PHB domain-containing protein

Overview
NamePHB domain-containing protein
Smed IDSMED30006221
Length (bp)1404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PHB domain-containing protein (SMED30006221) t-SNE clustered cells

Violin plots show distribution of expression levels for PHB domain-containing protein (SMED30006221) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PHB domain-containing protein (SMED30006221) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PHB domain-containing protein (SMED30006221) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006221

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006221SMESG000037334.1 dd_Smed_v4_6396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006221SMESG000037334.1 dd_Smed_v4_6396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006221SMESG000037334.1 dd_Smed_v4_6396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006221SMESG000037334.1 dd_Smed_v4_6396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006221SMESG000037334.1 dd_Smed_v4_6396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006221SMESG000037334.1 Contig42618uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006221SMESG000037334.1 Contig42618newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006221SMESG000009300.1 dd_Smed_v6_11883_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006221SMESG000037334.1 dd_Smed_v6_6396_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOM (stomatin [Source:HGNC Symbol;Acc:HGNC:3383])

HSP 1 Score: 306.22 bits (783), Expect = 2.559e-101
Identity = 166/254 (65.35%), Postives = 210/254 (82.68%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            C   L+  S+    +TFPIS+  CIK++ EYERA+IFRLGRIL GGAKGPGLFFILPC D   KVD+RT++FD+PPQE+LTKDSVT++VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNL++ILS+R+ I+  MQ+ LD+AT  WG+KVERVE+KDV+LPVQLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTL  I+AEKNSTI+FPLP+++++     K
Sbjct:   30 CGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDDATDAWGIKVERVEIKDVKLPVQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDMLQGIIGAK 283          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOML3 (stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420])

HSP 1 Score: 273.478 bits (698), Expect = 1.042e-88
Identity = 150/258 (58.14%), Postives = 202/258 (78.29%), Query Frame = 3
Query:  477 DKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            +K+   C   L  +S+ LV +TFPIS+  C+K++ EYERAV+FRLGRI    AKGPGL  +LPCID   KVDLRTVT ++PPQE+LT+DSVT  VD VVYYRIY+ + +V NV +  ++T LLA TTLRNVLGT+ L++IL+ R+ I+  +Q LLD+AT  WG++V RVE+KDVR+PVQLQR+MAAEAEA RE++AKV+AA GE  ++K+LK A+ V+++SP+ALQLRYLQTL+ ++ EKNSTI+FPLPM +++    
Sbjct:   12 NKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGG 269          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOML3 (stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420])

HSP 1 Score: 273.092 bits (697), Expect = 2.223e-88
Identity = 150/258 (58.14%), Postives = 202/258 (78.29%), Query Frame = 3
Query:  477 DKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            +K+   C   L  +S+ LV +TFPIS+  C+K++ EYERAV+FRLGRI    AKGPGL  +LPCID   KVDLRTVT ++PPQE+LT+DSVT  VD VVYYRIY+ + +V NV +  ++T LLA TTLRNVLGT+ L++IL+ R+ I+  +Q LLD+AT  WG++V RVE+KDVR+PVQLQR+MAAEAEA RE++AKV+AA GE  ++K+LK A+ V+++SP+ALQLRYLQTL+ ++ EKNSTI+FPLPM +++    
Sbjct:   21 NKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPMNILEGIGG 278          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: NPHS2 (NPHS2 stomatin family member, podocin [Source:HGNC Symbol;Acc:HGNC:13394])

HSP 1 Score: 209.92 bits (533), Expect = 1.019e-62
Identity = 117/252 (46.43%), Postives = 176/252 (69.84%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            C   L+L+S   + +TFP S+  C+KVV EYER +IFRLG +L G AKGPGLFF LPC+D   KVDLR  T ++P  E++TKD   + +DA+ YYR+ N  + ++++ +  ++ + L  TT++ +L  ++L EIL ER SI+   +  LD  T  WG+KVER+E+KDVRLP  LQ ++A EAEA R++K ++IAA  E+ ++++L+ AA+++S +P A+QLRYL TL ++S EK ST++ PLP +L+   SS
Sbjct:  101 CEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHVSKAVQFLVQTTMKRLLAHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSS 352          
BLAST of PHB domain-containing protein vs. Ensembl Human
Match: STOM (stomatin [Source:HGNC Symbol;Acc:HGNC:3383])

HSP 1 Score: 199.519 bits (506), Expect = 1.557e-61
Identity = 90/138 (65.22%), Postives = 111/138 (80.43%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSER 908
            C   L+  S+    +TFPIS+  CIK++ EYERA+IFRLGRIL GGAKGPGLFFILPC D   KVD+RT++FD+PPQE+LTKDSVT++VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNL++I S R
Sbjct:   30 CGWILVAFSFLFTVITFPISIWMCIKIIKEYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQISSLR 167          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 330.102 bits (845), Expect = 1.054e-109
Identity = 184/261 (70.50%), Postives = 221/261 (84.67%), Query Frame = 3
Query:  462 EISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            E + +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:  106 EKANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 325.865 bits (834), Expect = 4.810e-109
Identity = 187/285 (65.61%), Postives = 232/285 (81.40%), Query Frame = 3
Query:  390 TGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            +G     K +++  +K   +++A+    +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:   11 SGTDSTPKTTILPAKKDYFHVEAN----IQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 291          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 325.479 bits (833), Expect = 1.224e-108
Identity = 183/259 (70.66%), Postives = 220/259 (84.94%), Query Frame = 3
Query:  468 SQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            + +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:   49 ANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 307          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 324.324 bits (830), Expect = 2.260e-108
Identity = 183/259 (70.66%), Postives = 220/259 (84.94%), Query Frame = 3
Query:  468 SQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            + +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:   41 ANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 299          
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 329.331 bits (843), Expect = 3.424e-108
Identity = 184/261 (70.50%), Postives = 221/261 (84.67%), Query Frame = 3
Query:  462 EISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            E + +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:  106 EKANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301096)

HSP 1 Score: 317.39 bits (812), Expect = 1.865e-104
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:   59 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 316          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333583)

HSP 1 Score: 316.62 bits (810), Expect = 3.047e-104
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:   54 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 311          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0344807)

HSP 1 Score: 317.005 bits (811), Expect = 3.215e-104
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:   66 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 323          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333584)

HSP 1 Score: 317.005 bits (811), Expect = 3.342e-104
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:   70 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 327          
BLAST of PHB domain-containing protein vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301097)

HSP 1 Score: 316.62 bits (810), Expect = 3.689e-104
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:   58 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 315          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 315.849 bits (808), Expect = 2.787e-105
Identity = 172/268 (64.18%), Postives = 217/268 (80.97%), Query Frame = 3
Query:  453 DASEISQMD----KQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            D + I Q D    K   FC   L   S  L+  TFP+S+  C+KVV EYERAVIFRLGR+L GGAKGPGLF+I+PC+D  RKVDLRTV+FD+P QEVLTKDSVT+ VDAVVYYRI+NP VS+T VENA+ +T++LA TTLRN+LGTK+LA+IL +R+ +S  M+A+L  A+  WG+KVERVE+KDV+LP  LQRAMAAEAEA R+++AKVIAA GE K+++ALKEAA+V+S+SP ALQLRY+QTL  I++E+NSTIIFP+PM+LM  F
Sbjct:   22 DTNVIVQSDGDQSKSCGFCGYILTFFSCLLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLL-GGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGF 288          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 316.235 bits (809), Expect = 3.397e-105
Identity = 172/268 (64.18%), Postives = 217/268 (80.97%), Query Frame = 3
Query:  453 DASEISQMD----KQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            D + I Q D    K   FC   L   S  L+  TFP+S+  C+KVV EYERAVIFRLGR+L GGAKGPGLF+I+PC+D  RKVDLRTV+FD+P QEVLTKDSVT+ VDAVVYYRI+NP VS+T VENA+ +T++LA TTLRN+LGTK+LA+IL +R+ +S  M+A+L  A+  WG+KVERVE+KDV+LP  LQRAMAAEAEA R+++AKVIAA GE K+++ALKEAA+V+S+SP ALQLRY+QTL  I++E+NSTIIFP+PM+LM  F
Sbjct:   35 DTNVIVQSDGDQSKSCGFCGYILTFFSCLLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLL-GGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKVIAAEGEMKASRALKEAANVMSESPAALQLRYMQTLTEIASERNSTIIFPVPMDLMSGF 301          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 309.301 bits (791), Expect = 8.182e-103
Identity = 176/263 (66.92%), Postives = 211/263 (80.23%), Query Frame = 3
Query:  465 ISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            IS+ D     C   L+++S F   L FPIS+   IK+V EYERAVIFRLGRI    AKGPG+FFI+PC D   KVDLRTV+FD+PPQE+LTKDSVTV+VD VVY+R+ +P+ SV NV NAD STRLLA TTLRNVLGTKNLAE+LS+R+ IS  MQ  LDEAT  WG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTI+FPLP+++M  F  K
Sbjct:   18 ISENDGSLGCCGWILVIISAFFSILVFPISIFISIKIVKEYERAVIFRLGRITARKAKGPGIFFIIPCTDSFIKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVNDPVASVANVSNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQTTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIVFPLPIDIMNHFIRK 280          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stom (stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486])

HSP 1 Score: 307.76 bits (787), Expect = 4.458e-102
Identity = 182/282 (64.54%), Postives = 222/282 (78.72%), Query Frame = 3
Query:  399 HQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
             + R+   +D E  S N  A E    D     C   L++ S  L  LT P+S+  CIK+V EYERA+IFRLGRIL GGAKGPGLFFILPC D    VD+RT+TFD+PPQEVLTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LD+AT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLP+++M+SF
Sbjct:   12 EEERRKRQIDSELSSRNNKALE--NTDSDIGLCGWILVIFSILLTLLTLPLSIWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPIDMMQSF 291          
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Match: stom (stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486])

HSP 1 Score: 307.76 bits (787), Expect = 4.458e-102
Identity = 182/282 (64.54%), Postives = 222/282 (78.72%), Query Frame = 3
Query:  399 HQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
             + R+   +D E  S N  A E    D     C   L++ S  L  LT P+S+  CIK+V EYERA+IFRLGRIL GGAKGPGLFFILPC D    VD+RT+TFD+PPQEVLTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LD+AT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLP+++M+SF
Sbjct:   12 EEERRKRQIDSELSSRNNKALE--NTDSDIGLCGWILVIFSILLTLLTLPLSIWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDDATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPIDMMQSF 291          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 316.62 bits (810), Expect = 3.381e-105
Identity = 178/280 (63.57%), Postives = 222/280 (79.29%), Query Frame = 3
Query:  420 VVDPEKCS--INMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            + DPE  S   N +   I + D     C   L+++S+F   LTFPIS+  CIK+V EYERA+IFRLGRIL GGAKGPGLFF+LPC D    VD+RT++FD+PPQE+LTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNL++ILS+R+ I+  MQ+ LD AT  WG+KVERVE+KDV+LPVQLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VIS+SP ALQLRYLQTL  I++EKNSTI+FPLP++L+K F  K
Sbjct:   24 MADPELKSRRANQEDRNIEESDGGLGCCGWFLVILSFFFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGFMQK 303          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 313.153 bits (801), Expect = 1.769e-104
Identity = 173/263 (65.78%), Postives = 215/263 (81.75%), Query Frame = 3
Query:  465 ISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            I + D     C   L+++S+F   LTFPIS+  CIK+V EYERA+IFRLGRIL GGAKGPGLFF+LPC D    VD+RT++FD+PPQE+LTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNL++ILS+R+ I+  MQ+ LD AT  WG+KVERVE+KDV+LPVQLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VIS+SP ALQLRYLQTL  I++EKNSTI+FPLP++L+K F  K
Sbjct:    2 IKESDGGLGCCGWFLVILSFFFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGFMQK 264          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 311.227 bits (796), Expect = 1.436e-103
Identity = 171/253 (67.59%), Postives = 212/253 (83.79%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            C   L+++S+F   LTFPIS+  CIK+V EYERA+IFRLGRIL GGAKGPGLFF+LPC D    VD+RT++FD+PPQE+LTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNL++ILS+R+ I+  MQ+ LD AT  WG+KVERVE+KDV+LPVQLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VIS+SP ALQLRYLQTL  I++EKNSTI+FPLP++L+K F  K
Sbjct:   19 CGWFLVILSFFFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGFMQK 271          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: atp8b3 (ATPase, aminophospholipid transporter, class I, type 8B, member 3 [Source:Xenbase;Acc:XB-GENE-992174])

HSP 1 Score: 289.271 bits (739), Expect = 6.945e-95
Identity = 158/264 (59.85%), Postives = 208/264 (78.79%), Query Frame = 3
Query:  465 ISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            I   D     C   ++++S F+ A+TFP+S+  C+K++ EYERAV+FRLGRI++G AKGPG+ F+LPC D   KVDLR ++F +PPQE+LTKDSVT  VD VVYY I + I +V NV N   +T+ LA TTLRN+LGT+ LA IL+ R+ I+  +Q++LD ATH WGVKV+RVE++DVRLPVQ+QRAMAAEAEA RE++AKV+AA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AE NSTI+FPLP+ELM+ F S+K
Sbjct:   20 IEAADGNIGVCGWIILILSAFMAAITFPLSIWFCVKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRVISFAIPPQEILTKDSVTTTVDGVVYYNIQSAIKAVANVNNVHIATQQLAQTTLRNILGTQTLANILANREEIAHNIQSILDHATHKWGVKVDRVEMRDVRLPVQMQRAMAAEAEAAREARAKVVAAEGEMNASRALKEASLVIAESPAALQLRYLQTLNTIAAENNSTIVFPLPIELMQGFLSRK 283          
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000046764.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:22368844:22379341:1 gene:ENSXETG00000020360.1 transcript:ENSXETT00000046764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.662 bits (618), Expect = 8.623e-78
Identity = 130/209 (62.20%), Postives = 175/209 (83.73%), Query Frame = 3
Query:  627 GGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
             GAKGPG+F++LPC D I+ VD+RTV+F VPPQEVLTKDSVT+ VDAVV+YR++NP V+V  V+NA ++T++LA TTLRN+LGTK+L +IL ER+ ++  M  +L EAT  WG++VERVE+KDV+LP  LQRAMAAEAEA R+++AKVIAA GE  ++++LKEAA ++S++P ALQLRYLQTL+ ISAEKNSTI+FP+PM+++   + K
Sbjct:    1 NGAKGPGVFWVLPCADNIKIVDIRTVSFAVPPQEVLTKDSVTIMVDAVVFYRVFNPTVAVVKVDNASQATQMLAQTTLRNMLGTKSLTQILVEREEMAEQMSKILYEATRDWGIRVERVEIKDVKLPQSLQRAMAAEAEASRDARAKVIAAEGEMNASRSLKEAALIMSETPAALQLRYLQTLSHISAEKNSTIVFPVPMDIISMLAPK 209          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stom (stomatin [Source:MGI Symbol;Acc:MGI:95403])

HSP 1 Score: 308.145 bits (788), Expect = 2.380e-102
Identity = 167/248 (67.34%), Postives = 210/248 (84.68%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMK 1238
            C   L+  S+F V +TFPIS+  CIK+V EYER +IFRLGRIL GGAKGPGLFFILPC D + KVD+RT++FD+PPQEVLTKDSVT++VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRN LGTKNL++ILS+R+ I+  MQ+ LD+AT  WG+KVERVE+KDV+LPVQLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTL  I+AEKNSTI+FPLP+++++
Sbjct:   30 CGWILVAASFFFVIITFPISIWICIKIVKEYERVIIFRLGRILQGGAKGPGLFFILPCTDSLIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTIVFPLPVDMLQ 277          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stoml3 (stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MGI:2388072])

HSP 1 Score: 263.462 bits (672), Expect = 6.770e-85
Identity = 145/238 (60.92%), Postives = 191/238 (80.25%), Query Frame = 3
Query:  537 LTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            +TFPIS+  C+K++ EYERAV+FRLGRI    AKGPGL  +LPCID   KVDLRTVT ++PPQE+LT+DSVT  VD VVYYRIY+ + +V NV +  ++T LLA TTLRNVLGT+ L++ILS R+ I+  +Q LLD+AT  WG++V RVE+KDVR+PVQLQR+MAAEAEA RE++AKV+AA GE  ++K+LK A+ V+++SP+ALQLRYLQTL  ++ EKNSTI+FPLPM +++    
Sbjct:   37 VTFPISVWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQTTLRNVLGTQTLSQILSGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMAAEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPVALQLRYLQTLTTVATEKNSTIVFPLPMNILEGIGG 274          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 220.32 bits (560), Expect = 6.427e-67
Identity = 120/252 (47.62%), Postives = 176/252 (69.84%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            C   L+L S   + +TFP S+  CIKVV EYER +IFRLG +L G AKGPGLFF LPC+D   KVDLR  T ++P  EV+TKD   + +DAV YYR+ N  + ++++ +  ++ + L  TT++ +L  ++L EIL ER SI+  ++  LD  T  WG+KVER E+KDVRLP  LQ ++A EAEA R++K +VIAA GE+ ++++L+ AA+++S +P A+QLRYL TL ++S EK +T++ PLP +++   SS
Sbjct:  103 CEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIAQDVKVALDAVTCIWGIKVERTEIKDVRLPAGLQHSLAVEAEAQRQAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLSLLSS 354          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 186.808 bits (473), Expect = 1.434e-55
Identity = 96/252 (38.10%), Postives = 143/252 (56.75%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            C   L+L S   + +TFP S+  CIKVV EYER +IFRLG +L G AKGPGLFF LPC+D   KVDLR  T ++P  EV+TKD   + +DAV YYR+ N  + ++++ +  ++ + L  TT++ +L  ++L EIL ER SI+                                                KVIAA GE+ ++++L+ AA+++S +P A+QLRYL TL ++S EK +T++ PLP +++   SS
Sbjct:   28 CEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLLAHRSLTEILLERKSIA---------------------------------------------QDVKVIAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPATVVLPLPFDMLSLLSS 234          
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Match: Stoml1 (stomatin-like 1 [Source:MGI Symbol;Acc:MGI:1916356])

HSP 1 Score: 110.923 bits (276), Expect = 3.566e-26
Identity = 55/142 (38.73%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  540 TFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWG 965
            TFPIS    +K+V  YER ++FRLGRI     +GPG+  +LP ID  ++VDLRT  F+VPP ++ +KD   ++V A V +RI++P++SV  V++ + +TR+ A   +   L  + L EI  E+  I   +   +++ T  WG
Sbjct:   70 TFPISGWFALKIVPTYERMIVFRLGRIRN--PQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMAVKDLNTATRMTAHNAMTKALLRRPLQEIQMEKLKIGDQLLLEINDVTRAWG 209          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q27433|MEC2_CAEEL (Mechanosensory protein 2 OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 4.356e-107
Identity = 184/261 (70.50%), Postives = 221/261 (84.67%), Query Frame = 3
Query:  462 EISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            E + +  +   C   L ++SY L+  T PIS   CIKVV EYERAVIFRLGR++ GGAKGPG+FFI+PCID  RKVDLR ++F+VPPQE+L+KDSVTVAVDAVVY+RI N  +SVTNVE+A RST+LLA TTLRN+LGTK LAE+LS+R++IS  MQ  LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVI A GEQK+++ALKEAA+VI++SP ALQLRYLQTLN+ISAEKNSTIIFP P++L+ +F
Sbjct:  106 EKANIQNEFGVCGWILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREAISHQMQTTLDEATEPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIVAEGEQKASRALKEAAEVIAESPSALQLRYLQTLNSISAEKNSTIIFPFPIDLLSAF 366          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q16TM5|BND7A_AEDAE (Band 7 protein AAEL010189 OS=Aedes aegypti OX=7159 GN=AAEL010189 PE=3 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.732e-106
Identity = 184/268 (68.66%), Postives = 217/268 (80.97%), Query Frame = 3
Query:  477 DKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK*ADYFSKH 1280
            + + S C   LI +S+ LV LT P SL+ C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++++  F   K   Y + H
Sbjct:   28 NGEASTCGRILIFLSWVLVVLTMPFSLLVCFKVVQEYERAVIFRLGRLVQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSK-ESYEASH 294          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7PPU9|BND7A_ANOGA (Band 7 protein AGAP004871 OS=Anopheles gambiae OX=7165 GN=AGAP004871 PE=3 SV=3)

HSP 1 Score: 320.087 bits (819), Expect = 3.145e-106
Identity = 182/262 (69.47%), Postives = 215/262 (82.06%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            + + + S C   LI +S+ LV LT P SL+ C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++++  F   K
Sbjct:   12 ETNGEASTCGRILIFLSWVLVVLTMPFSLLVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDAYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGSMQLSLDEATEAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDILTYFMKSK 273          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q19958|STO2_CAEEL (Stomatin-2 OS=Caenorhabditis elegans OX=6239 GN=sto-2 PE=3 SV=4)

HSP 1 Score: 320.472 bits (820), Expect = 5.511e-105
Identity = 176/256 (68.75%), Postives = 219/256 (85.55%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMK 1238
              D    FC   L+ +S+ +V  TFP+S+  C+KVV EYERAVIFRLGR++ GGAKGPG+FF+LPCI+   KVDLRTV+F VPPQE+LTKDSVT +VDAV+YYRI N  VSV NVENA  STRLLA TTLRN+LGT++L+EILS+R+++++ MQ +LDEAT  WG+KVERVE+KDVRLP+QLQRAMAAEAEA RE++AKVIAA GEQK+++AL++AA VI+QSP ALQLRYLQTLN+++AEKNSTIIFPLPMEL++
Sbjct:  116 HYDTGLGFCGWFLMGLSWIMVISTFPVSIYFCMKVVQEYERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRTVSFSVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEILSDRETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQKASRALRDAASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELVR 371          
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZA4|BND7A_DROME (Band 7 protein CG42540 OS=Drosophila melanogaster OX=7227 GN=CG42540 PE=2 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 2.700e-102
Identity = 181/258 (70.16%), Postives = 212/258 (82.17%), Query Frame = 3
Query:  471 QMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            ++  + S C   LI +S  LV +T P SL  C KVV EYERAVIFRLGR++ GGAKGPG+FFILPCID   +VDLRT T+DVPPQEVLTKDSVTV+VDAVVYYR+ N  VS+ NVENA  STRLLA TTLRN +GT++L EILSER +IS  MQ  LDEAT  WG+KVERVE+KDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++AL+EA++VI  SP ALQLRYLQTLN ISAEKNSTI+FPLP++L+  F
Sbjct:  166 EISDKASTCGKLLIFLSVALVIMTLPFSLFVCFKVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQLDEATDAWGIKVERVEIKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALREASEVIGDSPAALQLRYLQTLNTISAEKNSTIVFPLPIDLITYF 423          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A267DLP1 (PHB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015086g3 PE=4 SV=1)

HSP 1 Score: 383.645 bits (984), Expect = 1.460e-128
Identity = 220/285 (77.19%), Postives = 254/285 (89.12%), Query Frame = 3
Query:  402 QVRKYSVVDPEKCSINMDASEISQMDKQ-TSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            ++RKYSVVDP+   I++ +    Q D Q   FC   LI++SY L+ +T P+SL  CIKVVAEYERAVIFRLGRIL GGAKGPGLFFI+PC+D IRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP+++VTNVE+ADRSTRLLAATTLRNVLGTKNL+EILSER+SIS+MMQA+LD+AT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++ALKEAADVI++SP ALQLRYLQTLN ISAEKNSTIIFPLP+E++ +F  +
Sbjct:   11 RMRKYSVVDPQ---IDLLSQ---QRDSQGMGFCGGVLIILSYALIVVTLPLSLCLCIKVVAEYERAVIFRLGRILEGGAKGPGLFFIVPCMDIIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVIAVTNVEDADRSTRLLAATTLRNVLGTKNLSEILSERESISNMMQAMLDDATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASRALKEAADVINESPFALQLRYLQTLNTISAEKNSTIIFPLPLEILSNFMHR 289          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A4E0RZB1 (Putative prohibitins and stomatins of the pid superfamily protein OS=Fasciola hepatica OX=6192 GN=D915_001195 PE=4 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 5.673e-128
Identity = 241/389 (61.95%), Postives = 278/389 (71.47%), Query Frame = 3
Query:  219 DDECKIIPAITKPYSPQPRLP-PKADHGARSS----------KTLLT------------------------------------DNGGNKSTSCLTPSDTLNLKPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            +DEC + PAITK YS Q  LP P+A+ G R +           TL T                                    D   +  TS LT       K T I Q+RKYSVVDP       D+++ SQ   +   C   L++ SY +V LTFP+SL  CIKVVAEYERAVIFRLGRI+  GA+GPGLFFI PC+D IRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP+V++TNVE+ADRSTRLLAATTLRNVLGT+NLAEILSER+SIS+ MQA+LD+AT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GE+K++ ALK+AADVI  SP ALQLRYLQTLNAISAEKNSTIIFPLP++ + + 
Sbjct:    9 EDECFVYPAITKRYS-QVTLPTPEAEAGNRQNTPKTAIRPLRSTLKTRSQFDTEDCDKNPLQDRRTRVDHSDNPVKSVNPVGNDTDSSTETSYLTVEPKQMSKRTSIQQLRKYSVVDPNALKYLEDSTKQSQ---EFGVCSALLVMFSYLVVFLTFPLSLFVCIKVVAEYERAVIFRLGRIIPRGARGPGLFFIAPCVDTIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVVAITNVEDADRSTRLLAATTLRNVLGTRNLAEILSERESISTSMQAMLDDATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEATREARAKVIAAEGEEKASYALKQAADVIHSSPFALQLRYLQTLNAISAEKNSTIIFPLPIDTLANL 393          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A0X3NTF4 (PHB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR132415 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.116e-127
Identity = 222/304 (73.03%), Postives = 260/304 (85.53%), Query Frame = 3
Query:  348 TSCLTPSDTLNLKPTG--IHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            T  LT  +TL     G  + +VRKYSVV+P     +MDA +I+   K   +C   L+ +SY  + LTFPIS++ CIKV+AEYERAV+FRLGRIL GGA+GPGLFF +PC+D IRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP++++TNVE+ADRSTRLLAATTLRNVLGTKNL+EILSER+SISSMMQA+LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++ALKEAADVI++SP A+QLRYLQTL+ ISAEKNSTIIFPLP++L+  F  K
Sbjct:    2 TQKLTNPETLAAGSEGSLLPEVRKYSVVNPRT---SMDAHQIT-TSKGMGYCSYILLGLSYCAILLTFPISILFCIKVIAEYERAVLFRLGRILPGGARGPGLFFTVPCLDMIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVIAITNVEDADRSTRLLAATTLRNVLGTKNLSEILSERESISSMMQAMLDEATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASQALKEAADVINESPFAIQLRYLQTLSTISAEKNSTIIFPLPVDLLTHFMRK 301          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A3S9SDV4 (Mechanosensory protein 2 OS=Echinococcus granulosus OX=6210 GN=Mec-2 PE=2 SV=1)

HSP 1 Score: 384.415 bits (986), Expect = 1.799e-127
Identity = 212/283 (74.91%), Postives = 249/283 (87.99%), Query Frame = 3
Query:  408 RKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            RKYSVV+P    ++MD   IS+  K   +C   L+ +SYF++ LTFP+S+  CIKV+AEYERAV+FRLGRIL GGA+GPGLFF +PC+D IRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP+V++TNVE+ADRSTRLLAATTLRNVLGTKNL++ILSERDSIS MMQ +LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++ALKEAADV+++SP A+QLRYLQTL+ ISAEKNSTIIFP+P++L+  F   K
Sbjct:   28 RKYSVVNPR---MSMDGGSISK-SKDMGYCSYVLLALSYFVIMLTFPVSIFFCIKVIAEYERAVLFRLGRILPGGARGPGLFFTVPCLDMIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVVAITNVEDADRSTRLLAATTLRNVLGTKNLSDILSERDSISGMMQTMLDEATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEATREARAKVIAARGEQKASQALKEAADVLNESPFAMQLRYLQTLSTISAEKNSTIIFPMPVDLVTHFMQGK 306          
BLAST of PHB domain-containing protein vs. TrEMBL
Match: A0A564Y4K1 (PHB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3020 PE=4 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 5.426e-127
Identity = 213/287 (74.22%), Postives = 251/287 (87.46%), Query Frame = 3
Query:  396 IHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            + + RKYSVV+P     +MD  ++S+  K    C   L+ +SYF++ LTFPIS+  CI+V+AEYERAV+FRLGRIL GGAKGPGLFF +PC+D IRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP+V++TNVE+ADRSTRLLAATTLRNVLGTKNL++ILSERDSIS MMQ +LDEAT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK+++ALKEAADVI++SP A+QLRYLQTL+ ISAEKNSTIIFPLP++++  F  +K
Sbjct:   25 LAESRKYSVVNPRT---SMDGGQMSKT-KDIGCCSYILLGLSYFVILLTFPISIFFCIRVIAEYERAVLFRLGRILPGGAKGPGLFFTVPCLDMIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVVAITNVEDADRSTRLLAATTLRNVLGTKNLSDILSERDSISGMMQTMLDEATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIAARGEQKASQALKEAADVINESPFAIQLRYLQTLSTISAEKNSTIIFPLPVDMLTQFMHRK 307          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 304.294 bits (778), Expect = 6.801e-101
Identity = 180/264 (68.18%), Postives = 215/264 (81.44%), Query Frame = 3
Query:  453 DASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            D  E+   D     C   L+L S  L  LT P+S+  CIK+V EYERA+IFRLGRIL GGAKGPGLFFILPC D    VD+RT+TFD+PPQEVLTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLPM++M+SF
Sbjct:   24 DVEELISTDSDIGLCGWLLVLFSILLTLLTLPLSIWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 287          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 304.679 bits (779), Expect = 2.664e-100
Identity = 181/303 (59.74%), Postives = 224/303 (73.93%), Query Frame = 3
Query:  378 NLKPTGIHQVR-KYSVVDPEKCSINMD-------ASE---ISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            NL P    Q+     +   E C + M+       AS+   IS+  +    C   L+ +S     L FP+ +  CIK+V EYERAVIFRLGRI    AKGPG+FFILPC D   KVD+RT++FD+PPQE+LTKDSVTV+VD VVY+R+ +PI SV NV NAD STRLLA TTLRNVLGTKNLAE+LS+R+ IS  MQ+ LDEAT  WG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNST+IFP+PM+++  F  K
Sbjct:   41 NLSPHCFIQLHTNRGITSGEACYMEMESQIERGSASKQDLISENKRGLGCCGWILVALSTLFTVLLFPVMIFVCIKIVQEYERAVIFRLGRITARKAKGPGIFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQSTLDEATDSWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTVIFPVPMDILGHFLKK 343          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 302.753 bits (774), Expect = 2.921e-100
Identity = 168/227 (74.01%), Postives = 199/227 (87.67%), Query Frame = 3
Query:  564 CIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            CIK+V EYERA+IFRLGRIL GGAKGPGLFFILPC D    VD+RT+TFD+PPQEVLTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLPM++M+SF
Sbjct:   55 CIKIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 281          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stom (stomatin [Source:NCBI gene;Acc:103034070])

HSP 1 Score: 302.753 bits (774), Expect = 3.816e-100
Identity = 168/227 (74.01%), Postives = 199/227 (87.67%), Query Frame = 3
Query:  564 CIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            CIK+V EYERA+IFRLGRIL GGAKGPGLFFILPC D    VD+RT+TFD+PPQEVLTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLPM++M+SF
Sbjct:   63 CIKIVKEYERAIIFRLGRILRGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEVLTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSTLDEATDDWGIKVERVEIKDVKLPLQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDMMQSF 289          
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Match: stoml3a (stomatin (EPB72)-like 3a [Source:ZFIN;Acc:ZDB-GENE-070620-18])

HSP 1 Score: 300.056 bits (767), Expect = 4.619e-99
Identity = 168/238 (70.59%), Postives = 204/238 (85.71%), Query Frame = 3
Query:  543 FPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
             PI++  CIK+V EYERAVIFRLGRIL    KGPG+FF+LPC D + KVDLR  +FD+PPQE+LTKDSVTV VD VVY+R+ +PI+SV NV NAD STRLLA TTLRNVLGTK+LAE+LS+R+SIS  MQ  LDEATHPWG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I++EKNSTIIFPLPM++++ F ++K
Sbjct:   57 LPITIFMCIKIVQEYERAVIFRLGRILDRKPKGPGMFFLLPCTDTMTKVDLRAKSFDIPPQEILTKDSVTVCVDGVVYFRVSDPIMSVANVVNADMSTRLLAQTTLRNVLGTKSLAEVLSDRESISHNMQISLDEATHPWGIKVERVEIKDVKLPQQLQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVIAESPSALQLRYLQTLNTIASEKNSTIIFPLPMDMLQPFLTRK 294          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008297.1 (pep scaffold:Pmarinus_7.0:GL485275:4696:10707:1 gene:ENSPMAG00000007488.1 transcript:ENSPMAT00000008297.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 306.605 bits (784), Expect = 1.909e-102
Identity = 168/252 (66.67%), Postives = 209/252 (82.94%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSS 1250
            C   LI +SYFL+ +TFPIS+  C K+V EYERAVIF LGRI  GGAKGPGLF+I+PC D   KVD+RTV FD+PPQE+LTKDSVTV+VD VVYYR+ N I+SV N+ NA+ +T+LLA TTLRNVLGTKNLAEILS+R+ I+  MQ  LDEAT  WG+K+ERV++KDV+LP QLQRAMAAEAEA RE++AKVI+A GE  +++ALKEAA V+ ++P A+QLRYLQTLN I+AE+NSTIIFPLPM+L++   +
Sbjct:   30 CGYLLIGLSYFLILITFPISIWMCFKIVQEYERAVIFTLGRIKPGGAKGPGLFWIVPCTDNFVKVDMRTVNFDIPPQEILTKDSVTVSVDGVVYYRVQNAILSVANITNANSATQLLAQTTLRNVLGTKNLAEILSDREEIAHTMQLTLDEATDNWGIKLERVDIKDVKLPQQLQRAMAAEAEATREARAKVISAEGEMNASRALKEAAQVMGEAPAAMQLRYLQTLNTIAAERNSTIIFPLPMDLLQGMGA 281          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006522.1 (pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 gene:ENSPMAG00000005879.1 transcript:ENSPMAT00000006522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 286.96 bits (733), Expect = 6.392e-95
Identity = 162/253 (64.03%), Postives = 209/253 (82.61%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            C   L ++S  +V LTFP+S+  C+KVV EYERAV+FRLG++L GGA GPGLF +LPCID   KVD+RTVTFDVPPQE+LT+DSVTVAVDAVVYYR+++   +VTNV  AD +TRLLA T LRNVLGT++L++I+SER+ I+  MQ  LDEAT PWG+KV+RVE+KDVRLP Q+QRAMAAEAEA RE++AKV++A GE  ++++LKEAA V+ +S  ALQLRYLQTLN I+AE+NSTIIFP+P++++ +  S 
Sbjct:   21 CEKLLGILSMVVVVLTFPLSVWFCLKVVREYERAVVFRLGKLLPGGAIGPGLFLVLPCIDTFVKVDMRTVTFDVPPQEILTRDSVTVAVDAVVYYRVHDATAAVTNVVFADGATRLLAQTALRNVLGTRSLSDIVSEREVIARSMQTSLDEATEPWGIKVQRVEIKDVRLPSQMQRAMAAEAEAIREARAKVVSAEGEMNASRSLKEAAIVLGESSGALQLRYLQTLNNIAAERNSTIIFPIPIDILSALRSN 273          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: NPHS2 (NPHS2 stomatin family member, podocin [Source:HGNC Symbol;Acc:HGNC:13394])

HSP 1 Score: 140.584 bits (353), Expect = 3.269e-39
Identity = 95/223 (42.60%), Postives = 143/223 (64.13%), Query Frame = 3
Query:  525 FLVALTFPISLIGC---IKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAI 1184
            F + L+ P  +  C   ++VV EYERAVIFRLGR+L+  A GPGLFFILPC+D  +KVDLR  T +VP  EV+T DS++V V    +YR+    +   +V     +  L+    +R ++  K+L+ IL  R  ++   +  LD     WG+KVER E+ DVR+P++LQ+++  EA+A+R ++A++IAA  E+++A  L  AA V++  P AL LRYL TL+A+
Sbjct:   11 FHLRLSLPCLVYSCCAGLQVVYEYERAVIFRLGRLLSVRANGPGLFFILPCLDTYQKVDLRMRTLEVPLHEVITSDSLSVRVSVACHYRVERASIWAVSVAQPLEALGLVLQAKVRALVAKKDLSYILQHRPELAQHTKECLDAVVGSWGIKVERAEINDVRIPLELQKSVCVEADANRAARARLIAAQAEKQTALELSGAARVLAAVPGALSLRYLHTLDAL 233          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: stoml1 (stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-070209-241])

HSP 1 Score: 122.865 bits (307), Expect = 3.828e-31
Identity = 58/158 (36.71%), Postives = 98/158 (62.03%), Query Frame = 3
Query:  492 FCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWG 965
            FC + +  +++  + LTFP+S+  C+K+V ++ER V+FRLGR+      GPG+  +LPCID+ R+VD R   F+VPP   +T+D   V+V A V  R++ P++ +T  ++ +RS+R  A T L ++L   +L E+ SE   ++  +   + + T PWG
Sbjct:   49 FCSLVITSLTFVFMVLTFPLSVWFCLKIVPQHERIVVFRLGRLRA--PLGPGVALVLPCIDRWRRVDTRPRAFNVPPCRAMTRDGALVSVGADVRVRVHCPVLLLTAAQDVNRSSRSAAHTALASLLPRHSLHELQSESAKMADELALEVTKVTEPWG 204          
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Match: stoml2 (stomatin (EPB72)-like 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1139])

HSP 1 Score: 81.6481 bits (200), Expect = 1.819e-17
Identity = 60/176 (34.09%), Postives = 104/176 (59.09%), Query Frame = 3
Query:  576 VAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVD-LRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXX-XXDRESKAKVIAALGEQKS 1097
            V E E  +I R+GR        PGL  ++P ID+I+ V  L+ +  D+P Q  +T D+VT+ +D V+Y RI +P  +   VE+ + +   LA TT+R+ LG   L  +  ER+S+++ +  +++ A   WG++  R E+KD+ LP +++ AM  +  EA+R  +A V+ + G ++S
Sbjct:   50 VPEQEAWIIERMGRFHR--VLRPGLNLLIPIIDRIKYVQSLKEIVIDIPEQSAITLDNVTLQLDGVLYLRIMDPFKASYGVEDPEYAVTQLAQTTMRSELGKIALDSVFKERESLNANIVEVINGAAEVWGIRCLRYEIKDMELPTRVKEAMQMQQVEAERRKRAVVLESEGIRES 223          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ15])

HSP 1 Score: 321.242 bits (822), Expect = 4.266e-108
Identity = 181/253 (71.54%), Postives = 212/253 (83.79%), Query Frame = 3
Query:  477 DKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELM 1235
            D +  F    L  VS  +  +TFPI++  C+K+V EYERAVIFRLGR+L GGAKGPGLFFILPCID  +KVDLR V+FDVPPQE+LTKDSVTVAVDAVVY+RI N  +S+TNVENA+ STRLLA TTLRN LGTKNL EILS+RD IS  MQ+ LDEAT PWGVKVER+EVKDVRLP QLQRAMAAEAEA RE++AK+IAA GE  ++++LKEA+D+IS+SP ALQLRYLQTL  ISAEKNSTIIFPLP++ +
Sbjct:   23 DHERGFFYFFLTGVSILIFIITFPIAIFMCLKIVQEYERAVIFRLGRLLKGGAKGPGLFFILPCIDSYQKVDLRVVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVENANASTRLLAQTTLRNTLGTKNLTEILSQRDEISQTMQSSLDEATDPWGVKVERIEVKDVRLPQQLQRAMAAEAEATREARAKIIAAEGEMNASRSLKEASDIISESPQALQLRYLQTLTTISAEKNSTIIFPLPIDFL 275          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO31853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWR9])

HSP 1 Score: 318.931 bits (816), Expect = 1.685e-107
Identity = 179/244 (73.36%), Postives = 208/244 (85.25%), Query Frame = 3
Query:  513 LVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            +  Y  V  TFP SL  C+KVV+EYERAVIFR+GRIL+GGA+GPG+FF+LPCID+ RKVD+RTV+FDVPPQEVLTKDSVTV VDAVVY+R+ N  VS+TNVENA  ST+LLA TTLRN++G+K L EILSERD+IS+ M+ +LDEAT PWGV+VERVE+KDVRLPVQLQRAMAAEAEA RE+KAK I A GE KS+ ALK AA+V+  SP ALQLRYLQTLN ISAEKNSTIIFPLPM L+  F
Sbjct:   10 ICCYIGVICTFPFSLFFCLKVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVENAFGSTKLLAQTTLRNMMGSKLLCEILSERDNISATMKGMLDEATGPWGVRVERVEMKDVRLPVQLQRAMAAEAEAHREAKAKFIVAEGEMKSSHALKNAAEVLDGSPSALQLRYLQTLNTISAEKNSTIIFPLPMNLLNRF 253          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ14])

HSP 1 Score: 285.034 bits (728), Expect = 4.069e-94
Identity = 149/250 (59.60%), Postives = 182/250 (72.80%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            C   +  +S  L  LTFPI++  CIK+V EYERAVIFRLGR+L GGAKGPG+FFILPCID  +KVDLRTV+FDVPPQE+LTKDSVTVAVDAVVY+RI N  +S+TNVENA+RSTRLLA TTLRN+LGTK+L+EILSERD+IS  M+      T    +    + +  +   V     +             VIAA GE  +++ALKEA+D+IS+SP ALQLRYLQTL  ISAEKNSTIIFPLP++ +  F
Sbjct:    3 CDYIITGLSILLFVLTFPIAVFFCIKIVQEYERAVIFRLGRLLEGGAKGPGMFFILPCIDSYQKVDLRTVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVENANRSTRLLAQTTLRNILGTKSLSEILSERDNISHTMELTTPRLTP-LTLPPLVLPLLTLPHLVLPLLILPHLVLPLLTLPHLVIAAEGEMNASRALKEASDIISESPQALQLRYLQTLTTISAEKNSTIIFPLPIDFIAKF 251          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO28629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Y2])

HSP 1 Score: 259.61 bits (662), Expect = 2.164e-84
Identity = 159/246 (64.63%), Postives = 185/246 (75.20%), Query Frame = 3
Query:  507 LILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            + +  Y  V  TFP SL  C+KVV+EYERAVIFR+GRIL+GGA+GPG+FF+LPCID+ RKVD+RTV+FDVPPQEVLTKDSVTV VDAVVY+R+ N  VS+TNVENA  S    A    R       L      +    S ++ L  +AT PWGV+VERVE+KDVRLPVQLQRAMAAEAEA RE+KAK I A GE KS+ ALK AA+V+  SP ALQLRYLQTLN ISAEKNSTIIFPLPM L+  F
Sbjct:    8 ITICCYIGVICTFPFSLFFCLKVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVENAFDSVTPSAQAFARQHPRAYWLPAFFHPQGK-QSYLKNLCPQATGPWGVRVERVEMKDVRLPVQLQRAMAAEAEAHREAKAKFIVAEGEMKSSHALKNAAEVLDGSPSALQLRYLQTLNTISAEKNSTIIFPLPMNLLNRF 252          
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Match: EDO43324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ13])

HSP 1 Score: 218.009 bits (554), Expect = 8.886e-69
Identity = 133/252 (52.78%), Postives = 170/252 (67.46%), Query Frame = 3
Query:  489 SFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
              C + L ++S  ++ LTFP+S+  C+K+V EYERAVIFRLGR+L GGAKGPG+   +P +D                                                NA+ STRLLA TTLRN+LGTKNL EILS+RD IS  MQ+ LDEAT PWGVKVER+EVKDVRLP Q+QRAMAAEAEA R+++AK+IAA GE  ++++LK+A+D++S+SP A+QLRYLQTL  ISAEKNSTIIFPLP++++  F
Sbjct:    4 GICDVVLTVISVIVIVLTFPLSVWFCLKIVQEYERAVIFRLGRLLQGGAKGPGM---IPRLD-----------------------------------------------PNANGSTRLLAQTTLRNILGTKNLTEILSQRDEISQTMQSTLDEATDPWGVKVERIEVKDVRLPQQMQRAMAAEAEASRDARAKIIAAEGEMNASRSLKDASDILSESPQAIQLRYLQTLTTISAEKNSTIIFPLPIDMLSHF 205          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: STOML3 (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101171931])

HSP 1 Score: 300.442 bits (768), Expect = 2.464e-99
Identity = 176/279 (63.08%), Postives = 219/279 (78.49%), Query Frame = 3
Query:  420 VVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            +V  EK   N D  E     +   F  + +I    F+VA TFP++   C+K+V EYERAVIFRLGRI+    KGPGLFF+LPC D   KVDLRTV+FD+PPQE+LTKDSVTV+VD VVY+RI+ PI SV NV NA  STRLLA TTLRNVLGTKNL+E+LS+R+ IS  MQ  LD+AT PWG+KVERVE+KDV LP QLQRAMAAEAEA RE++AK+IAA GE K+++ALKEA+ V++++P ALQLRYLQTL+ I+AEKNSTIIFPLP+++++SF  +K
Sbjct:   11 MVRQEKLDRNADIIEDKNSGQLGCFGWLLVIFSLIFVVA-TFPLTGFMCVKIVKEYERAVIFRLGRIVDRKPKGPGLFFVLPCTDNFVKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRIHCPISSVANVSNAHSSTRLLAQTTLRNVLGTKNLSELLSDREGISLSMQESLDDATEPWGIKVERVEIKDVTLPQQLQRAMAAEAEASREARAKIIAAEGEMKASRALKEASLVMAEAPSALQLRYLQTLSTIAAEKNSTIIFPLPIDMLQSFMQRK 288          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101173000])

HSP 1 Score: 297.745 bits (761), Expect = 1.284e-98
Identity = 170/249 (68.27%), Postives = 206/249 (82.73%), Query Frame = 3
Query:  507 LILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            ++++S   V L FP+++  C K V EYERAVIFRLGRI     KGPG+FFILPC D + KVDLRTV+FD+PPQE+LTKDSVTV+VD VVY+R+ +PI SV NV NAD STRLLA TTLRNVLGTKNLAE+LS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLPM+++  F  K
Sbjct:   22 IVILSGLFVFLLFPVTIWFCFKTVQEYERAVIFRLGRITDRKPKGPGIFFILPCTDSLVKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADFSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPFQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPMDVISHFMRK 270          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stom (stomatin [Source:NCBI gene;Acc:101167971])

HSP 1 Score: 298.13 bits (762), Expect = 1.802e-98
Identity = 165/231 (71.43%), Postives = 200/231 (86.58%), Query Frame = 3
Query:  552 SLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            S+  CIK+V EYERA+IFRLGRI+ GGAKGPGLFFILPC D    VD+RT+TFD+PPQE+LTKDSVTV+VD VVYYR+ N  ++V N+ NAD +TRLLA TTLRNVLGTKNLAEILS+R+ I+  MQ+ LD+AT  WG+KVERVE+KDV+LP+QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTLN I+AEKNSTIIFPLP+E+M+ F
Sbjct:   51 SVWMCIKIVKEYERAIIFRLGRIVKGGAKGPGLFFILPCTDSFINVDMRTITFDIPPQEILTKDSVTVSVDGVVYYRVQNATLAVANITNADAATRLLAQTTLRNVLGTKNLAEILSDREEIAHSMQSSLDDATDAWGIKVERVEIKDVKLPLQLQRAMAAEAEATREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLNTIAAEKNSTIIFPLPLEMMQGF 281          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 295.819 bits (756), Expect = 9.267e-98
Identity = 167/249 (67.07%), Postives = 208/249 (83.53%), Query Frame = 3
Query:  507 LILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSK 1253
            ++++S F   L FPI++  C+K+V EYERAVIFRLGRI+    KGPG+FFILPC D + KVDLR ++FD+PPQE+LTKDSVTV+VD VVY+R+ +PI SV NV NA+ STRLLA TTLRNVLGTKNLAE+LS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTL+ I+AEKNSTIIFPLPM+++  F  K
Sbjct:   26 IVILSGFFTVLLFPITICYCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPHQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLSTIAAEKNSTIIFPLPMDVISHFMRK 274          
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 268.855 bits (686), Expect = 2.933e-87
Identity = 154/230 (66.96%), Postives = 193/230 (83.91%), Query Frame = 3
Query:  507 LILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEK 1196
            ++++S F   L FPI++  C+K+V EYERAVIFRLGRI+    KGPG+FFILPC D + KVDLR ++FD+PPQE+LTKDSVTV+VD VVY+R+ +PI SV NV NA+ STRLLA TTLRNVLGTKNLAE+LS+R+ I+  MQ+ LDEAT  WG+KVERVE+KDV+LP QLQRAMAAEAEA RE++AKVIAA GE  +++ALKEA+ VI++SP ALQLRYLQTL+ I+AE+
Sbjct:   35 IVILSGFFTVLLFPITICYCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQSNLDEATDNWGIKVERVEIKDVKLPHQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASLVIAESPSALQLRYLQTLSTIAAER 264          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000009300.1 (SMESG000009300.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 317/345 (91.88%), Postives = 334/345 (96.81%), Query Frame = 3
Query:  213 MDDDECKIIPAITKPYSPQPRLPPKADHGARSSKTLLTDNGGNKSTSCLTPSDTLNLKPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFS 1247
            MDDDECKIIPAITKPYSPQPRLPPKADHGARSSKTLLTDNGGNKSTSCLTPSDTLNLKPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNP+VSV NVE+ DRSTRLLAATTLRNVLGTKNL+EILSERDSISSMMQ++LD+AT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQKSA+ALKEAAD I++SPMALQLRYLQTL+ ISAE NSTIIFP P++ + +F+
Sbjct:    1 MDDDECKIIPAITKPYSPQPRLPPKADHGARSSKTLLTDNGGNKSTSCLTPSDTLNLKPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPVVSVINVEDCDRSTRLLAATTLRNVLGTKNLSEILSERDSISSMMQSMLDDATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEATREARAKVIAAEGEQKSARALKEAADTINRSPMALQLRYLQTLSTISAEHNSTIIFPFPIDFVSAFN 345          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000068910.1 (SMESG000068910.1)

HSP 1 Score: 371.318 bits (952), Expect = 2.335e-127
Identity = 213/290 (73.45%), Postives = 248/290 (85.52%), Query Frame = 3
Query:  396 IHQ--VRKYSVVDP-EKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK 1256
            IH    RKYSVV+P E   +++ +   + +D     C   LI +SY  + LT P+SL  CIKVVAEYERAVIFRLGRIL+ GAKGPGLFF++PC+D IRK+DLRTVTFDVPPQEVLT+DSVTVAVDAVVYYRI+NP+V+VTNVE+ADRSTRLLAATTLRNVLGTKNLAEILSER+SIS+MMQ +LD+AT PWGVKVERVEVKDVRLPVQLQRAMAAEAEA RE++AKVIAA GEQK++ AL+EAADVI++S  ALQLRYLQTLN ISAEKNSTIIFPLPM+++  F S +
Sbjct:    2 IHHEATRKYSVVNPKEPIQLSIRSKGTTSLD----VCEFILIGLSYISIVLTLPVSLFLCIKVVAEYERAVIFRLGRILSEGAKGPGLFFVVPCMDVIRKIDLRTVTFDVPPQEVLTRDSVTVAVDAVVYYRIHNPVVAVTNVEDADRSTRLLAATTLRNVLGTKNLAEILSERESISTMMQNMLDDATDPWGVKVERVEVKDVRLPVQLQRAMAAEAEAAREARAKVIAAEGEQKASHALREAADVINKSKFALQLRYLQTLNTISAEKNSTIIFPLPMDMLSYFMSSE 287          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000028915.1 (SMESG000028915.1)

HSP 1 Score: 348.977 bits (894), Expect = 1.056e-117
Identity = 202/328 (61.59%), Postives = 252/328 (76.83%), Query Frame = 3
Query:  297 GARSSKTL----LTDNGGN--KSTSCLTPSDTLNL------KPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            G RS+  L     T   G+  K++S +T  +T+N       +P  +   RKYSV+DPE  +   D  E   M K    C   L+ + Y L+  T P+SLI CIK+++EYERAVIFR GR+   G KGPG+ F+LPC++ +++VDLRT+TF+VPPQEVLTKDSVTVAVDAVVYYRIYNPIVS+ NVE+ D STRLLAATTLRNVLGTKNL+EILSER+ IS +MQ +LD+ATHPWGVKVERVE+KDVRLP+QLQRAMAAEAEA RE+ AKVIAA GEQKS+ ALK A+++I QSP ALQLRYLQTL+A+S+E++STIIFP P+EL+  +
Sbjct:   12 GNRSNNALNLMKFTSRSGSIIKTSSFVTYPETINFSNELMNEPPTLISSRKYSVMDPECTASTFDEYE---MSKSWQICSSMLVFLIYVLLFFTMPLSLIFCIKIISEYERAVIFRFGRVPKYGTKGPGIIFVLPCLETVKRVDLRTLTFNVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSIINVEDCDFSTRLLAATTLRNVLGTKNLSEILSERELISGLMQVMLDDATHPWGVKVERVEIKDVRLPLQLQRAMAAEAEATREANAKVIAAEGEQKSSIALKAASEIICQSPTALQLRYLQTLSALSSEQSSTIIFPFPIELLYKY 336          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000063036.1 (SMESG000063036.1)

HSP 1 Score: 302.368 bits (773), Expect = 1.615e-100
Identity = 182/250 (72.80%), Postives = 215/250 (86.00%), Query Frame = 3
Query:  495 CRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSF 1244
            C   +I +SY +  +T P SLI  +K VAEYER VIFRLGRI  G A GPGLF ILPC+D + K+DLRTVTF+VPPQEVLTKDSV+V+VDAVVYYRI+NPIVSV NVE+ADRSTRLLAATTL+NVLGTK L E+LSER+SIS MMQ +LDEATHPWGVKVERVEVKDVRLP+QLQR MAA+AEA+RE++AKVIAA GE+ ++  LK AADV++  P+ALQLRYLQ L+AISAEKNSTIIFP+P++LM +F
Sbjct:   20 CSYLMIALSYLVFVITLPFSLIFSVKAVAEYERVVIFRLGRIKYGEALGPGLFCILPCLDTLTKIDLRTVTFEVPPQEVLTKDSVSVSVDAVVYYRIHNPIVSVINVEDADRSTRLLAATTLQNVLGTKKLTEVLSERESISFMMQNMLDEATHPWGVKVERVEVKDVRLPLQLQRVMAAQAEAEREARAKVIAAEGERNASIPLKMAADVMNDYPVALQLRYLQILSAISAEKNSTIIFPIPIDLMSAF 269          
BLAST of PHB domain-containing protein vs. Planmine SMEST
Match: SMESG000059569.1 (SMESG000059569.1)

HSP 1 Score: 298.13 bits (762), Expect = 1.161e-97
Identity = 176/263 (66.92%), Postives = 213/263 (80.99%), Query Frame = 3
Query:  489 SFCRIALILVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFILPCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTNVENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPWGXXXXXXXXXXXXLPVQLQRXXXXXXXXDRESKAKVIAALGEQKSAKALKEAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK*ADYFSK 1277
            S C  A+  +SY   A+TFP SL  C+KVVA+YERAVIFRLGR+++   KGPGL F+LPC+D ++ VDLRT TF+VP QEVLTKDSVTVAVDAVVYYRI+NPI+SV NVE+A+RSTRLLA TTLRNVLGT +L ++L+ER+ I+S MQ  LD AT  WGVKVERV++KDVRLP+QLQRAMAAEAEA RE+KAKVIAA GE++++ ALK AA  IS  P+ALQLRYLQTL +IS EKNSTIIFP+P++ +  FS    AD   K
Sbjct:   95 SGCESAIQAMSYLTAAITFPFSLFACLKVVAQYERAVIFRLGRLISKQPKGPGLVFVLPCLDSMKLVDLRTFTFNVPTQEVLTKDSVTVAVDAVVYYRIFNPIMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYQLLAEREQIASNMQGCLDTATETWGVKVERVDIKDVRLPIQLQRAMAAEAEAAREAKAKVIAAEGEKRASVALKAAAIQISDCPIALQLRYLQTLRSISDEKNSTIIFPIPIDFLNLFSDSN-ADNMEK 356          
The following BLAST results are available for this feature:
BLAST of PHB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STOM2.559e-10165.35stomatin [Source:HGNC Symbol;Acc:HGNC:3383][more]
STOML31.042e-8858.14stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420... [more]
STOML32.223e-8858.14stomatin like 3 [Source:HGNC Symbol;Acc:HGNC:19420... [more]
NPHS21.019e-6246.43NPHS2 stomatin family member, podocin [Source:HGNC... [more]
STOM1.557e-6165.22stomatin [Source:HGNC Symbol;Acc:HGNC:3383][more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-21.054e-10970.50Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-24.810e-10965.61Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-21.224e-10870.66Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-22.260e-10870.66Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-23.424e-10870.50Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425401.865e-10470.16gene:FBgn0260657 transcript:FBtr0301096[more]
CG425403.047e-10470.16gene:FBgn0260657 transcript:FBtr0333583[more]
CG425403.215e-10470.16gene:FBgn0260657 transcript:FBtr0344807[more]
CG425403.342e-10470.16gene:FBgn0260657 transcript:FBtr0333584[more]
CG425403.689e-10470.16gene:FBgn0260657 transcript:FBtr0301097[more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1124082.787e-10564.18zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
zgc:1124083.397e-10564.18zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
stoml3b8.182e-10366.92stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
stom4.458e-10264.54stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486][more]
stom4.458e-10264.54stomatin [Source:ZFIN;Acc:ZDB-GENE-980526-486][more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo10.23.381e-10563.57myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.21.769e-10465.78myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.21.436e-10367.59myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
atp8b36.945e-9559.85ATPase, aminophospholipid transporter, class I, ty... [more]
ENSXETT00000046764.18.623e-7862.20pep primary_assembly:Xenopus_tropicalis_v9.1:2:223... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stom2.380e-10267.34stomatin [Source:MGI Symbol;Acc:MGI:95403][more]
Stoml36.770e-8560.92stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MG... [more]
Nphs26.427e-6747.62nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Nphs21.434e-5538.10nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Stoml13.566e-2638.73stomatin-like 1 [Source:MGI Symbol;Acc:MGI:1916356... [more]
back to top
BLAST of PHB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27433|MEC2_CAEEL4.356e-10770.50Mechanosensory protein 2 OS=Caenorhabditis elegans... [more]
sp|Q16TM5|BND7A_AEDAE1.732e-10668.66Band 7 protein AAEL010189 OS=Aedes aegypti OX=7159... [more]
sp|Q7PPU9|BND7A_ANOGA3.145e-10669.47Band 7 protein AGAP004871 OS=Anopheles gambiae OX=... [more]
sp|Q19958|STO2_CAEEL5.511e-10568.75Stomatin-2 OS=Caenorhabditis elegans OX=6239 GN=st... [more]
sp|Q9VZA4|BND7A_DROME2.700e-10270.16Band 7 protein CG42540 OS=Drosophila melanogaster ... [more]
back to top
BLAST of PHB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DLP11.460e-12877.19PHB domain-containing protein OS=Macrostomum ligna... [more]
A0A4E0RZB15.673e-12861.95Putative prohibitins and stomatins of the pid supe... [more]
A0A0X3NTF41.116e-12773.03PHB domain-containing protein OS=Schistocephalus s... [more]
A0A3S9SDV41.799e-12774.91Mechanosensory protein 2 OS=Echinococcus granulosu... [more]
A0A564Y4K15.426e-12774.22PHB domain-containing protein OS=Hymenolepis dimin... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stom6.801e-10168.18stomatin [Source:NCBI gene;Acc:103034070][more]
stoml3b2.664e-10059.74stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
stom2.921e-10074.01stomatin [Source:NCBI gene;Acc:103034070][more]
stom3.816e-10074.01stomatin [Source:NCBI gene;Acc:103034070][more]
stoml3a4.619e-9970.59stomatin (EPB72)-like 3a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008297.11.909e-10266.67pep scaffold:Pmarinus_7.0:GL485275:4696:10707:1 ge... [more]
ENSPMAT00000006522.16.392e-9564.03pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 ... [more]
NPHS23.269e-3942.60NPHS2 stomatin family member, podocin [Source:HGNC... [more]
stoml13.828e-3136.71stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
stoml21.819e-1734.09stomatin (EPB72)-like 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PHB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433264.266e-10871.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318531.685e-10773.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433254.069e-9459.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286292.164e-8464.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433248.886e-6952.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PHB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STOML32.464e-9963.08erythrocyte band 7 integral membrane protein-like ... [more]
stoml3b1.284e-9868.27erythrocyte band 7 integral membrane protein-like ... [more]
stom1.802e-9871.43stomatin [Source:NCBI gene;Acc:101167971][more]
stoml3b9.267e-9867.07erythrocyte band 7 integral membrane protein [Sour... [more]
stoml3b2.933e-8766.96erythrocyte band 7 integral membrane protein [Sour... [more]
back to top
BLAST of PHB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009300.10.000e+091.88SMESG000009300.1[more]
SMESG000068910.12.335e-12773.45SMESG000068910.1[more]
SMESG000028915.11.056e-11761.59SMESG000028915.1[more]
SMESG000063036.11.615e-10072.80SMESG000063036.1[more]
SMESG000059569.11.161e-9766.92SMESG000059569.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006221 ID=SMED30006221|Name=PHB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1404bp
GCTGACCAATAGAAATCATTTGAGTAAAAGTTTATGATAAGCAACTGTAA
TATTTCTTTCCCAATTTTAATATAGTAAATTTATTAGTAGAGAAAAAATA
AAAATTCTTTTATAACATTGATTTCTCTATTGTGATTCCATTCTTGGTTC
TGTTGTCGTTGTTGTGATTATTTCTCTGTTCTCTATCGCCTAATTGATAT
TACTTATAAATTATGGACGACGATGAGTGCAAAATTATTCCTGCCATTAC
CAAGCCATATTCACCTCAACCTCGCTTGCCTCCAAAGGCAGATCATGGAG
CTAGATCATCGAAAACTCTTCTAACCGATAACGGTGGAAATAAATCGACA
TCGTGTCTCACCCCGTCGGATACTTTGAATTTAAAACCAACTGGTATTCA
TCAGGTTCGAAAATATTCTGTTGTAGATCCAGAAAAATGTAGCATCAACA
TGGACGCGTCAGAAATATCCCAAATGGACAAACAAACAAGTTTTTGCCGC
ATAGCCTTAATATTAGTATCATATTTTCTGGTGGCACTAACGTTTCCTAT
CTCTCTGATTGGATGTATAAAAGTCGTAGCGGAATATGAAAGAGCGGTCA
TTTTTCGATTGGGTAGAATTCTAACTGGCGGTGCCAAGGGACCTGGATTA
TTTTTCATTCTTCCATGTATTGATCAAATTCGAAAGGTAGATTTACGAAC
GGTCACATTTGATGTTCCTCCACAAGAAGTTTTGACAAAAGATTCAGTTA
CAGTTGCTGTGGATGCTGTAGTTTATTACAGAATATATAATCCAATTGTA
TCAGTAACTAATGTTGAAAATGCAGACAGGTCTACCCGACTTTTAGCAGC
TACAACCCTGAGAAATGTCTTAGGAACTAAAAATCTTGCTGAAATATTAT
CAGAAAGAGATTCAATATCCAGTATGATGCAGGCATTGCTAGATGAAGCA
ACCCATCCCTGGGGTGTTAAAGTAGAAAGAGTTGAAGTGAAAGATGTTCG
CCTTCCTGTGCAATTACAGCGAGCTATGGCGGCGGAAGCCGAAGCTGACC
GTGAATCAAAAGCAAAAGTAATTGCTGCACTTGGAGAGCAAAAATCAGCA
AAAGCTTTGAAAGAGGCCGCAGACGTAATCTCCCAATCGCCTATGGCTCT
GCAGTTGCGCTACTTACAGACATTGAATGCTATCAGCGCAGAAAAGAATT
CCACGATTATTTTTCCTCTTCCAATGGAATTGATGAAAAGTTTTAGTTCT
AAAAAATAGGCAGACTATTTTTCAAAGCATTTTTTTGGAAATGTGTAATT
ATTATATAATAGTATTCAATTGAGAAAAAAATAGATTTTTATCTAAGACT
GATAATCATTTCAACATTTTCAACTTTACAATGTATTAAAATTATGTTTA
TTTG
back to top

protein sequence of SMED30006221-orf-1

>SMED30006221-orf-1 ID=SMED30006221-orf-1|Name=SMED30006221-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MDDDECKIIPAITKPYSPQPRLPPKADHGARSSKTLLTDNGGNKSTSCLT
PSDTLNLKPTGIHQVRKYSVVDPEKCSINMDASEISQMDKQTSFCRIALI
LVSYFLVALTFPISLIGCIKVVAEYERAVIFRLGRILTGGAKGPGLFFIL
PCIDQIRKVDLRTVTFDVPPQEVLTKDSVTVAVDAVVYYRIYNPIVSVTN
VENADRSTRLLAATTLRNVLGTKNLAEILSERDSISSMMQALLDEATHPW
GVKVERVEVKDVRLPVQLQRAMAAEAEADRESKAKVIAALGEQKSAKALK
EAADVISQSPMALQLRYLQTLNAISAEKNSTIIFPLPMELMKSFSSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043202Band-7_stomatin-like
IPR036013Band_7/SPFH_dom_sf
IPR001972Stomatin_HflK_HflKC_fam
IPR001107Band_7
IPR018080Band_7/stomatin-like_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 14..37
NoneNo IPR availablePANTHERPTHR10264:SF114BAND 7 PROTEIN CG42540coord: 83..172
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 1..106
e-value: 6.6E-44
score: 151.1
NoneNo IPR availablePANTHERPTHR10264:SF121coord: 1..172
IPR043202Band-7 stomatin-likePANTHERPTHR10264BAND 7 PROTEIN-RELATEDcoord: 83..172
IPR043202Band-7 stomatin-likePANTHERPTHR10264BAND 7 PROTEIN-RELATEDcoord: 1..172
IPR001972Stomatin/HflK/HflC familyPRINTSPR00721STOMATINcoord: 80..98
score: 70.3
coord: 56..79
score: 48.51
coord: 99..120
score: 70.78
coord: 124..147
score: 66.07
coord: 1..22
score: 64.94
coord: 36..53
score: 67.46
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 1..104
e-value: 7.1E-8
score: 42.2
IPR001107Band 7 domainPFAMPF01145Band_7coord: 1..117
e-value: 4.6E-20
score: 72.4
IPR018080Band 7/stomatin-like, conserved sitePROSITEPS01270BAND_7coord: 60..88
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 1..109