: 45.714
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 30..114
e-value: 3.1E-28
score: 99.7
NoneNo IPR availablePFAMPF12330Haspin_kinasecoord: 13..181
e-value: 1.1E-6
score: 27.8
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 13..263
e-value: 4.5E-19
score: 66.1
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 115..323
e-value: 5.1E-61
score: 207.9
NoneNo IPR availablePANTHERPTHR24056CELL DIVISION PROTEIN KINASEcoord: 32..339
NoneNo IPR availablePANTHERPTHR24056:SF192CYCLIN-DEPENDENT KINASE-LIKE 1coord: 32..339
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 152..164
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 40..63
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 28..323