Transmembrane protease serine

Overview
NameTransmembrane protease serine
Smed IDSMED30006211
Length (bp)984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protease serine (SMED30006211) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protease serine (SMED30006211) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protease serine (SMED30006211) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protease serine (SMED30006211) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006211

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30006211h1SMcG0005532 Contig250GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006211h1SMcG0005532 Contig250GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
secretory cellSMED30006211h1SMcG0005532 Contig250GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30006211h1SMcG0005532 Contig250GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30006211h1SMcG0005532 SmedASXL_006828SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30006211h1SMcG0005532 Contig50853uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006211h1SMcG0005532 Contig50853newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006211h1SMcG0005532 Contig18950uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006211h1SMcG0005532 Contig18950newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30006211h1SMcG0005532 dd_Smed_v4_4090_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006211h1SMcG0005532 dd_Smed_v6_4090_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006211h1SMcG0005532 OX_Smed_1.0.17612ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protease serine vs. Ensembl Human
Match: PRSS33 (serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30405])

HSP 1 Score: 137.117 bits (344), Expect = 1.241e-37
Identity = 84/243 (34.57%), Postives = 136/243 (55.97%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFL--KPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL-INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEI-RPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D R  + PW A+I       CGGS+I  +W+L+AAHCF   R  P ++ ++ +G+  L + + + L    +++++   + +     D+AL++L   + L ++V+P+ L +  +     + C V G+GS      + +W    L+  +VP+++ R C  LY V +   +  R V   ++CAG  +G  DAC+GDSGG L C  S    VLVG+VS G GC LPNRP +Y +V++Y  WI
Sbjct:   37 IVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPR-RALPAEY-RVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEW--RPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGS-WVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Transmembrane protease serine vs. Ensembl Human
Match: PRSS33 (serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30405])

HSP 1 Score: 137.117 bits (344), Expect = 1.241e-37
Identity = 84/243 (34.57%), Postives = 136/243 (55.97%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFL--KPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL-INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEI-RPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D R  + PW A+I       CGGS+I  +W+L+AAHCF   R  P ++ ++ +G+  L + + + L    +++++   + +     D+AL++L   + L ++V+P+ L +  +     + C V G+GS      + +W    L+  +VP+++ R C  LY V +   +  R V   ++CAG  +G  DAC+GDSGG L C  S    VLVG+VS G GC LPNRP +Y +V++Y  WI
Sbjct:   37 IVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPR-RALPAEY-RVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEW--RPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGS-WVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Transmembrane protease serine vs. Ensembl Human
Match: TMPRSS11D (transmembrane serine protease 11D [Source:HGNC Symbol;Acc:HGNC:24059])

HSP 1 Score: 137.502 bits (345), Expect = 1.227e-36
Identity = 86/239 (35.98%), Postives = 131/239 (54.81%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKF-LKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWWSST---LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG +A     PW  ++   +  HCGGS+IN  WIL+AAHCF +   +P D W   + +  +     K  ++ + I+IH  +    + NDIAL+ LE  +     +  + L   ++ I   S+  V G+G+  +++   T   L+ GQV +I+   C      P S N    +    +CAG  +GG DAC+GDSGG LV  +S++   +VGIVS GD CGLP++P +Y  V++YLDWI
Sbjct:  187 ILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNS-NPRD-W---IATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNIPPGSTAYVTGWGA--QEYAGHTVPELRQGQVRIISNDVCN----APHSYNG--AILSGMLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWI 412          
BLAST of Transmembrane protease serine vs. Ensembl Human
Match: TMPRSS11E (transmembrane serine protease 11E [Source:HGNC Symbol;Acc:HGNC:24465])

HSP 1 Score: 133.65 bits (335), Expect = 4.640e-35
Identity = 82/242 (33.88%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  112 GKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCL-VYGFGSTVKDWWSST-LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWIS 831
            G+   I GG +    + PW A++    +  CG ++IN  W++SAAHCF  Y+ +P   W    G     +K  + L+  +II+HEK+  P +  DI+L EL   +   + V  + L + S +      + V GFG+   D +S   L+  QV +I+   C      P + N+   +    +CAG+L+G  DAC+GDSGG LV ++++    L GIVS GD C  PN+P +Y  V++  DWI+
Sbjct:  187 GQSLRIVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYK-NPA-RWTASFGVTIKPSKMKRGLR--RIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNE----PQAYNDA--ITPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWIT 418          
BLAST of Transmembrane protease serine vs. Ensembl Human
Match: TMPRSS11E (transmembrane serine protease 11E [Source:HGNC Symbol;Acc:HGNC:24465])

HSP 1 Score: 133.265 bits (334), Expect = 4.985e-35
Identity = 82/242 (33.88%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  112 GKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCL-VYGFGSTVKDWWSST-LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWIS 831
            G+   I GG +    + PW A++    +  CG ++IN  W++SAAHCF  Y+ +P   W    G     +K  + L+  +II+HEK+  P +  DI+L EL   +   + V  + L + S +      + V GFG+   D +S   L+  QV +I+   C      P + N+   +    +CAG+L+G  DAC+GDSGG LV ++++    L GIVS GD C  PN+P +Y  V++  DWI+
Sbjct:  187 GQSLRIVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYK-NPA-RWTASFGVTIKPSKMKRGLR--RIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTCNE----PQAYNDA--ITPRMLCAGSLEGKTDACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWIT 418          
BLAST of Transmembrane protease serine vs. Ensembl Celegans
Match: svh-1 (HGF/MSP/plasminogen-like protein [Source:UniProtKB/TrEMBL;Acc:Q17800])

HSP 1 Score: 111.309 bits (277), Expect = 9.983e-27
Identity = 77/252 (30.56%), Postives = 131/252 (51.98%), Query Frame = 1
Query:  106 ATGKVAFIAGGNDARIEDAPWHAAIM--SGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGS--DDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELE-GGINLKSQVKPIDLINLSEKIVES---SCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFI 837
            A  ++A + GG +      PW AA+   +    HCG S++++  +++AAHCF       +  ++++VG   ++  + N +    ++I  +  + K  +S+DIA++E+   GI      +PI L   S+  V +    C+V G+GS +   ++  L+   +P+IN   C       +S+     + +S  CAG L+GG D+C+GDSGG   C       VL G++S GDGC    +P +Y  V+ YL WIS I
Sbjct:  706 AKSRIARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEEDER--VSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLY-KDIFSHDIAILEIPYPGIEFNEYAQPICLP--SKDFVYTPGRQCVVSGWGS-MGLRYAERLQAALIPIINRFDC------VNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAI 945          
BLAST of Transmembrane protease serine vs. Ensembl Celegans
Match: try-1 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q23528])

HSP 1 Score: 100.908 bits (250), Expect = 1.917e-24
Identity = 76/244 (31.15%), Postives = 124/244 (50.82%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIH-CGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSN-DIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVK--DWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQR 846
            + GG+++     PW   ++S    H CGGS+I+  ++L+AAHCF   R  P   + + VG    ++ +    +   + IH  ++  F S+ D A++ +   +N  +  +PI L +L   +    C+V G+GST++     + TL+   VP+++   C +L   P+    I     S +CAG   G  D+C+GDSGG L+C      + L G+VS G GC  P  P +Y NV S   WI+    R
Sbjct:   58 LIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDR-RPTS-YSVRVGGH--RSGSGSPHRVTAVSIHPWYNIGFPSSYDFAIMRIHPPVNTSTTARPICLPSL-PAVENRLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSL---PNYIGRIH--LPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWE-LTGVVSWGIGCARPGMPGVYGNVHSASTWINLEMNR 290          
BLAST of Transmembrane protease serine vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 77.7962 bits (190), Expect = 4.043e-16
Identity = 78/255 (30.59%), Postives = 125/255 (49.02%), Query Frame = 1
Query:  127 IAGGNDARIED-APWHAAIMS-GDN---IHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES--SCLVYGFGSTV--------KDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHG-DGC-GLPNR---PTMYANVSSYLDWIS 831
            I GGN   I+D A W A ++S GDN   I CG +VI++ W+++AAHC    +     + +      + KN   +    K+  IH  ++     NDIAL+ +   ++ K  +KP+ L++   K+++   + +V G+G T+        K   S TL+   VP+I+   C   +   S  +     Y+  ICAG    G     GDSGG L+   S    V +GI S+G DG  G+ ++   P +Y  +S Y+ WI 
Sbjct:   38 IIGGNS--IDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVR------EPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLS-KLGIKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQ--ICAGAYLHG--TAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWIQ 279          
BLAST of Transmembrane protease serine vs. Ensembl Celegans
Match: try-3 (TRYpsin-like protease [Source:UniProtKB/TrEMBL;Acc:Q94176])

HSP 1 Score: 73.1738 bits (178), Expect = 1.117e-14
Identity = 66/230 (28.70%), Postives = 111/230 (48.26%), Query Frame = 1
Query:  184 SGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES--SCLVYGFGSTV--------KDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHG-DGC-GLPNR---PTMYANVSSYLDWI 828
            +G  I CG +VI++ W+++AAHC    +     + +      + KN   +    K+  IH  ++     NDIAL+ +   ++ K  +KP+ L++   K+++   + +V G+G T+        K   S TL+   VP+I+   C   +   S  +     Y+  ICAG    G     GDSGG L+   S    V +GI S+G DG  G+ ++   P +Y  +S Y+ WI
Sbjct:   10 NGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVR------EPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLS-KLGIKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQ--ICAGAYLHG--TAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWI 228          
BLAST of Transmembrane protease serine vs. Ensembl Fly
Match: CG31954 (gene:FBgn0051954 transcript:FBtr0077563)

HSP 1 Score: 127.102 bits (318), Expect = 3.687e-34
Identity = 81/240 (33.75%), Postives = 129/240 (53.75%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGST-----VKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG+   I DAP   ++ +  +I CGGS+I+E+WIL+AAHC Y       D  K+ +G+ +   ++ + L+ ++I+ H +F+      D +L++L   I      K + L     K ++  +C V G+G+T      ++W    L+  +VP++N   C   Y       +   V +  ICAG L+GG DAC+GDSGG +V  + +    LVG+VS G GC  P+ P +Y+ VS   DWI
Sbjct:   51 IVGGHRINITDAPHQVSLQTSSHI-CGGSIISEEWILTAAHCTYG---KTADRLKVRLGTSEFA-RSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFDETKKAVKLPESQMKYMDGEACFVSGWGNTQNLLESREW----LRQVEVPLVNQELCSEKY------KQYGGVTERMICAGFLEGGKDACQGDSGGPMVSESGE----LVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271          
BLAST of Transmembrane protease serine vs. Ensembl Fly
Match: CG4914 (gene:FBgn0036436 transcript:FBtr0075712)

HSP 1 Score: 122.865 bits (307), Expect = 7.106e-32
Identity = 78/244 (31.97%), Postives = 128/244 (52.46%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPF----YSNDIALIELEGGINLKSQVKPIDLINLSEK---IVESSCLVYGFGSTVKDWWSST-LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLK-GGDDACEGDSGGGLV-CTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG    + + PW A +   +  +CGG++IN++++L+AAHC   + W  +   K+  G  D  N      +P+   +   F + F    + NDIAL+ L   + + S ++PI L  + ++    V +  +  G+G+  +D   S  L+  +VPV++  +     CV  +    + + K+ +C+G    GG D+C+GDSGG LV      KR   +GIVS G+GC  PN P +Y  V+ YLDWI
Sbjct:  128 IVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMI---KVTFGEHDRCNDKE---RPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDE-----CVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360          
BLAST of Transmembrane protease serine vs. Ensembl Fly
Match: CG6041 (gene:FBgn0029826 transcript:FBtr0070861)

HSP 1 Score: 121.324 bits (303), Expect = 8.027e-32
Identity = 84/249 (33.73%), Postives = 124/249 (49.80%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIM--------SGDNIHCGGSVINEKWILSAAHCFY---NYRWHPMDHWKIIVGSDDLKNKNVKFLK--PKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKD--WWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG DA IE   +  +I          G    CGG VI+++ + +AAHC Y     ++     + +++GS  L +   + L    +Q+I HE ++    +NDIAL+ + G I           +N       + CL+ G+G   ++  + S+TL+   VP+++   C   Y      N I PV  S +CAG L GG DAC+GDSGG + C       +L GIVS+G GC  P  P +Y NVS Y DWI
Sbjct:   35 IVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSYTTCRISY------NSI-PV--SQVCAGYLSGGVDACQGDSGGPMSCNG-----MLAGIVSYGAGCAAPGYPGVYTNVSYYYDWI 269          
BLAST of Transmembrane protease serine vs. Ensembl Fly
Match: CG3355 (gene:FBgn0031619 transcript:FBtr0077376)

HSP 1 Score: 119.013 bits (297), Expect = 8.805e-31
Identity = 80/246 (32.52%), Postives = 125/246 (50.81%), Query Frame = 1
Query:  109 TGKVAFIAGGNDARIEDAPWHAAIMSGDN---IHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFL-KPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSST-LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLK-GGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            T  V  I GG   R    PW A ++ G +   + CGGS+IN++++L+AAHC +  R    D   I +   D  +++   + K  Q  +H  +D     ND+AL++LE  + L   ++P+ L   +      + +V G+G   +   +S  L+   VPVI   +C         T     + +  +CAG ++ GG DAC+GDSGG L+    + +  L G+VS G GC   N P +YA VS +LDWI
Sbjct:   70 TPNVNRIVGGQQVRSNKYPWTAQLVKGRHYPRLFCGGSLINDRYVLTAAHCVHGNR----DQITIRLLQIDRSSRDPGIVRKVVQTTVHPNYDPNRIVNDVALLKLESPVPLTGNMRPVCLPEANHNFDGKTAVVAGWGLIKEGGVTSNYLQEVNVPVITNAQC-------RQTRYKDKIAEVMLCAGLVQQGGKDACQGDSGGPLIVNEGRYK--LAGVVSFGYGCAQKNAPGVYARVSKFLDWI 302          
BLAST of Transmembrane protease serine vs. Ensembl Fly
Match: CG32755 (gene:FBgn0052755 transcript:FBtr0070862)

HSP 1 Score: 118.627 bits (296), Expect = 1.006e-30
Identity = 81/252 (32.14%), Postives = 130/252 (51.59%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIH---------CGGSVINEKWILSAAHCFYNYRWHPM-----DHWKIIVGSD--DLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE--SSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG    I+  P+  ++    +IH         CGG+VI+++ + SAAHC+      P+     + + ++ GS   D  ++  +    ++I+ H+ ++     NDIAL+ L G I  +S    +  I L+ K  E  ++CL++G+G       S++L+   VP++N   C  +Y +P+S           +CAG L+GG DAC+GDSGG L+C        L GI+S G GC  P  P +Y NVS +L WI
Sbjct:   38 IVGGYTVTIDQVPFQVSVRR-RSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES--PGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYKLPAS----------QMCAGFLQGGIDACQGDSGGPLICDGR-----LAGIISWGVGCADPGYPGVYTNVSHFLKWI 271          
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Match: CR352265.1 (pep chromosome:GRCz11:24:21813127:21819010:-1 gene:ENSDARG00000062758.6 transcript:ENSDART00000091096.6 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352265.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.178e-36
Identity = 82/254 (32.28%), Postives = 132/254 (51.97%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIH-CGGSVINEKWILSAAHCFYN---YRWHPMDHWKIIVGSDDLKNKN--VKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWWSSTL-KVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKI 852
            K A I GG DA+    PW  ++      H CG S++  +W++SAAHCF +    ++     W+  +G   + + +      + ++I++H ++D+     DIAL+EL   +     V+P+ +   S      +SC V G+G   ++   +TL +   V +IN   C  +Y      + + P     +CAGN++GG DAC+GDSGG LVC    +R  L GIVS G+GC   NRP +Y  V  + DWI   T+ ++
Sbjct:   51 KRAKIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVASRWLVSAAHCFQDSDAIKYSDARSWRAYMGMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSAPVFFNELVQPVCVPAPSHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMY-----DDAVTPRM---LCAGNIQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTRVIKFTDWIHQQTKGQV 296          
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Match: tmprss12 (transmembrane serine protease 12 [Source:ZFIN;Acc:ZDB-GENE-090313-370])

HSP 1 Score: 130.954 bits (328), Expect = 1.997e-35
Identity = 88/276 (31.88%), Postives = 146/276 (52.90%), Query Frame = 1
Query:   40 TFGIQLEMIVKFIFCVVHIGILATG--------KVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIV----GSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLI--NLSEKIVESS-CLVYGFGSTVKDW-WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVC-TNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSY 816
            +F + L  ++  I C++  GI   G        K + I+GG+ A     PW  +I       CGGS+I+ +W+++A+HCF   R    ++ K++V     S     K V++   +++I+HEK+++  Y ND+AL+ L       + V+P+ ++   + EK +    C + G+GS+V +    +TL+  +V +I+ + C   +      N+      + ICAG   GG D C+GDSGG L C +  K+R  L G+ SHGDGC LP +P +YA  S Y
Sbjct:   20 SFKMSLTFVL-IIICLLPFGIAGCGQRTLVSPPKQSRISGGHSALEGAWPWQVSIQQMFWHICGGSIISHRWVITASHCFKKKR----NNNKLLVVAGVNSRFKPGKEVQYRTVQKVILHEKYNQSEYDNDVALLYLHHPFYFTNYVQPVCILENQMHEKQLNFGLCYITGWGSSVLEGKLYNTLQEAEVELIDTQICNQRWWHNGHVND------NMICAGFETGGVDTCQGDSGGPLQCYSQDKERFYLFGVTSHGDGCALPKKPGIYARASRY 284          
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Match: zgc:171509 (zgc:171509 [Source:ZFIN;Acc:ZDB-GENE-080219-48])

HSP 1 Score: 127.872 bits (320), Expect = 7.677e-35
Identity = 85/254 (33.46%), Postives = 134/254 (52.76%), Query Frame = 1
Query:   76 IFCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFI 837
            I  ++ IG++   K   I GG++ +    PW A +  G  + CGGS+I+E W++SAAHC  +     +    + V  D  +      ++ +++I H K++   ++NDI LI+L     + + VKP+ L        E  CLV G+G T  D  SSTL+  ++P+++   C + Y         R + K   CAG + GG D+C+GDSGG +VC  + K     GIVS G GC  P  P +Y  V  Y++WI++I
Sbjct:    4 IVFILLIGVVVHSKGDKIIGGHECQPHSQPWQARLDDGYGL-CGGSLIHESWVVSAAHCKSSSIIVHLGKHDLFVVEDTAQE-----IQAEKVISHPKYNNREHNNDIMLIKLREPAVINNNVKPVPLPTNCSHAGEQ-CLVSGWGVT-GDSISSTLQCLELPILSKADCKSAYG--------RVITKKMFCAGFMDGGKDSCQGDSGGPVVCNGTLK-----GIVSFGIGCAEPGFPGVYVEVCRYINWINYI 236          
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Match: tmprss5 (transmembrane serine protease 5 [Source:ZFIN;Acc:ZDB-GENE-131121-184])

HSP 1 Score: 133.65 bits (335), Expect = 1.406e-34
Identity = 83/253 (32.81%), Postives = 132/253 (52.17%), Query Frame = 1
Query:  112 GKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKI---IVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVKD--WWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKI 852
             K+  I GG +A +   PW  ++   +   CGGS+I  +WI++AAHC +NYR   +  W +   I+ S+  K    +    ++II ++ ++   + NDIAL++L+  +N    ++P+ L      +   + C + G+G T  D       LK   VP+I+ +KC       SS      +    +CAG  +G  DAC+GDSGG LVC +    + LVG+VS G GC  PN P +Y+ V+ +L WI  I +  I
Sbjct:  307 AKLPRIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCN------SSCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWR-LVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDIIEVSI 552          
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Match: tmprss5 (transmembrane serine protease 5 [Source:ZFIN;Acc:ZDB-GENE-131121-184])

HSP 1 Score: 133.265 bits (334), Expect = 1.894e-34
Identity = 82/250 (32.80%), Postives = 131/250 (52.40%), Query Frame = 1
Query:  112 GKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKI---IVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVKD--WWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQ 843
             K+  I GG +A +   PW  ++   +   CGGS+I  +WI++AAHC +NYR   +  W +   I+ S+  K    +    ++II ++ ++   + NDIAL++L+  +N    ++P+ L      +   + C + G+G T  D       LK   VP+I+ +KC       SS      +    +CAG  +G  DAC+GDSGG LVC +    + LVG+VS G GC  PN P +Y+ V+ +L WI  I +
Sbjct:  307 AKLPRIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAGIITSNLAKLAQYQGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNFSDTIRPVCLPQYDHDLPGGTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCN------SSCMYNGEITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWR-LVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDIIE 549          
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Match: gdap2 (ganglioside induced differentiation associated protein 2 [Source:Xenbase;Acc:XB-GENE-996028])

HSP 1 Score: 155.606 bits (392), Expect = 4.060e-44
Identity = 90/246 (36.59%), Postives = 137/246 (55.69%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL----INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIR-PVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D++    PW   I S D   CGGS+I  KW++SA+HCF   R +P   + + +GS  L   N N   +  ++ I+H  +  P Y +DI L+EL   +N  + ++P+ L    +N    +    C V G+G+     +++D   +TL+   VP+I  ++C ++   PS        +    +CAG + GG D+C+GDSGG LVC  +  +  LVG+VS GDGCG PNRP +Y  V++YLDWI
Sbjct:   22 IMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFN--RTNPPSFYTVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPSAGVNFPTGL---QCWVTGWGNIASNVSLRD--PNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDMLCAGYIDGGKDSCQGDSGGPLVCA-AANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWI 259          
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Match: gdap2 (ganglioside induced differentiation associated protein 2 [Source:Xenbase;Acc:XB-GENE-996028])

HSP 1 Score: 155.606 bits (392), Expect = 5.321e-44
Identity = 90/246 (36.59%), Postives = 137/246 (55.69%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL----INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIR-PVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D++    PW   I S D   CGGS+I  KW++SA+HCF   R +P   + + +GS  L   N N   +  ++ I+H  +  P Y +DI L+EL   +N  + ++P+ L    +N    +    C V G+G+     +++D   +TL+   VP+I  ++C ++   PS        +    +CAG + GG D+C+GDSGG LVC  +  +  LVG+VS GDGCG PNRP +Y  V++YLDWI
Sbjct:   36 IMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFN--RTNPPSFYTVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPSAGVNFPTGL---QCWVTGWGNIASNVSLRD--PNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDMLCAGYIDGGKDSCQGDSGGPLVCA-AANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWI 273          
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Match: ENSXETT00000015760.1 (serine protease 27-like [Source:NCBI gene;Acc:100494126])

HSP 1 Score: 153.295 bits (386), Expect = 1.237e-43
Identity = 87/243 (35.80%), Postives = 132/243 (54.32%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGS--DDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRP--VYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            ++  I GG +A+    PW A I   D   CGGS++  KW++SAAHCF +   +P   + + +GS    + N N   +  K+ + H  +  P    DIAL+EL   +N    ++P+ L ++   ++    C V G+G+   + W        VP+I+ ++C TL   PSST +     +    +CAG + G  D+C+GDSGG LVCT    R  LVG VS G+GCG PNRP +Y  +++Y DWI
Sbjct:   20 QLTRIMGGQNAQQGAWPWQARIQGNDGGLCGGSLVTTKWVISAAHCFNSS--NPPSFYTVYLGSYQTSVPNANEVPMTVKRFMNHPNYTSPDKGFDIALVELSSDVNYTLYIQPVCLPSIGVSLLTGLQCWVTGWGNIASNEWRDVELA--VPLIDNQQCNTLLQTPSSTGQSSSFVILNDMLCAGYIDGSKDSCQGDSGGPLVCTQ-NSRWYLVGAVSFGEGCGQPNRPGVYTRLTTYYDWI 257          
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Match: ENSXETT00000015817.1 (serine protease 27-like [Source:NCBI gene;Acc:100494126])

HSP 1 Score: 151.754 bits (382), Expect = 5.033e-43
Identity = 88/246 (35.77%), Postives = 135/246 (54.88%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGS--DDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFGSTVKDW---WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRP--VYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            ++  I GG +A+    PW A I   D   CGGS++  KW++SAAHCF +   +P   + + +GS    + N N   +  K+ + H  +  P    DIAL+EL   +N    ++P+ L ++   ++    C V G+G+   +      +TL+   VP+I+ ++C TL   PSST +     +    +CAG + G  D+C+GDSGG LVCT    R  LVG VS G+GCG PNRP +Y  +++Y DWI
Sbjct:   20 QLTRIMGGQNAQQGAWPWQARIQGNDGGLCGGSLVTTKWVISAAHCFNSS--NPPSFYTVYLGSYQTSVPNANEVPMTVKRFMNHPNYTSPDKGFDIALVELSSDVNYTLYIQPVCLPSIGVSLLTGLQCWVTGWGNIASNGDLPEPNTLQELAVPLIDNQQCNTLLQTPSSTGQSSSFVILNDMLCAGYIDGSKDSCQGDSGGPLVCTQ-NSRWYLVGAVSFGEGCGQPNRPGVYTRLTTYYDWI 262          
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Match: ENSXETT00000031071.1 (serine protease 27-like [Source:NCBI gene;Acc:100494126])

HSP 1 Score: 151.369 bits (381), Expect = 9.220e-43
Identity = 88/246 (35.77%), Postives = 135/246 (54.88%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGS--DDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFGSTVKDW---WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRP--VYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            ++  I GG +A+    PW A I   D   CGGS++  KW++SAAHCF +   +P   + + +GS    + N N   +  K+ + H  +  P    DIAL+EL   +N    ++P+ L ++   ++    C V G+G+   +      +TL+   VP+I+ ++C TL   PSST +     +    +CAG + G  D+C+GDSGG LVCT    R  LVG VS G+GCG PNRP +Y  +++Y DWI
Sbjct:   20 QLTRIMGGQNAQQGAWPWQARIQGNDGGLCGGSLVTTKWVISAAHCFNSS--NPPSFYTVYLGSYQTSVPNANEVPMTVKRFMNHPNYTSPDKGFDIALVELSSDVNYTLYIQPVCLPSIGVSLLTGLQCWVTGWGNIASNGDLPEPNTLQELAVPLIDNQQCNTLLQTPSSTGQSSSFVILNDMLCAGYIDGSKDSCQGDSGGPLVCTQ-NSRWYLVGAVSFGEGCGQPNRPGVYTRLTTYYDWI 262          
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Match: Prss8 (protease, serine 8 (prostasin) [Source:MGI Symbol;Acc:MGI:1923810])

HSP 1 Score: 136.346 bits (342), Expect = 5.576e-37
Identity = 84/240 (35.00%), Postives = 121/240 (50.42%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKN--KNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFG---STVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG  A+    PW  +I    N  CGGS+++ KW++SAAHCF   R H  + +++ +G+  L +   +       QII H  + +     DIALI L   +     ++PI L   +        C V G+G    +V       L+  +VP+I+   C  LY + +   E   + +  +CAG +KGG DAC+GDSGG L C   +    L GIVS GD CG PNRP +Y   S+Y  WI
Sbjct:   45 ITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFP--REHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCP-MEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281          
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Match: Prss8 (protease, serine 8 (prostasin) [Source:MGI Symbol;Acc:MGI:1923810])

HSP 1 Score: 136.346 bits (342), Expect = 5.576e-37
Identity = 84/240 (35.00%), Postives = 121/240 (50.42%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKN--KNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFG---STVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG  A+    PW  +I    N  CGGS+++ KW++SAAHCF   R H  + +++ +G+  L +   +       QII H  + +     DIALI L   +     ++PI L   +        C V G+G    +V       L+  +VP+I+   C  LY + +   E   + +  +CAG +KGG DAC+GDSGG L C   +    L GIVS GD CG PNRP +Y   S+Y  WI
Sbjct:   45 ITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFP--REHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCP-MEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281          
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Match: Prss52 (protease, serine 52 [Source:MGI Symbol;Acc:MGI:1920632])

HSP 1 Score: 135.576 bits (340), Expect = 7.258e-37
Identity = 95/257 (36.96%), Postives = 132/257 (51.36%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVL--VGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIPKKYMYNE 891
            I GG  A I + PWH  IM+  +  CGGS++NE W+LSA+HCF       ++   II G++DL  K +K+ K  ++ +H KFD     NDIAL+ L+  +NL     PI    +S+     +C V G+G T      +T + G  P I       LY        +  + K+ +CAG    G DAC+GDSGG LVC   +   +   VGIVS G GCG  N P +Y  VS Y+ WIS  T +        + YMY +
Sbjct:   56 IVGGKPANILEFPWHVGIMNHGSHLCGGSILNEWWVLSASHCFDQLNNSKLE---IIHGTEDLSTKGIKYQKVDKLFLHPKFDDWLLDNDIALLLLKSPLNLSVNRIPICTSEISDIQAWRNCWVTGWGIT------NTSEKGVQPTILQAVKVDLYRWDWCGYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGMGCGKKNLPGVYTKVSHYVRWISKQTAKA------GRPYMYEQ 297          
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Match: Tmprss11c (transmembrane protease, serine 11c [Source:MGI Symbol;Acc:MGI:3521861])

HSP 1 Score: 134.42 bits (337), Expect = 1.170e-35
Identity = 88/237 (37.13%), Postives = 130/237 (54.85%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESS-CLVYGFGSTVKDWWS-STLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWIS 831
            +AGG DA   + PW A++       CG ++I+  W+++AAHCF     +P D WK+  G   L +K       K IIIHE +  P + NDIA++ L   +  +S ++   L   ++K   +S  +V G+G+   D  S + L+ G+V +I+ + C +     +    I P     +CAG LKG  DAC+GDSGG LV  +SK    L GIVS GD C LPN+P +Y  V+ Y DWI+
Sbjct:  187 VAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCFIRAA-NPKD-WKVSFGF--LLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNS---GKAYGGMITP---GMMCAGFLKGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWIT 413          
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Match: Tmprss11c (transmembrane protease, serine 11c [Source:MGI Symbol;Acc:MGI:3521861])

HSP 1 Score: 134.42 bits (337), Expect = 1.435e-35
Identity = 88/237 (37.13%), Postives = 130/237 (54.85%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESS-CLVYGFGSTVKDWWS-STLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWIS 831
            +AGG DA   + PW A++       CG ++I+  W+++AAHCF     +P D WK+  G   L +K       K IIIHE +  P + NDIA++ L   +  +S ++   L   ++K   +S  +V G+G+   D  S + L+ G+V +I+ + C +     +    I P     +CAG LKG  DAC+GDSGG LV  +SK    L GIVS GD C LPN+P +Y  V+ Y DWI+
Sbjct:  200 VAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCFIRAA-NPKD-WKVSFGF--LLSKPQAPRAVKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNS---GKAYGGMITP---GMMCAGFLKGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWIT 426          
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Match: sp|Q9N2D1|TRYT_PIG (Tryptase OS=Sus scrofa OX=9823 GN=MCT7 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.497e-38
Identity = 89/251 (35.46%), Postives = 135/251 (53.78%), Query Frame = 1
Query:  121 AFIAGGNDARIEDAPWHAAIMSGDNI---HCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWW---SSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSN-ICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRK 849
            A I GG +A     PW  ++   D      CGGS+I+ +W+L+AAHCF   +  P+ + ++ +G   L  ++ + L   +II+H  +       DIAL+ELE  +NL S V+P+ L   SE   + + C V G+G     W       LK  +VP++   +C   Y +  ST +  P+ + + +CAG+   G D+C+GDSGG LVC       +  G+VS G+GC LPNRP +Y  V+ YLDWI     R+
Sbjct:   29 AGIVGGKEAPGHKWPWQVSLRCLDQYWKHFCGGSLIHPQWVLTAAHCFGPEKADPL-YIRVQLGEQHLYYQD-RLLLVSRIIVHPNYYDEVNGADIALLELEDPVNLSSHVQPVTLPPASETFPKGTRCWVTGWGDVHSGWPLPPPYPLKQVRVPIVENSECDMQYHLGLSTGDNIPIVRDDMLCAGS--EGHDSCQGDSGGPLVC-RVNGTWLQAGVVSWGEGCALPNRPGIYTRVTHYLDWIHQCIPRE 274          
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Match: sp|Q8NF86|PRS33_HUMAN (Serine protease 33 OS=Homo sapiens OX=9606 GN=PRSS33 PE=1 SV=3)

HSP 1 Score: 137.117 bits (344), Expect = 5.962e-37
Identity = 84/243 (34.57%), Postives = 136/243 (55.97%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFL--KPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL-INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEI-RPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D R  + PW A+I       CGGS+I  +W+L+AAHCF   R  P ++ ++ +G+  L + + + L    +++++   + +     D+AL++L   + L ++V+P+ L +  +     + C V G+GS      + +W    L+  +VP+++ R C  LY V +   +  R V   ++CAG  +G  DAC+GDSGG L C  S    VLVG+VS G GC LPNRP +Y +V++Y  WI
Sbjct:   37 IVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTAAHCFPR-RALPAEY-RVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPGVPLPEW--RPLQGVRVPLLDSRTCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGS-WVLVGVVSWGKGCALPNRPGVYTSVATYSPWI 274          
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Match: sp|Q9D9M0|PRS52_MOUSE (Serine protease 52 OS=Mus musculus OX=10090 GN=Prss52 PE=2 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 5.077e-36
Identity = 95/257 (36.96%), Postives = 132/257 (51.36%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVL--VGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIPKKYMYNE 891
            I GG  A I + PWH  IM+  +  CGGS++NE W+LSA+HCF       ++   II G++DL  K +K+ K  ++ +H KFD     NDIAL+ L+  +NL     PI    +S+     +C V G+G T      +T + G  P I       LY        +  + K+ +CAG    G DAC+GDSGG LVC   +   +   VGIVS G GCG  N P +Y  VS Y+ WIS  T +        + YMY +
Sbjct:   56 IVGGKPANILEFPWHVGIMNHGSHLCGGSILNEWWVLSASHCFDQLNNSKLE---IIHGTEDLSTKGIKYQKVDKLFLHPKFDDWLLDNDIALLLLKSPLNLSVNRIPICTSEISDIQAWRNCWVTGWGIT------NTSEKGVQPTILQAVKVDLYRWDWCGYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGMGCGKKNLPGVYTKVSHYVRWISKQTAKA------GRPYMYEQ 297          
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Match: sp|O60235|TM11D_HUMAN (Transmembrane protease serine 11D OS=Homo sapiens OX=9606 GN=TMPRSS11D PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.892e-36
Identity = 86/239 (35.98%), Postives = 131/239 (54.81%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKF-LKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWWSST---LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG +A     PW  ++   +  HCGGS+IN  WIL+AAHCF +   +P D W   + +  +     K  ++ + I+IH  +    + NDIAL+ LE  +     +  + L   ++ I   S+  V G+G+  +++   T   L+ GQV +I+   C      P S N    +    +CAG  +GG DAC+GDSGG LV  +S++   +VGIVS GD CGLP++P +Y  V++YLDWI
Sbjct:  187 ILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNS-NPRD-W---IATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNIPPGSTAYVTGWGA--QEYAGHTVPELRQGQVRIISNDVCN----APHSYNG--AILSGMLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWI 412          
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Match: sp|Q9ESD1|PRSS8_MOUSE (Prostasin OS=Mus musculus OX=10090 GN=Prss8 PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 1.714e-35
Identity = 83/240 (34.58%), Postives = 120/240 (50.00%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKN--KNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFG---STVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG  A+    PW  +I    N  CGGS+++ KW++SAAHCF   R H  + +++ +G+  L +   +       QII H  + +     DIA I L   +     ++PI L   +        C V G+G    +V       L+  +VP+I+   C  LY + +   E   + +  +CAG +KGG DAC+GDSGG L C   +    L GIVS GD CG PNRP +Y   S+Y  WI
Sbjct:   45 ITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVSAAHCFP--REHSREAYEVKLGAHQLDSYSNDTVVHTVAQIITHSSYREEGSQGDIAFIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCP-MEGIWYLAGIVSWGDACGAPNRPGVYTLTSTYASWI 281          
BLAST of Transmembrane protease serine vs. TrEMBL
Match: A0A5G3J6J1 (Ganglioside induced differentiation associated protein 2 OS=Xenopus tropicalis OX=8364 GN=gdap2 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 6.376e-41
Identity = 90/246 (36.59%), Postives = 137/246 (55.69%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL----INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIR-PVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D++    PW   I S D   CGGS+I  KW++SA+HCF   R +P   + + +GS  L   N N   +  ++ I+H  +  P Y +DI L+EL   +N  + ++P+ L    +N    +    C V G+G+     +++D   +TL+   VP+I  ++C ++   PS        +    +CAG + GG D+C+GDSGG LVC  +  +  LVG+VS GDGCG PNRP +Y  V++YLDWI
Sbjct:   22 IMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFN--RTNPPSFYTVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPSAGVNFPTGL---QCWVTGWGNIASNVSLRD--PNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDMLCAGYIDGGKDSCQGDSGGPLVCA-AANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWI 259          
BLAST of Transmembrane protease serine vs. TrEMBL
Match: A0A5G3J6I8 (Ganglioside induced differentiation associated protein 2 OS=Xenopus tropicalis OX=8364 GN=gdap2 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.355e-41
Identity = 90/246 (36.59%), Postives = 137/246 (55.69%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL----INLSEKIVESSCLVYGFGS-----TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIR-PVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG D++    PW   I S D   CGGS+I  KW++SA+HCF   R +P   + + +GS  L   N N   +  ++ I+H  +  P Y +DI L+EL   +N  + ++P+ L    +N    +    C V G+G+     +++D   +TL+   VP+I  ++C ++   PS        +    +CAG + GG D+C+GDSGG LVC  +  +  LVG+VS GDGCG PNRP +Y  V++YLDWI
Sbjct:   36 IMGGQDSQQGMWPWQVNIRSNDFSFCGGSLITSKWVISASHCFN--RTNPPSFYTVYLGSYQLTGANGNEIPMAIQRFIVHPNYTSPEYGHDITLVELSSDVNFTNYIQPVCLPSAGVNFPTGL---QCWVTGWGNIASNVSLRD--PNTLQQVAVPLIGNQQCNSILQAPSPLGPSSFAILNDMLCAGYIDGGKDSCQGDSGGPLVCA-AANQWYLVGVVSFGDGCGQPNRPGVYVRVTAYLDWI 273          
BLAST of Transmembrane protease serine vs. TrEMBL
Match: F6YNH1 (Peptidase S1 domain-containing protein OS=Xenopus tropicalis OX=8364 GN=pex10 PE=3 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 1.942e-40
Identity = 87/243 (35.80%), Postives = 132/243 (54.32%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGS--DDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVES-SCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRP--VYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            ++  I GG +A+    PW A I   D   CGGS++  KW++SAAHCF +   +P   + + +GS    + N N   +  K+ + H  +  P    DIAL+EL   +N    ++P+ L ++   ++    C V G+G+   + W        VP+I+ ++C TL   PSST +     +    +CAG + G  D+C+GDSGG LVCT    R  LVG VS G+GCG PNRP +Y  +++Y DWI
Sbjct:   20 QLTRIMGGQNAQQGAWPWQARIQGNDGGLCGGSLVTTKWVISAAHCFNSS--NPPSFYTVYLGSYQTSVPNANEVPMTVKRFMNHPNYTSPDKGFDIALVELSSDVNYTLYIQPVCLPSIGVSLLTGLQCWVTGWGNIASNEWRDVELA--VPLIDNQQCNTLLQTPSSTGQSSSFVILNDMLCAGYIDGSKDSCQGDSGGPLVCTQ-NSRWYLVGAVSFGEGCGQPNRPGVYTRLTTYYDWI 257          
BLAST of Transmembrane protease serine vs. TrEMBL
Match: A0A267EPX7 (Peptidase S1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011981g1 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.109e-40
Identity = 90/250 (36.00%), Postives = 137/250 (54.80%), Query Frame = 1
Query:  118 VAFIAGGNDARIEDAPWHAAIMSGDNI------------HCGGSVINEKWILSAAHCFYNYRW-HPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            V+ + GG+ A   D PW A I+   ++            HCGG +++ +W+LSA HCF    W    + + + +G     + +V+     ++++HE+F +P YSND+AL++L+    L + V+PI L    E    S   V G+G+T     +  L   Q+PV++  +C  LY   S     RPVY  NICAG L G  DAC GDSGG L+  N +   ++ G+VSHGDGCG   RP +YA +S+Y +W+
Sbjct:  112 VSLVIGGHLAVAGDWPWLAQILVSRDLSAKTAKDATPRQHCGGVLVHPQWVLSAGHCF---AWADASETFSVRLGHTAAGDISVQEFNVSRVVVHERFFQPIYSNDVALLKLDKPAQLLNSVEPICLPEPGEAFDNSIGSVAGWGATEDSDVADRLMETQLPVLSNTRCKELYAGTS-----RPVYAENICAGFLAGERDACTGDSGGPLM-INRQDLWLVAGLVSHGDGCGQAKRPGVYARMSAYAEWV 352          
BLAST of Transmembrane protease serine vs. TrEMBL
Match: A0A267H9B2 (Peptidase S1 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019102g1 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 4.131e-40
Identity = 90/250 (36.00%), Postives = 137/250 (54.80%), Query Frame = 1
Query:  118 VAFIAGGNDARIEDAPWHAAIMSGDNI------------HCGGSVINEKWILSAAHCFYNYRW-HPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            V+ + GG+ A   D PW A I+   ++            HCGG +++ +W+LSA HCF    W    + + + +G     + +V+     ++++HE+F +P YSND+AL++L+    L + V+PI L    E    S   V G+G+T     +  L   Q+PV++  +C  LY   S     RPVY  NICAG L G  DAC GDSGG L+  N +   ++ G+VSHGDGCG   RP +YA +S+Y +W+
Sbjct:  112 VSLVIGGHLAVAGDWPWLAQILVSRDLSAKTAKDATPRQHCGGVLVHPQWVLSAGHCF---AWADASETFSVRLGHTAAGDISVQEFNVSRVVVHERFFQPIYSNDVALLKLDKPAQLLNSVEPICLPEPGEAFDNSIGSVAGWGATEDSDVADRLMETQLPVLSNTRCKELYAGTS-----RPVYAENICAGFLAGERDACTGDSGGPLM-INGQDLWLVAGLVSHGDGCGQAKRPGVYARMSAYAEWV 352          
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Match: ENSAMXT00000033802.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:21891941:21894733:1 gene:ENSAMXG00000030254.1 transcript:ENSAMXT00000033802.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.658 bits (348), Expect = 2.343e-38
Identity = 81/252 (32.14%), Postives = 130/252 (51.59%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIH-CGGSVINEKWILSAAHCFYNYR--WHPMDHWKIIVGSDDLKNKN--VKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKI 852
            K A I GG DA+    PW  ++      H CG S++  +W+LSAAHCF +    +     W+  +G   +   +      + ++I+ H ++D+     DIAL+EL   +     V+P+ +   S      ++C V G+G   ++  ++ L+   V +I+ + C  +Y      + + P     ICAGN++GG DAC+GDSGG LVC    +R  L GIVS G+GC   NRP +Y  V  + DWI   T+ ++
Sbjct:   49 KRAKIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVGTRWLLSAAHCFQDSDAIYSDARAWRAFLGMRVMNTASNAAATRQIRRIVQHAQYDQFTSDYDIALLELSAPVFFNDLVQPVCVPAPSHAFTSGTTCFVTGWGVLTEEELATLLQEATVSIISHKTCNKMY-----DDAVTP---RMICAGNIQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTQVIKFTDWIHQQTKGQV 292          
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Match: ENSAMXT00000049166.1 (serine protease 56 [Source:NCBI gene;Acc:103021696])

HSP 1 Score: 138.272 bits (347), Expect = 7.235e-36
Identity = 87/261 (33.33%), Postives = 136/261 (52.11%), Query Frame = 1
Query:   88 VHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKV-GQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNS-KKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGN 858
            V +G   T   + I GG+ A     PW   +     + CGG +++  W+L+AAHCF   R     +W  +VG  D+   +   + LK  ++I H KF+   ++NDIAL+EL   + L  QV P+ L +  E    + CLV G+GS  +D  ++ + +  +VP+++   C +       TN +        CAG L GG D+C+GDSGG L+  +    R  L GI S GDGCG   +P +Y  V+++ DWI    Q+ +G+
Sbjct:   85 VSVGRNLTQPRSRIVGGSPAPPGSWPWLVNLQLDGALMCGGVLVDSSWVLTAAHCFAGSRSD--SYWTAVVGEFDITKTDPEEQVLKVNRVITHPKFNPKTFNNDIALVELTSPVVLSDQVTPVCLPSGIEPPTGTPCLVAGWGSLYEDGPAADVVMEAKVPLLSQGTCKSALGKELLTNTM-------FCAGYLSGGIDSCQGDSGGPLIFQDRITGRFQLYGITSWGDGCGEKGKPGVYTRVTAFTDWILSEIQKSVGS 336          
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Match: zgc:100868 (transmembrane protease serine 9-like [Source:NCBI gene;Acc:103044070])

HSP 1 Score: 135.961 bits (341), Expect = 2.463e-35
Identity = 91/269 (33.83%), Postives = 132/269 (49.07%), Query Frame = 1
Query:   58 EMIVKFIFCVVHIGILATGKVAFIA-------GGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMD-HWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVKDWWSS---TLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
             + V FI  ++  G  +   V  IA       GG +A     PW  ++ +  +  CGGS+IN  W+L+AAHCF +Y    +  H  +        N+   F+   ++I+H  ++   + NDIAL++L   +   S V P+ L         ++   V G+G T      S   TL+  QVPV+  RKC  LY V S T+ +       +CAG L GG D+C+GDSGG LV      R +  GIVS G GC   N P +Y+ VS Y +WI
Sbjct:    6 TLCVAFIISLIANGCYSQSDVCGIASLNTKIVGGQNANNGAWPWQVSLQTSGSHFCGGSLINSNWVLTAAHCFPSYTASQVTAHMGMYALKSTNPNQQSSFI--SRLIVHSSYNTATHDNDIALLQLSTSVTFNSYVSPVCLAAPGSTFYSDTQTWVTGWGDTATGVPLSNPKTLQEVQVPVVGNRKCKCLYGVGSITDNM-------MCAGLLAGGKDSCQGDSGGPLV-VKQNGRWIQGGIVSFGTGCAQANYPGVYSRVSMYQNWI 264          
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Match: tmprss13b (transmembrane protease serine 13-like [Source:NCBI gene;Acc:103023038])

HSP 1 Score: 134.42 bits (337), Expect = 2.705e-35
Identity = 85/242 (35.12%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFY--NYRWHPMDHWKIIVGSD---DLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVK--DWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG+ A +   PW A++    +  CGGS++ + +IL+AAHCF   +  W    +W++ +G +   +L + N       QII+HEK++      DIAL++L   + L S V+P+ L    + ++ ++ C   GFGS  +     SS L    V +I+   C +         E      + +CAG+L GG D+C+GDSGG LVC +   R  L G+ S G GCG  NRP +Y+NV S L WI
Sbjct:  250 IIGGHVAGLGQWPWQASLHFMGSHTCGGSLVAQDFILTAAHCFPKDSASWQLPSNWRVYLGVESQYNLPSPNTV----AQIILHEKYNSQTNDYDIALLKLSQPVTLSSTVQPVCLPMFDKTVIADTQCWTSGFGSMTEGAALGSSRLMEVAVDIIDSSVCNSADVYNGQITE------NMLCAGDLSGGRDSCQGDSGGPLVCQDDDGRWYLTGVTSWGAGCGRKNRPGVYSNVHSLLTWI 481          
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Match: tmprss13b (transmembrane protease serine 13-like [Source:NCBI gene;Acc:103023038])

HSP 1 Score: 134.806 bits (338), Expect = 4.325e-35
Identity = 85/242 (35.12%), Postives = 129/242 (53.31%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFY--NYRWHPMDHWKIIVGSD---DLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVK--DWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG+ A +   PW A++    +  CGGS++ + +IL+AAHCF   +  W    +W++ +G +   +L + N       QII+HEK++      DIAL++L   + L S V+P+ L    + ++ ++ C   GFGS  +     SS L    V +I+   C +         E      + +CAG+L GG D+C+GDSGG LVC +   R  L G+ S G GCG  NRP +Y+NV S L WI
Sbjct:  320 IIGGHVAGLGQWPWQASLHFMGSHTCGGSLVAQDFILTAAHCFPKDSASWQLPSNWRVYLGVESQYNLPSPNTV----AQIILHEKYNSQTNDYDIALLKLSQPVTLSSTVQPVCLPMFDKTVIADTQCWTSGFGSMTEGAALGSSRLMEVAVDIIDSSVCNSADVYNGQITE------NMLCAGDLSGGRDSCQGDSGGPLVCQDDDGRWYLTGVTSWGAGCGRKNRPGVYSNVHSLLTWI 551          
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Match: f10 (coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021206-9])

HSP 1 Score: 134.806 bits (338), Expect = 3.804e-36
Identity = 90/260 (34.62%), Postives = 138/260 (53.08%), Query Frame = 1
Query:  118 VAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDL--KNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDL--INLSEKI-VESSCLVYGFGSTVKDWWSST-LKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQR-KIGNLAIPKK 876
            V  IAGG D    D PW A +   +N++CGG+++N +WIL+AAHC       P+  W ++VG  +L     + + +  K I++H ++D   + NDIAL++LE  +N    V P  L   + ++K+ VE    + G+GS       +T L++ +VP ++     TL C  SS++    V K+  CAG   G  DAC+ DSGG  V T  K      GI+S G+GC    +  +Y  VS YL W+  + QR  +  L IP +
Sbjct:  218 VKTIAGGMDCPRGDCPWQALVKLENNLYCGGTILNLEWILTAAHCL------PLKPWNVVVGEHNLGVTESSEQHVPIKNIVVHSRYDPITFDNDIALLQLERPLNFSRLVLPACLPERDFADKVLVEEQSRISGWGSLHHRGIKATVLQIAEVPFVD-----TLRCKESSSS---LVTKNMFCAGYSDGTKDACQHDSGGPHV-TLFKDTWFATGIISWGEGCARKGKYGVYTRVSRYLLWMHQVMQRASVYKLEIPTR 462          
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001315.1 (pep scaffold:Pmarinus_7.0:GL479305:249343:254401:-1 gene:ENSPMAG00000001180.1 transcript:ENSPMAT00000001315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 128.257 bits (321), Expect = 7.510e-35
Identity = 86/250 (34.40%), Postives = 132/250 (52.80%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSG--DNIHCGGSVINEKWILSAAHCFY--NYRWHPMDHWKIIVGSD--DLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESS-CLVYGFGSTVKDWWS--STLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACE-GDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQR 846
            I GG  A     PW A++ SG   N HCGGS+I+ KW+L+AAHC Y  N R   +  W +  G    D +    +    +QI++H ++       DIAL+EL+  +NL  QV+ + +   S   +    C V G+G+ + + +S  + ++  Q+P+I+   C   Y      +   P     +CAG   GG DAC+ GDSGG LVC + +    L G+VS G GCGL N+P +Y  V+++  WI+ I  +
Sbjct:   89 IVGGESALAGAWPWQASLWSGLTKNHHCGGSLIHPKWVLTAAHCVYGKNCRVEALSDWTLFFGKLLLDKEGPMEQHRSIRQIVVHRQYVSSENDYDIALLELDSPVNLTEQVQTVCMPAASHAFLPGQMCWVSGWGTVIGNEFSLSNNMQEVQLPLISQSDCIGSY------DHATPRM---LCAGYPDGGKDACQQGDSGGPLVCED-RGSWFLAGLVSWGVGCGLVNKPGVYTRVTAFTKWINSIIAQ 328          
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Match: tmprss3a (transmembrane serine protease 3a [Source:ZFIN;Acc:ZDB-GENE-070912-70])

HSP 1 Score: 127.487 bits (319), Expect = 5.308e-34
Identity = 83/262 (31.68%), Postives = 130/262 (49.62%), Query Frame = 1
Query:   85 VVHIGILATGK----VAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKI-VESSCLVYGFGST--VKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRK 849
            VV I  LA G      + I GG DA++   PW  ++       CGG+++   W+LSAAHCF  Y     D W +   + +L     K +   Q + +   D      DIAL++L   +++ + + P  L N      V  +C + G+G+T       S+TL+   VP+++   C       ++ +    +    +CAG ++GG DAC+GDSGG LVC  +     +VG  S G+GC L N P +Y+ V++YLDWI    Q +
Sbjct:  105 VVSISCLACGSSIKSTSRIVGGQDAQLGSWPWQVSLQFNGQHTCGGTLLTPTWVLSAAHCFQGYL--GPDMWNVTDLTSNLAGSISKIITNSQYVDNTNNDY-----DIALVKLSKPLSMSNTIGPACLPNYQTDFQVGMNCWITGWGATKVSAGPASTTLQEVMVPILSTETCN------AANSYNGQITSRMVCAGFMQGGQDACQGDSGGPLVC-QTGTTWFVVGATSFGEGCALTNFPGVYSRVTAYLDWIHGTMQAR 352          
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006641.1 (pep scaffold:Pmarinus_7.0:GL487373:2056:5756:-1 gene:ENSPMAG00000006000.1 transcript:ENSPMAT00000006641.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 2.074e-29
Identity = 75/251 (29.88%), Postives = 120/251 (47.81%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPK---QIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE--SSCLVYGFGSTVKDWWSSTLKVGQVP-VINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDD------ACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQ 843
            I GG +AR    PW A +       CGGS+++ +W++SAAHCF          W + +G     N N   +  +   ++I+HE+++   +  D+AL+EL GG++    V+P+ L    ++      SC V G+G T+ D        G +P V+       L      ++ + P   +      L  GDD        +GDSGG +VC +S  R  L GI S G+ C   N+P +Y  V+ +L+WI   +Q
Sbjct:    1 IVGGTEARPGAWPWQAILYYNGKFQCGGSLLSNRWVVSAAHCFGAS--SQAGSWTVYLGLHSRSNLNSSTVVARNVSRVIVHERYNTTSHDYDVALMELSGGVSFTDYVQPVCLPAPFQRFPYPGKSCFVSGWG-TLSD-------GGDLPNVLQEAAVAIL------SHCVLPGAGAYSADPRLSVGDDMNAVSSVPQGDSGGPMVCQDSNSRWFLSGITSWGESCARANKPGVYGRVTKFLEWIRVKSQ 235          
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007992.1 (pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gene:ENSPMAG00000007230.1 transcript:ENSPMAT00000007992.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 1.951e-28
Identity = 76/245 (31.02%), Postives = 113/245 (46.12%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDL--KNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVG--------QVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWIS 831
            I GG++      PW  ++  G +  CGGS+IN +W++SAAHC+            + +G  ++       + ++  + I H +++     NDI LI+L     L    + I L         SSC+  G   T+  W  +   VG        Q PV++   C   Y  P        +  + IC G L+GG D+C+GDSGG +VC        L GIVS G GC LPN P +Y  V +Y  WI+
Sbjct:   11 IVGGSECAAHSQPWQVSLNIGYHF-CGGSLINSQWVVSAAHCY-----QTASRISVRIGEHNIFVNEGTEQQIQASKAIQHPQYNSWTIDNDIMLIKLSSPATLNQYAQAIAL--------PSSCVNTGVMCTISGWGETQTSVGSPDVLMCVQAPVLSDTSCRNSY--PGD------ITNNMICLGYLEGGKDSCQGDSGGPVVCNGE-----LQGIVSWGRGCALPNYPGVYTKVCNYNAWIA 228          
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Match: EDO47836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKX5])

HSP 1 Score: 118.242 bits (295), Expect = 1.112e-31
Identity = 84/249 (33.73%), Postives = 127/249 (51.00%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDN--IHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNV---KFLKPKQIIIHEKFDKPF-YSNDIALIELEGGINLKSQVKPIDLINLSEKIVESS---CLVYGFGSTVKDWWS-STLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQ 843
            I GG +A I   PW A ++   N    CGGS+I+  W+L+AAHC    +    D   + +G+    NK V   K +K  QII H+ +  P   +NDIAL++LE   NL + V  + L N +  +       C + G+GS      +   L    VP+++  +C T        N    +++S +CAG  +GG D+C+GDSGG LVC ++  R  L G+ S G GC  P    +YA+V    DWI+ + +
Sbjct:    2 IVGGTEAPINGWPWQAMLLRSPNGDQFCGGSLIDPGWVLTAAHCLVGEQ---PDSVVVRLGAHYRSNKTVGTEKDIKVAQIIPHKNYHSPIEMANDIALLKLENPANLVNGVGTVCLANNNTHLPVDEFGKCYITGWGSLSSGGAAPDRLMQASVPLVSKSRCDT-------GNYTGKIHESMLCAGLEQGGVDSCQGDSGGPLVCEDTNGRWHLEGVTSWGYGCAAPRMYGVYASVRYLRDWINGVMK 240          
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Match: NVMASP (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ55])

HSP 1 Score: 124.02 bits (310), Expect = 1.699e-31
Identity = 85/253 (33.60%), Postives = 130/253 (51.38%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWH--PMDHWKIIVG--SDDLKNK-NVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEK--IVESS--CLVYGFGSTVKDW-------WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQ-VLVGIVSHGD--GCGLPNRPTMYANVSSYLDWI 828
            I GG+D      PWH  I  G ++ CGGS+I+EKW+L+AAHC  +   +  P   +++ +G     L N+  V+     +I  H +FD   +  D+ALI+L+G   +   V+PI L    ++  ++  S   +  G+G TV           +  LK   +P++N   C   +      +E   V  +  CAG   GG D C+GDSGGG V  +S K++  L G+VS G   GCGLPN+  +Y  V+ +L WI
Sbjct:  402 IVGGHDTVKGAYPWHVLIRKGGHVACGGSLISEKWVLTAAHCVTHRNGNILPRSRFQVQLGLYRTTLPNEPQVQLRNISEIRTHPQFDHVLFDADLALIKLDGEAIISEYVRPICLPETDDQASLISPSKFGMAVGWGKTVGRQGDVSVKNLADALKETCMPIVNSHVCNQAF-----QDEGYSVTPNMFCAGQASGGKDICQGDSGGGFVLYDSAKQKWFLGGVVSWGSSLGCGLPNKYGVYVRVTQFLGWI 649          
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Match: EDO47664 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC0])

HSP 1 Score: 117.472 bits (293), Expect = 3.149e-31
Identity = 82/255 (32.16%), Postives = 128/255 (50.20%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSG--DNIHCGGSVINEKWILSAAHCFYNYRWH------PMDHWKIIVGSDDLKNK--NVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGI-NLKSQVKPIDLINLS--EKIVESSCLVYGFGSTVKDW-WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSK--KRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQ 843
            I GG  A++ED PW A +  G  D I CGGS+IN +W+++AAHC             P    ++I+G  D+     N       QI IH  + +   +ND+ALI L   I      V+P+ L   +  +  V ++C V G+G   ++   S+ L+   +PV++  +C   Y   +  +++       ICAG   G  D+C+GDSGG  VC + +   R +L G VS G GC    +P +Y ++  YL+WI  I +
Sbjct:   10 IVGGQTAKVEDWPWQAGLKKGLDDTIVCGGSLINREWVVTAAHCIDRNNPSRTGCVVPDPPIRVILGESDVTKHEGNEIHRDVAQICIHPDYHEIKLTNDLALIRLRTPITTFTKHVRPVCLPTSATPDLAVGTNCTVTGYGRVGENEDLSTQLRHATIPVLSVSECRANYSGHTINDKV-------ICAGYEGGKIDSCKGDSGGPFVCKDPRVTSRFILHGAVSWGVGCARKGQPGIYTDIKKYLNWIDNIVK 257          
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Match: EDO34807 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB8])

HSP 1 Score: 115.546 bits (288), Expect = 1.119e-30
Identity = 81/239 (33.89%), Postives = 120/239 (50.21%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNV--KFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKI-VESSCLVYGFGSTVKDWWSS--TLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            + GG DA     PW  A+ S  N  CGGS+++  W+++AAHC    R      ++IIVG  +     V  + L  K++I H +++ P  SNDIALIEL     L S+V P+ L     K+   S C + G+G  +K   SS   L+   +P ++  +C             +    S +CAG   GG DAC+GDSGG LVC    +  +  G  S G GC  P +  +YA+V + + W+
Sbjct:    3 VIGGKDAIPGAWPWQIALKSRGNFICGGSLVSSTWVVTAAHCV--ARSSNPAQYQIIVGEHNRNVNEVTEETLNVKKVIAHPQYNNPRLSNDIALIELASPAKLSSRVNPVCLPPHGYKLPAGSRCFITGWGK-IKHPGSSHPILQQAMIPSLSEAQC--------KQKAQQSGCNSMLCAGLYNGGIDACQGDSGGPLVCETGGQFYIH-GATSWGHGCAAPGKYGVYAHVKNLIGWV 229          
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Match: EDO39666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G1])

HSP 1 Score: 114.39 bits (285), Expect = 4.171e-30
Identity = 80/242 (33.06%), Postives = 119/242 (49.17%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAI-MSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSN----DIALIELEGGINLKSQVKPI-DLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG ++     PW AA+ ++G +  CGGSVI  +W+++AAHCF  +      HW++ +G       ++  K LK  QI IH ++     S+    DIAL+ L   + L   V PI    N         C++ G+G T   W  S   V +   ++       +   S   +I    K  ICAG  +GG DAC  DSGG L+C     R +L GIVS G+ C +P +  +Y NV+ ++ WI
Sbjct:    1 IVGGIESANGAWPWQAALFLNGTHHRCGGSVIKSQWVVTAAHCFSKHSSRNPRHWQVRLGEHSFHKNDRTEKILKVAQIKIHPRYIPGNNSHPGDYDIALVRLSRSVKLGRHVSPICTPDNFKFFKPGKRCVIAGWGKTA--WNGSASPVLREAWVDLSVFDVCFIDRSYAGKIG---KRFICAGYREGGIDACAYDSGGPLMCPGDDNRWLLAGIVSWGEKCAMPYKYGVYTNVNEFMPWI 237          
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Match: ENSORLT00000010945.2 (pep primary_assembly:ASM223467v1:20:17371788:17374100:1 gene:ENSORLG00000008718.2 transcript:ENSORLT00000010945.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 1.965e-40
Identity = 86/252 (34.13%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  115 KVAFIAGGNDARIEDAPWHAAIMSGDNIH-CGGSVINEKWILSAAHCFYNYR--WHPMDHWKIIVGSDDLK--NKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVE-SSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKI 852
            K A I GG+DA     PW  ++      H CG ++++ +W++SAAHCF +    +     W+  +G   +   N        ++I++H ++D+     DIAL+EL   +     V+P+ +   S      +SC V G+G  ++D  +S L+   V +IN + C  LY      + + P     +CAGNL+GG DAC+GDSGG LVC    KR  L GIVS G+GC   NRP +Y  V  + DWI   T+ ++
Sbjct:   50 KRAKIVGGSDALAGSWPWQVSLQMERYGHVCGATLVSNRWLISAAHCFQDSDAIYSDPHAWRAYMGMRVMARGNHGAATRLIRRILLHPQYDQFTSDYDIALLELSAPVFFSDLVQPVCVPASSHTFTTGTSCYVTGWGVLMEDELASRLQEASVKIINRKTCNKLY-----DDAVTP---RMMCAGNLQGGVDACQGDSGGPLVCLERGKRWFLAGIVSWGEGCARQNRPGVYTQVVKFTDWIRLQTKGQV 293          
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Match: ENSORLT00000028221.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 131.339 bits (329), Expect = 8.370e-36
Identity = 90/264 (34.09%), Postives = 136/264 (51.52%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAI---MSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINL-SEKIVESSCLVYGFGS-TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIP-KKYMYNEKLV 900
            I GG DA     PW A +   ++G    CGGS+IN +WILSAAHCF +     +   +I   ++   N +   L   +II+H  +D    +ND+ L++L   +     + P+ L    S+    +S  V GFG+ +     +STL+   +P+++  +C + Y     TN++       ICAG   GG D+C+GDSGG LV  NS  R V  G+VS G+GC  PN P +YA VS +  WIS        +  +  K ++YNE  +
Sbjct:   14 IVGGQDAAAGQWPWQAMLQIPVAGGTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRI---TEQGSNPHQVSLSVSKIIVHPNYDSRTNNNDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGTSSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAY--GGITNQM-------ICAGLTTGGLDSCQGDSGGPLVIKNST-RWVQAGVVSFGEGCAKPNFPGVYARVSEFQSWISSQVDGPTNSYCLNIKTFIYNETTI 264          
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Match: ENSORLT00000028466.1 (tryptase [Source:NCBI gene;Acc:101156896])

HSP 1 Score: 131.339 bits (329), Expect = 9.968e-36
Identity = 90/264 (34.09%), Postives = 136/264 (51.52%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAI---MSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINL-SEKIVESSCLVYGFGS-TVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIP-KKYMYNEKLV 900
            I GG DA     PW A +   ++G    CGGS+IN +WILSAAHCF +     +   +I   ++   N +   L   +II+H  +D    +ND+ L++L   +     + P+ L    S+    +S  V GFG+ +     +STL+   +P+++  +C + Y     TN++       ICAG   GG D+C+GDSGG LV  NS  R V  G+VS G+GC  PN P +YA VS +  WIS        +  +  K ++YNE  +
Sbjct:   20 IVGGQDAAAGQWPWQAMLQIPVAGGTALCGGSLINSQWILSAAHCFKSTSNVVVSLGRI---TEQGSNPHQVSLSVSKIIVHPNYDSRTNNNDLTLLKLASPVTFNDYISPVCLAAAGSDFPGGTSSWVTGFGTLSSGGPLASTLQEVNIPIVSNTQCNSAY--GGITNQM-------ICAGLTTGGLDSCQGDSGGPLVIKNST-RWVQAGVVSFGEGCAKPNFPGVYARVSEFQSWISSQVDGPTNSYCLNIKTFIYNETTI 270          
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Match: tmprss5 (transmembrane serine protease 5 [Source:NCBI gene;Acc:101167385])

HSP 1 Score: 133.265 bits (334), Expect = 1.445e-35
Identity = 86/245 (35.10%), Postives = 127/245 (51.84%), Query Frame = 1
Query:  112 GKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKI---IVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIV-ESSCLVYGFGSTVKDWWSS--TLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
             K+  I GG +A +   PW  ++       CGGS+I  +WI++AAHC +NYR   +  W +   IV     K         ++II ++ ++   + +DIALI+L   +N    ++PI L      +   + C + G+G T  D   S  TLK   VP+I+ +KC +  C+     EI P     +CAG  +G  DAC+GDSGG LVC      + LVG+VS G GC  PN P +Y  V+ +L WI
Sbjct:  138 AKLPRIIGGAEAALGRWPWQVSLYYSSRHTCGGSIITRQWIVTAAHCVHNYRLPQVSSWVVYAGIVTRSSAKMVQHTGHAVEKIIYNKNYNHRTHDSDIALIKLRTPLNFTDTIRPICLPQYKYDLPGGTQCWISGWGYTKPDDVQSPDTLKEAPVPLISTKKCNS-SCM--YNGEITP---RMLCAGYTEGKVDACQGDSGGPLVCQEDTVWR-LVGVVSWGTGCAEPNHPGVYTKVAEFLSWI 375          
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Match: si:dkey-32n7.7 (si:dkey-32n7.7 [Source:ZFIN;Acc:ZDB-GENE-121214-179])

HSP 1 Score: 130.568 bits (327), Expect = 2.516e-35
Identity = 95/289 (32.87%), Postives = 138/289 (47.75%), Query Frame = 1
Query:   79 FCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPK--QIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDW----------WSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI-SFITQRKIGNLAIPKKYMYNEKLVEK 906
            FCV   GI      + I GG DA     PW A++       CGGS+IN++W+L+AAHC        +    + +G  +L+ KN   +  +   II+H  FD+   +NDIAL+ L   +     ++P+ L         +S    G GS V  W          +  T++   VPVI  R+C  LY V + T+ +       ICAG L GG D+C+GDSGG ++ T      +  GIVS G GC  PN P +Y+ VS Y  WI S I+  + G +      +Y    + K
Sbjct:   26 FCVSVCGIAPLN--SKIVGGADAVPGSWPWQASLQYFGKHFCGGSLINKEWVLTAAHCVAGTSTKKL---LVSLGRQNLEGKNPNEVSRRVAAIIVHPDFDRGTMNNDIALVRLSSPVPFSHYIRPVCL------AASASVFNNGTGSWVTGWGHIKEGELLPFPQTIQEVAVPVIGSRQCNCLYGVINITSNM-------ICAGRLDGGKDSCQGDSGGPML-TKLGSVWIQSGIVSFGIGCARPNLPGVYSRVSRYQTWIKSHISSHEPGFVHQSSSNLYKPHFLVK 295          
BLAST of Transmembrane protease serine vs. Planmine SMEST
Match: SMESG000025034.1 (SMESG000025034.1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 287/287 (100.00%), Postives = 287/287 (100.00%), Query Frame = 1
Query:   61 MIVKFIFCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIPKKYMYNEKLVEKFNDCF 921
            MIVKFIFCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIPKKYMYNEKLVEKFNDCF
Sbjct:    1 MIVKFIFCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKIGNLAIPKKYMYNEKLVEKFNDCF 287          
BLAST of Transmembrane protease serine vs. Planmine SMEST
Match: SMESG000044335.1 (SMESG000044335.1)

HSP 1 Score: 139.043 bits (349), Expect = 5.490e-38
Identity = 85/255 (33.33%), Postives = 136/255 (53.33%), Query Frame = 1
Query:  103 LATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVG--SDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQ-VKPIDLINLSEKIVESSCLVYGFGSTVK--DWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVC----TNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFIT 840
            ++ G    + GG  +   + PW   I      HCGG++I+  W+++AAHC + ++  P++ W+I  G    ++   + + ++ K++I H  F      +DIALI+LE  +    + V PI L N  E   +  C + G+G T    +  S+ L    +P+I+   C   +C  +S      +Y+ N+CAG  +G  DAC GDSGG +VC     N  K+ VL G+VS+G GCG  + P +Y  +SSYLDWI + T
Sbjct:   88 ISNGSKYKVFGGWRSMPGEWPWQVQIEREGAHHCGGALIHPNWVVTAAHCTFFFQDLPIEKWRIRAGKTQTNMTEPHEQNVRVKKLIDHPGFTLFTKYHDIALIQLEDPMYFDYKFVSPICLPNPQESFDDHVCTLSGYGKTESSGEGASTYLLEVNLPIISADTCQEKHCNSNS------IYEENLCAGFKEGKRDACTGDSGGPIVCEKLSVNGFKQFVLAGVVSYGSGCGGKDTPGVYTRISSYLDWIEYET 336          
BLAST of Transmembrane protease serine vs. Planmine SMEST
Match: SMESG000002831.1 (SMESG000002831.1)

HSP 1 Score: 129.028 bits (323), Expect = 9.694e-34
Identity = 82/236 (34.75%), Postives = 122/236 (51.69%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDL--KNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWI 828
            I GG  AR    PW  ++ + D + CGGS++N KWI++AAHC    R  P   W +  G   L   ++N++  + +++I +E +      NDIA+++L G + L   V+P+  I  S     + C + G+G T        LK  +VP+I+   C + Y           +    ICAG   GG D+C+GDSGG LVC  + K Q L+GI S G GC  P +P +Y   S YL W+
Sbjct:  196 IVGGIVAREGSWPWQVSLRNSDGVLCGGSIVNSKWIVTAAHCVEG-RSSPQ-TWTVHAGRFTLNGNDRNLQVNRVEKVIKNENYRSENNENDIAMMKLSGILRLNDYVEPV-CIGTSVPRDNAECYITGWGVTHGTGGDGYLKQAKVPIIDQNTCQSWY--------GNSLSDGMICAGYENGGTDSCQGDSGGPLVCRINSKFQ-LIGITSWGMGCAEPRQPGVYTAASKYLQWM 419          
BLAST of Transmembrane protease serine vs. Planmine SMEST
Match: SMESG000004375.1 (SMESG000004375.1)

HSP 1 Score: 129.798 bits (325), Expect = 4.905e-33
Identity = 83/242 (34.30%), Postives = 127/242 (52.48%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIMSGDNIHCGGSVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGFGSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGNLKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVSSYLDWISFITQRKI 852
            I GG++A     PW  ++  G    CGGS+I E ++L+AAHCF     +P D++ I +G   L    V+ +  ++I +H  +       D+A+++L+    L + ++ + +    E I    C++ G+GST        LK   VP++    C  LY     TN++       +CAG   GG D+C GDSGG LVC   KK ++  GIVS G GC LPNRP +Y N+  ++DWI  I  R +
Sbjct:  273 IVGGSEANPGSWPWMISLKYGPLHMCGGSLIAEDFVLTAAHCFI-MDSNP-DYYNIDLGRYFLYKGLVENIAVEKIFLHPSYKIETQDFDLAIVKLKRKAKLTASIQTVCIPRDKEPIAGKKCVILGWGSTQGTGGEGVLKQAVVPIVERNVCNELYGN-IITNQM-------LCAGYKTGGIDSCSGDSGGPLVCKTEKKFEIY-GIVSFGQGCALPNRPGVYTNIVRFVDWIDKIIGRNL 503          
BLAST of Transmembrane protease serine vs. Planmine SMEST
Match: SMESG000055023.1 (SMESG000055023.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.450e-29
Identity = 88/261 (33.72%), Postives = 133/261 (50.96%), Query Frame = 1
Query:  127 IAGGNDARIEDAPWHAAIM----SGDNIH-CGGSVINEKWILSAAHCFYNYRWHPM-----DHWKIIVGSDDLKNKNVKFL--KPKQIIIHEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKI-VESSCLVYGFGSTVKD--WWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNI-----CAGNLKGGDDACEGDSGGGLVCTNSKKRQVLV-GIVSHGDGCGLPNRPTMYANVSSYLDWISFITQR 846
            I GG   +  + PW  ++M     G  IH CGG++I+ +W+L+AAHCF  +  +P      + W + VG  D+  +++  +  + ++I IH K      SNDIAL++L+  I L        L NL E   +   C   G+G   ++    S+ L+   VP++  R C   Y       ++ P Y  +I     CAG  +GG DAC+ DSGG L+C   K  Q LV GI+S G GCG    P +Y  V S++ WI  IT++
Sbjct:   55 IVGGVTTKQGEWPWLVSLMVRLKPGLKIHLCGGTLISRQWVLTAAHCFEPHEKYPTLSTNPEIWTVRVGEHDMLKQDIPHVDVEVQKIYIHYKRTDT-NSNDIALMKLKNPITLTEYANAACLPNLDENPKIREICFAAGWGHKNENDTAISTILQHVAVPIVANRDCNLNYG--QLRTQLGPQYALDIEDTMVCAGVDEGGKDACQFDSGGPLMC--KKNNQWLVSGIISFGFGCGKAYYPGIYTRVPSFISWIQNITKK 310          
The following BLAST results are available for this feature:
BLAST of Transmembrane protease serine vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRSS331.241e-3734.57serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30... [more]
PRSS331.241e-3734.57serine protease 33 [Source:HGNC Symbol;Acc:HGNC:30... [more]
TMPRSS11D1.227e-3635.98transmembrane serine protease 11D [Source:HGNC Sym... [more]
TMPRSS11E4.640e-3533.88transmembrane serine protease 11E [Source:HGNC Sym... [more]
TMPRSS11E4.985e-3533.88transmembrane serine protease 11E [Source:HGNC Sym... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
svh-19.983e-2730.56HGF/MSP/plasminogen-like protein [Source:UniProtK... [more]
try-11.917e-2431.15TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-34.043e-1630.59TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
try-31.117e-1428.70TRYpsin-like protease [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG319543.687e-3433.75gene:FBgn0051954 transcript:FBtr0077563[more]
CG49147.106e-3231.97gene:FBgn0036436 transcript:FBtr0075712[more]
CG60418.027e-3233.73gene:FBgn0029826 transcript:FBtr0070861[more]
CG33558.805e-3132.52gene:FBgn0031619 transcript:FBtr0077376[more]
CG327551.006e-3032.14gene:FBgn0052755 transcript:FBtr0070862[more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR352265.11.178e-3632.28pep chromosome:GRCz11:24:21813127:21819010:-1 gene... [more]
tmprss121.997e-3531.88transmembrane serine protease 12 [Source:ZFIN;Acc:... [more]
zgc:1715097.677e-3533.46zgc:171509 [Source:ZFIN;Acc:ZDB-GENE-080219-48][more]
tmprss51.406e-3432.81transmembrane serine protease 5 [Source:ZFIN;Acc:Z... [more]
tmprss51.894e-3432.80transmembrane serine protease 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdap24.060e-4436.59ganglioside induced differentiation associated pro... [more]
gdap25.321e-4436.59ganglioside induced differentiation associated pro... [more]
ENSXETT00000015760.11.237e-4335.80serine protease 27-like [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000015817.15.033e-4335.77serine protease 27-like [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000031071.19.220e-4335.77serine protease 27-like [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prss85.576e-3735.00protease, serine 8 (prostasin) [Source:MGI Symbol;... [more]
Prss85.576e-3735.00protease, serine 8 (prostasin) [Source:MGI Symbol;... [more]
Prss527.258e-3736.96protease, serine 52 [Source:MGI Symbol;Acc:MGI:192... [more]
Tmprss11c1.170e-3537.13transmembrane protease, serine 11c [Source:MGI Sym... [more]
Tmprss11c1.435e-3537.13transmembrane protease, serine 11c [Source:MGI Sym... [more]
back to top
BLAST of Transmembrane protease serine vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9N2D1|TRYT_PIG2.497e-3835.46Tryptase OS=Sus scrofa OX=9823 GN=MCT7 PE=2 SV=1[more]
sp|Q8NF86|PRS33_HUMAN5.962e-3734.57Serine protease 33 OS=Homo sapiens OX=9606 GN=PRSS... [more]
sp|Q9D9M0|PRS52_MOUSE5.077e-3636.96Serine protease 52 OS=Mus musculus OX=10090 GN=Prs... [more]
sp|O60235|TM11D_HUMAN5.892e-3635.98Transmembrane protease serine 11D OS=Homo sapiens ... [more]
sp|Q9ESD1|PRSS8_MOUSE1.714e-3534.58Prostasin OS=Mus musculus OX=10090 GN=Prss8 PE=2 S... [more]
back to top
BLAST of Transmembrane protease serine vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3J6J16.376e-4136.59Ganglioside induced differentiation associated pro... [more]
A0A5G3J6I88.355e-4136.59Ganglioside induced differentiation associated pro... [more]
F6YNH11.942e-4035.80Peptidase S1 domain-containing protein OS=Xenopus ... [more]
A0A267EPX73.109e-4036.00Peptidase S1 domain-containing protein OS=Macrosto... [more]
A0A267H9B24.131e-4036.00Peptidase S1 domain-containing protein OS=Macrosto... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033802.12.343e-3832.14pep primary_assembly:Astyanax_mexicanus-2.0:3:2189... [more]
ENSAMXT00000049166.17.235e-3633.33serine protease 56 [Source:NCBI gene;Acc:103021696... [more]
zgc:1008682.463e-3533.83transmembrane protease serine 9-like [Source:NCBI ... [more]
tmprss13b2.705e-3535.12transmembrane protease serine 13-like [Source:NCBI... [more]
tmprss13b4.325e-3535.12transmembrane protease serine 13-like [Source:NCBI... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
f103.804e-3634.62coagulation factor X [Source:ZFIN;Acc:ZDB-GENE-021... [more]
ENSPMAT00000001315.17.510e-3534.40pep scaffold:Pmarinus_7.0:GL479305:249343:254401:-... [more]
tmprss3a5.308e-3431.68transmembrane serine protease 3a [Source:ZFIN;Acc:... [more]
ENSPMAT00000006641.12.074e-2929.88pep scaffold:Pmarinus_7.0:GL487373:2056:5756:-1 ge... [more]
ENSPMAT00000007992.11.951e-2831.02pep scaffold:Pmarinus_7.0:GL479522:6599:9454:1 gen... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protease serine vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478361.112e-3133.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NVMASP1.699e-3133.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476643.149e-3132.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348071.119e-3033.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396664.171e-3033.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transmembrane protease serine vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000010945.21.965e-4034.13pep primary_assembly:ASM223467v1:20:17371788:17374... [more]
ENSORLT00000028221.18.370e-3634.09tryptase [Source:NCBI gene;Acc:101156896][more]
ENSORLT00000028466.19.968e-3634.09tryptase [Source:NCBI gene;Acc:101156896][more]
tmprss51.445e-3535.10transmembrane serine protease 5 [Source:NCBI gene;... [more]
si:dkey-32n7.72.516e-3532.87si:dkey-32n7.7 [Source:ZFIN;Acc:ZDB-GENE-121214-17... [more]
back to top
BLAST of Transmembrane protease serine vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025034.10.000e+0100.00SMESG000025034.1[more]
SMESG000044335.15.490e-3833.33SMESG000044335.1[more]
SMESG000002831.19.694e-3434.75SMESG000002831.1[more]
SMESG000004375.14.905e-3334.30SMESG000004375.1[more]
SMESG000055023.11.450e-2933.72SMESG000055023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006211 ID=SMED30006211|Name=Transmembrane protease serine|organism=Schmidtea mediterranea sexual|type=transcript|length=984bp
ATTTGTTATAAATACCACATGACAATGCCTCTTGAGTAGACGTTTGGTAT
ACAACTTGAAATGATAGTAAAATTCATTTTTTGTGTCGTTCACATCGGCA
TTTTAGCAACGGGTAAAGTTGCATTTATAGCTGGAGGAAATGATGCCAGA
ATTGAGGATGCACCGTGGCATGCGGCAATAATGTCTGGAGATAATATCCA
TTGTGGCGGCTCTGTAATTAATGAAAAATGGATTCTTTCAGCTGCCCATT
GCTTTTACAATTACAGATGGCACCCGATGGATCATTGGAAGATTATTGTC
GGAAGTGATGATTTGAAAAACAAAAATGTAAAATTCTTGAAACCGAAACA
GATAATTATTCATGAAAAATTCGACAAACCGTTTTATTCCAATGACATTG
CTCTCATAGAATTGGAGGGGGGCATTAATTTAAAATCACAAGTGAAACCA
ATTGATTTGATAAATCTTTCCGAAAAAATTGTGGAATCTTCGTGTTTAGT
CTATGGATTCGGATCCACTGTTAAAGATTGGTGGAGTAGCACTTTGAAAG
TAGGTCAAGTTCCAGTGATTAATGGTCGGAAATGCGGTACACTTTATTGC
GTGCCATCATCTACCAATGAAATTCGACCCGTTTATAAGTCAAATATTTG
TGCTGGAAATCTTAAAGGAGGAGATGATGCGTGCGAAGGTGATAGTGGAG
GAGGACTTGTTTGCACAAATTCAAAAAAAAGACAAGTGCTTGTCGGAATT
GTCTCACATGGAGACGGCTGTGGATTACCAAACAGACCAACAATGTACGC
AAATGTGTCATCTTATCTTGATTGGATTTCTTTTATCACGCAAAGGAAAA
TTGGAAATCTAGCGATTCCGAAAAAATATATGTACAATGAAAAACTTGTA
GAAAAATTTAATGACTGTTTTTAACAGACAGCGGATAAAGAAATGGGACC
ATTAAAATGCACTATTTAATTATTCATTTGTTTT
back to top

protein sequence of SMED30006211-orf-1

>SMED30006211-orf-1 ID=SMED30006211-orf-1|Name=SMED30006211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=288bp
MIVKFIFCVVHIGILATGKVAFIAGGNDARIEDAPWHAAIMSGDNIHCGG
SVINEKWILSAAHCFYNYRWHPMDHWKIIVGSDDLKNKNVKFLKPKQIII
HEKFDKPFYSNDIALIELEGGINLKSQVKPIDLINLSEKIVESSCLVYGF
GSTVKDWWSSTLKVGQVPVINGRKCGTLYCVPSSTNEIRPVYKSNICAGN
LKGGDDACEGDSGGGLVCTNSKKRQVLVGIVSHGDGCGLPNRPTMYANVS
SYLDWISFITQRKIGNLAIPKKYMYNEKLVEKFNDCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000105secretory cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001314Peptidase_S1A
IPR001254Trypsin_dom
IPR018114TRYPSIN_HIS
IPR009003Peptidase_S1_PA
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001314Peptidase S1A, chymotrypsin familyPRINTSPR00722CHYMOTRYPSINcoord: 205..217
score: 61.35
coord: 49..64
score: 54.64
coord: 108..122
score: 35.5
IPR001254Serine proteases, trypsin domainSMARTSM00020trypsin_2coord: 22..256
e-value: 4.0E-68
score: 242.3
IPR001254Serine proteases, trypsin domainPFAMPF00089Trypsincoord: 23..256
e-value: 1.8E-54
score: 184.9
IPR001254Serine proteases, trypsin domainPROSITEPS50240TRYPSIN_DOMcoord: 23..261
score: 30.599
IPR001254Serine proteases, trypsin domainCDDcd00190Tryp_SPccoord: 23..259
e-value: 5.32753E-72
score: 219.455
NoneNo IPR availableGENE3DG3DSA:2.40.10.10coord: 18..261
e-value: 4.0E-65
score: 221.6
NoneNo IPR availablePANTHERPTHR24253:SF60coord: 23..274
NoneNo IPR availablePANTHERPTHR24253FAMILY NOT NAMEDcoord: 23..274
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.604
IPR018114Serine proteases, trypsin family, histidine active sitePROSITEPS00134TRYPSIN_HIScoord: 59..64
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 7..260