polyadenylate-binding protein 2

Overview
Namepolyadenylate-binding protein 2 (AHY82409.1)
Smed IDSMED30006209
Length (bp)886
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of polyadenylate-binding protein 2 (SMED30006209) t-SNE clustered cells

Violin plots show distribution of expression levels for polyadenylate-binding protein 2 (SMED30006209) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of polyadenylate-binding protein 2 (SMED30006209) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for polyadenylate-binding protein 2 (SMED30006209) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006209

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006209SMESG000011330.1 Contig6399newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006209SMESG000011330.1 Contig6399uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30006209SMESG000011330.1 SmedASXL_003291SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006209SMESG000011330.1 SmedASXL_003291SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30006209SMESG000011330.1 dd_Smed_v4_2924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30006209SMESG000011330.1 dd_Smed_v4_2924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30006209SMESG000011330.1 dd_Smed_v4_2924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Match: PABPN1 (poly(A) binding protein nuclear 1 [Source:HGNC Symbol;Acc:HGNC:8565])

HSP 1 Score: 148.673 bits (374), Expect = 7.833e-44
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:   30 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 129          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Match: PABPN1 (poly(A) binding protein nuclear 1 [Source:HGNC Symbol;Acc:HGNC:8565])

HSP 1 Score: 148.673 bits (374), Expect = 1.178e-43
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:   30 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 129          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Match: BCL2L2-PABPN1 (BCL2L2-PABPN1 readthrough [Source:HGNC Symbol;Acc:HGNC:42959])

HSP 1 Score: 149.443 bits (376), Expect = 3.716e-42
Identity = 67/101 (66.34%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:  185 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTD 285          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Match: BCL2L2-PABPN1 (BCL2L2-PABPN1 readthrough [Source:HGNC Symbol;Acc:HGNC:42959])

HSP 1 Score: 149.443 bits (376), Expect = 3.716e-42
Identity = 67/101 (66.34%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:  185 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTD 285          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Match: PABPN1 (poly(A) binding protein nuclear 1 [Source:HGNC Symbol;Acc:HGNC:8565])

HSP 1 Score: 148.288 bits (373), Expect = 3.869e-42
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:  158 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 257          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Match: pabp-2 (PolyA Binding Protein (Nuclear) [Source:UniProtKB/TrEMBL;Acc:Q93233])

HSP 1 Score: 133.65 bits (335), Expect = 4.952e-38
Identity = 57/97 (58.76%), Postives = 76/97 (78.35%), Query Frame = 3
Query:  288 TDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            T +EKAE D +S+YVGNVDYG+TA+E+E HF GCG+++R+TI  ++++GHPKGFAY+EF   + +  A+ + DS  R RQIKV PKRTN PG STTN
Sbjct:   68 TPEEKAEADAKSVYVGNVDYGATAEEIEQHFHGCGSVSRVTIQCDRFSGHPKGFAYVEFTEKEGMQNALAMTDSLLRGRQIKVDPKRTNKPGMSTTN 164          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Match: EEED8.12 (Putative RNA-binding protein EEED8.12 [Source:UniProtKB/Swiss-Prot;Acc:Q09301])

HSP 1 Score: 106.686 bits (265), Expect = 9.232e-28
Identity = 59/155 (38.06%), Postives = 92/155 (59.35%), Query Frame = 3
Query:   99 SDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPG 563
            +D+N   E S   EM+ E  S+ L ++ N      + ++++S+ +              PP  T++E+  +D +S+++GNVD+ ST +E+E HFKGCG I R TI  +K+T   K FAYIEF    S++ A++++ S FRSR I V  KRTN+PG
Sbjct:    8 ADNNCNEESSNSFEMEIEAESAILEQIQN-----KMAKNLESAAY-------------VPP--TEEEQKAIDAKSVFIGNVDFNSTIEEVEEHFKGCGHIVRTTIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGSLFRSRPIVVTAKRTNIPG 142          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Match: EEED8.4 (Putative RNA-binding protein EEED8.4 [Source:UniProtKB/Swiss-Prot;Acc:Q09295])

HSP 1 Score: 104.76 bits (260), Expect = 3.960e-27
Identity = 55/143 (38.46%), Postives = 86/143 (60.14%), Query Frame = 3
Query:  135 LEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPG 563
             EM+ E  S+ L ++ N      + +H++S+ +              PP  T++E+  +D +S+++GNVD+ ST +E+E HFKGCG I + TI  +K+T   K FAYIEF    S++ A++++ S FRSR I V  KRTN+PG
Sbjct:   14 FEMEIEAESAILQQIQN-----KMAKHLESAAY-------------VPP--TEEEQKAIDAKSVFIGNVDFNSTIEEIEEHFKGCGQIVKTTIPKDKFTKKQKNFAYIEFDDSSSIENALVMNGSLFRSRPIVVTAKRTNIPG 136          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Match: sgnh-1 (SGN1 Homolog [Source:UniProtKB/TrEMBL;Acc:O44530])

HSP 1 Score: 102.449 bits (254), Expect = 1.954e-26
Identity = 47/98 (47.96%), Postives = 66/98 (67.35%), Query Frame = 3
Query:  282 ALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            A T +E+ + D RS+YVGNVD+ ST  E+E HF  CG + R+TI  +K+TG+ K FA++EF   +SV  A++L  + FR+R+I V  KRTN PG   T
Sbjct:   34 APTAEEQEKTDARSVYVGNVDWKSTVSEIEEHFAVCGKVARVTIPKDKFTGYQKNFAFVEFQKLESVQLALVLSGTMFRNRKIMVTLKRTNKPGMGRT 131          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Match: rbm-3.1 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45712])

HSP 1 Score: 60.4622 bits (145), Expect = 7.505e-12
Identity = 29/73 (39.73%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  321 SIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAM-LLDDSEFRSRQIKV 536
            S+YVGN  + +T +EL   F   G IN + I+ ++ TG P+GFA+IEFA   S   A+  ++ +EF  R ++V
Sbjct:    6 SVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAEFNGRPLRV 78          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Match: Pabp2 (gene:FBgn0005648 transcript:FBtr0088785)

HSP 1 Score: 150.599 bits (379), Expect = 3.748e-44
Identity = 76/174 (43.68%), Postives = 111/174 (63.79%), Query Frame = 3
Query:   63 KFMNMVDSLNDSSDDNFVSEISKD--LEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + +  ++  N   +    +E+ ++  +++D E  + K    +   + + + Q +QS V  +        L + P +L  +EK E+D RS+YVGNVDYG++A+ELEAHF GCG INR+TIL NK  GHPKGFAYIEF   + V+TA+ ++++ FR RQIKVM KRTN PG STTN
Sbjct:   12 QLLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQ-MQSEVDKQMAGGSTTGLATVPLSL--EEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTN 182          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Match: Pabp2 (gene:FBgn0005648 transcript:FBtr0088786)

HSP 1 Score: 150.599 bits (379), Expect = 3.748e-44
Identity = 76/174 (43.68%), Postives = 111/174 (63.79%), Query Frame = 3
Query:   63 KFMNMVDSLNDSSDDNFVSEISKD--LEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + +  ++  N   +    +E+ ++  +++D E  + K    +   + + + Q +QS V  +        L + P +L  +EK E+D RS+YVGNVDYG++A+ELEAHF GCG INR+TIL NK  GHPKGFAYIEF   + V+TA+ ++++ FR RQIKVM KRTN PG STTN
Sbjct:   12 QLLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQ-MQSEVDKQMAGGSTTGLATVPLSL--EEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTN 182          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082854)

HSP 1 Score: 52.7582 bits (125), Expect = 1.331e-7
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  312 DVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKR 548
            D R ++VG + + +T KEL  HF   G I  I + T+  TG  +GFA+I F   +++D     D+    S+  KV PK+
Sbjct:   54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSK--KVDPKK 130          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0309094)

HSP 1 Score: 52.373 bits (124), Expect = 1.538e-7
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  312 DVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKR 548
            D R ++VG + + +T KEL  HF   G I  I + T+  TG  +GFA+I F   +++D     D+    S+  KV PK+
Sbjct:   54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSK--KVDPKK 130          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082856)

HSP 1 Score: 52.373 bits (124), Expect = 1.538e-7
Identity = 28/79 (35.44%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  312 DVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKR 548
            D R ++VG + + +T KEL  HF   G I  I + T+  TG  +GFA+I F   +++D     D+    S+  KV PK+
Sbjct:   54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSK--KVDPKK 130          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 149.443 bits (376), Expect = 1.142e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPAGPVIMSIEEKIEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 149.058 bits (375), Expect = 1.610e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   22 SPPPAGPVIMSIEEKIEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 128          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 149.058 bits (375), Expect = 2.592e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPAGPVIMSIEEKIEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 149.058 bits (375), Expect = 7.692e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPAGPVIMSIEEKIEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Match: pabpn1l (PABPN1 like, cytoplasmic [Source:ZFIN;Acc:ZDB-GENE-080709-5])

HSP 1 Score: 135.191 bits (339), Expect = 6.376e-39
Identity = 62/98 (63.27%), Postives = 79/98 (80.61%), Query Frame = 3
Query:  285 LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            +T +E+ + D RSIYVGNVDYG+TA ELE +F  CG +NR+TI  N++TGHPKGFAYIEF+  +SV TAM LD++ FR R IKV PKRTN+PG+STT+
Sbjct:   26 MTHEERIDSDRRSIYVGNVDYGATADELEMYFNSCGHVNRVTIPYNRFTGHPKGFAYIEFSDRESVRTAMALDETLFRGRVIKVSPKRTNIPGFSTTD 123          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Match: pabpn1l (poly(A) binding protein, nuclear 1-like (cytoplasmic) [Source:NCBI gene;Acc:549106])

HSP 1 Score: 149.058 bits (375), Expect = 2.143e-43
Identity = 69/117 (58.97%), Postives = 89/117 (76.07%), Query Frame = 3
Query:  228 VHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            +H K     Y   E  P  L+ +EK E+D RS+YVGNVDYG TA++LEAHF  CG+INRITIL +K++GHPKG+AYIEFA  +SVD A+ +D++ FR R IKV+PKRTN+PG STT+
Sbjct:   65 IHSKMTAGAY--TEGPPRPLSAEEKKEIDKRSVYVGNVDYGGTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDVAVAMDETVFRGRTIKVLPKRTNMPGISTTD 179          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Match: ccdc113 (coiled-coil domain containing 113 [Source:Xenbase;Acc:XB-GENE-941142])

HSP 1 Score: 150.599 bits (379), Expect = 4.501e-43
Identity = 69/101 (68.32%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:  149 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVVPKRTNRPGISTTD 249          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Match: ccdc113 (coiled-coil domain containing 113 [Source:Xenbase;Acc:XB-GENE-941142])

HSP 1 Score: 103.219 bits (256), Expect = 2.531e-25
Identity = 54/101 (53.47%), Postives = 67/101 (66.34%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKG     F      +  M        S   +V+PKRTN PG STT+
Sbjct:  149 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKG----PFTFHRCCNICM--------SFYKQVVPKRTNRPGISTTD 237          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Match: rbm34 (RNA binding motif protein 34 [Source:NCBI gene;Acc:448232])

HSP 1 Score: 61.2326 bits (147), Expect = 4.195e-10
Identity = 29/87 (33.33%), Postives = 47/87 (54.02%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            RS ++GN+ Y    + +  HF  CG +  + I+ ++ TG  KGF Y+ F   D+V  A+ L++SE   R+I+V    T      +TN
Sbjct:  271 RSAFIGNLPYEIEEEAVRDHFSECGKVQGVRIIRDQKTGIGKGFGYVLFESADAVQLALKLNNSELSGRKIRVKRSLTAEAAQKSTN 357          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Match: tada2a (transcriptional adaptor 2A [Source:Xenbase;Acc:XB-GENE-946815])

HSP 1 Score: 46.9802 bits (110), Expect = 3.431e-6
Identity = 24/72 (33.33%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTA 491
            PPA   D   +LD   ++VG +      K+L+  F+  G I  +T+L ++YTG  KG A++ +   DS   A
Sbjct:   33 PPAQQSDSMKDLDAIKLFVGQIPRNLEEKDLKPLFEQFGKIYELTVLKDRYTGMHKGCAFLTYCARDSAIKA 104          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Match: Pabpn1 (poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158])

HSP 1 Score: 149.058 bits (375), Expect = 3.130e-44
Identity = 67/101 (66.34%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:   58 PVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTD 158          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Match: Pabpn1 (poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158])

HSP 1 Score: 148.673 bits (374), Expect = 6.054e-44
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:   30 PVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 129          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Match: Pabpn1 (poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158])

HSP 1 Score: 148.673 bits (374), Expect = 6.054e-44
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:   30 PVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 129          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Match: Pabpn1 (poly(A) binding protein, nuclear 1 [Source:MGI Symbol;Acc:MGI:1859158])

HSP 1 Score: 148.288 bits (373), Expect = 1.047e-43
Identity = 67/100 (67.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT
Sbjct:   30 PVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTT 129          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Match: Gm20521 (predicted gene 20521 [Source:MGI Symbol;Acc:MGI:5141986])

HSP 1 Score: 148.673 bits (374), Expect = 4.240e-42
Identity = 67/101 (66.34%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K++GHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:  185 PVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTD 285          
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Match: sp|Q7KNF2|PABP2_DROME (Polyadenylate-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Pabp2 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.757e-43
Identity = 76/174 (43.68%), Postives = 111/174 (63.79%), Query Frame = 3
Query:   63 KFMNMVDSLNDSSDDNFVSEISKD--LEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + +  ++  N   +    +E+ ++  +++D E  + K    +   + + + Q +QS V  +        L + P +L  +EK E+D RS+YVGNVDYG++A+ELEAHF GCG INR+TIL NK  GHPKGFAYIEF   + V+TA+ ++++ FR RQIKVM KRTN PG STTN
Sbjct:   12 QLLESLEETNGEQETEIATEVEEEGSMQIDPELEAIKARVKEMEEEAEKIKQ-MQSEVDKQMAGGSTTGLATVPLSL--EEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTN 182          
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Match: sp|Q6TY21|EPA2B_XENLA (Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis OX=8355 GN=Pabpn1l-b PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.020e-42
Identity = 69/118 (58.47%), Postives = 90/118 (76.27%), Query Frame = 3
Query:  225 SVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + H K     Y   E  P  L+ +EK E+D RS+YVGNVDYGSTA++LEAHF  CG+INRITIL +K++GHPKG+AYIEFA  +SVD A+ +D++ FR R IKV+PKRTN+PG S+T+
Sbjct:   64 TTHSKMTAGAY--TEGPPQPLSAEEKKEIDKRSVYVGNVDYGSTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVAMDETVFRGRTIKVLPKRTNMPGISSTD 179          
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Match: sp|Q28ZX3|PABP2_DROPS (Polyadenylate-binding protein 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Pabp2 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.015e-42
Identity = 70/123 (56.91%), Postives = 89/123 (72.36%), Query Frame = 3
Query:  210 QHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + +QS V  +        L + P +L  +EK E+D RS+YVGNVDYG++A+ELEAHF GCG INR+TIL NK  GHPKGFAYIEF   + V+TA+ ++++ FR RQIKVM KRTN PG STTN
Sbjct:   62 KQMQSEVDKQMAGGSTTGLAAVPLSL--EEKQEIDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMNETLFRGRQIKVMSKRTNRPGLSTTN 182          
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Match: sp|Q6NVP7|PABP2_XENTR (Polyadenylate-binding protein 2 OS=Xenopus tropicalis OX=8364 GN=pabpn1 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 2.385e-42
Identity = 69/101 (68.32%), Postives = 85/101 (84.16%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKGFAYIEF+  +SV T++ LD+S FR RQIKV+PKRTN PG STT+
Sbjct:  149 PVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVVPKRTNRPGISTTD 249          
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Match: sp|Q804A5|EPA2A_XENLA (Embryonic polyadenylate-binding protein 2-A OS=Xenopus laevis OX=8355 GN=Pabpn1l-a PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 3.179e-42
Identity = 68/117 (58.12%), Postives = 90/117 (76.92%), Query Frame = 3
Query:  228 VHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            +H K    +Y   E  P  L+ +EK E+D RS+YVGNVDYG TA++LEAHF  CG+INRITIL +K++GHPKG+AYIEFA  +SVD A+ +D++ FR R IKV+PKRTN+PG S+T+
Sbjct:   65 IHSKMTAGEY--TEGPPRPLSAEEKKEIDKRSVYVGNVDYGGTAQDLEAHFSSCGSINRITILCDKFSGHPKGYAYIEFAERNSVDAAVTMDETVFRGRTIKVLPKRTNMPGISSTD 179          
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Match: A0A023ZS93 (Polyadenylate-binding protein 2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 5.491e-115
Identity = 200/210 (95.24%), Postives = 202/210 (96.19%), Query Frame = 3
Query:   69 MNMVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNXXXXXXXXXXXXXXXFHPVIXXXXXXXXXXXXXSYHYAPY 698
            MNMVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPK +       +SYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY
Sbjct:    1 MNMVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKGVNS-----KSYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY 205          
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Match: A0A5K3F8S8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 9.011e-48
Identity = 88/173 (50.87%), Postives = 116/173 (67.05%), Query Frame = 3
Query:   75 MVDSLNDSSDDNFVSEISKD-------LEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYST 572
            M D +++  +D FV E SKD       L+M+ E    +  E++   +D N   H+++S  P          +S    L+D+EKAE+D+RSIYVGNVDYGSTA ELEAHF+ CGAINR+TIL ++YTGHPKGFAYIEF   D+++ A+ LDDS FR R +KVMPKRTN+PG S 
Sbjct:    5 MFDGVHEGDNDEFVDEASKDESLTSEALDMELEMIKERFKEIE---EDANKLHHLKNSEKPSN--------KSNTSVLSDEEKAEVDLRSIYVGNVDYGSTADELEAHFRCCGAINRVTILCDRYTGHPKGFAYIEFENADAIEAAVALDDSNFRGRPLKVMPKRTNIPGLSV 166          
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Match: A0A183S8S6 (RRM domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS624 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 9.287e-48
Identity = 85/176 (48.30%), Postives = 119/176 (67.61%), Query Frame = 3
Query:   75 MVDSLNDSSDDNFVSEISKD-------LEMDNEYASSKLLELDNTVDD-DNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            ++D++++   D FV E SK+        E D E    +L E++   +   N+  +++ S      +     LES    ++++EKAE+D+RSIYVGNVDYGSTA+ELEAHF+ CGAINR+TIL ++YTGHPKGFAYIEF   D+++ A+ LDDS FR R +KVMPKRTNLPG S ++
Sbjct:    5 VIDAVHEGDQDEFVEEASKEESINSDTFEADIEAMKERLKEMEADANKLHNISSNVERSSASALPLRILSFLESNVSVVSEEEKAEVDLRSIYVGNVDYGSTAEELEAHFRCCGAINRVTILCDRYTGHPKGFAYIEFESEDAIEAAVALDDSNFRGRPLKVMPKRTNLPGLSNSS 180          
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Match: A0A183WXB0 (RRM domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS16763 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 9.927e-48
Identity = 75/114 (65.79%), Postives = 92/114 (80.70%), Query Frame = 3
Query:  237 KAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            + +ID     +S    L+D++K E+D+RS+YVGNVDYGSTA ELEAHF+GCG INR+TIL NK+TGHPKGFAYIEF   D+V+ AM LDDS FRSRQ+KV+PKRTN+PG S TN
Sbjct:   56 RRVIDKSPVAKSNNSVLSDEDKTEVDLRSVYVGNVDYGSTADELEAHFRGCGPINRVTILCNKFTGHPKGFAYIEFDTRDAVEAAMALDDSSFRSRQLKVLPKRTNVPGMSLTN 169          
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Match: A0A183QFQ4 (RRM domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 2.772e-47
Identity = 103/206 (50.00%), Postives = 135/206 (65.53%), Query Frame = 3
Query:  114 VSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSS---------VHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNX--XXXXXXXXXXXXXXFHPVIXXXXXXXXXXXXXSYHYAPY 698
            + E  K++E D    ++KL +L   +D   +  H++ +            KA  + +   ES    L+D++K E+D+RS+YVGNVDYGSTA ELEAHF+GCG INR+TIL NK+TGHPKGFAYIEF   D+V+ A+ LDDS FRSRQ+KV+PKRTN+PG S TNR    R    GR M   F P   GR R  R+RRRGSY+++PY
Sbjct:   41 IKERFKEIEAD----ANKLHDLRRVIDKSPISNHLERAPLVSRLCYEESEKAFRNLFSAAESNNSNLSDEDKTEVDLRSVYVGNVDYGSTADELEAHFRGCGPINRVTILCNKFTGHPKGFAYIEFDTRDAVEAAIALDDSSFRSRQLKVLPKRTNVPGMSMTNRPPFVRGRARGRGMSIGFRPAYAGRMRFPRYRRRGSYYFSPY 242          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 148.673 bits (374), Expect = 5.537e-44
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   22 SPPPAGPVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 128          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 149.058 bits (375), Expect = 2.051e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPAGPVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 148.673 bits (374), Expect = 5.293e-43
Identity = 73/107 (68.22%), Postives = 86/107 (80.37%), Query Frame = 3
Query:  270 SYPPA----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PPA    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPAGPVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Match: PABPN1L (PABPN1 like, cytoplasmic [Source:HGNC Symbol;Acc:HGNC:37237])

HSP 1 Score: 143.665 bits (361), Expect = 4.544e-41
Identity = 64/97 (65.98%), Postives = 80/97 (82.47%), Query Frame = 3
Query:  285 LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTT 575
            +T +E+ + D RS+YVGNVDYG+TA ELE HF GCG +NR+TIL +K+TGHPKGFAYIEF+  +SV TAM LD++ FR R IKV+PKRTN+PG STT
Sbjct:   60 MTHEERIDADNRSVYVGNVDYGTTADELEIHFNGCGHVNRVTILCDKFTGHPKGFAYIEFSDRESVRTAMALDETLFRGRVIKVLPKRTNMPGISTT 156          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 140.584 bits (353), Expect = 1.296e-39
Identity = 71/106 (66.98%), Postives = 84/106 (79.25%), Query Frame = 3
Query:  270 SYPPA---LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            S PP    ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +K+TGHPK FAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   78 SPPPGPVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFTGHPK-FAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 182          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 151.369 bits (381), Expect = 5.239e-45
Identity = 70/106 (66.04%), Postives = 86/106 (81.13%), Query Frame = 3
Query:  276 PPA-----LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            PPA     ++ +EK E D RSIYVGNVDY +TA+ELEAHF GCG++NR+TIL +K+TGHPKGFAYIEF+  +S+ TAM LDDS FR RQIKV+PKRTN PG S+T+
Sbjct:   79 PPAAGPMIMSFEEKMEADARSIYVGNVDYHATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFSEKESIRTAMALDDSLFRGRQIKVLPKRTNRPGISSTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Match: rbm34 (RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-GENE-040718-77])

HSP 1 Score: 59.6918 bits (143), Expect = 1.554e-10
Identity = 29/94 (30.85%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQI---------KVMPKRTNLPGYST 572
            RS+++GN+ Y      + +HF+ CG +  + ++ ++ +G  KGF YI F   D+V  A+ LD SE   R++         K+ P R   P  S+
Sbjct:  213 RSVFIGNLPYDVEEDRIRSHFEPCGPVESVRVVRDRESGMGKGFGYILFKGTDAVLLALHLDGSEMAGRKVRVKRSVKKEKIKPGRAGRPANSS 306          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Match: snrnp70 (small nuclear ribonucleoprotein 70 (U1) [Source:ZFIN;Acc:ZDB-GENE-040825-2])

HSP 1 Score: 47.7506 bits (112), Expect = 5.152e-7
Identity = 17/49 (34.69%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEF 464
            ++++V  ++Y ++  +L   F+  G I RIT++ NK +G P+G+A+IE+
Sbjct:  103 KTLFVARINYDTSESKLRREFEVYGPIRRITMIYNKVSGKPRGYAFIEY 151          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Match: snrnp70 (small nuclear ribonucleoprotein 70 (U1) [Source:ZFIN;Acc:ZDB-GENE-040825-2])

HSP 1 Score: 47.7506 bits (112), Expect = 5.982e-7
Identity = 17/49 (34.69%), Postives = 34/49 (69.39%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEF 464
            ++++V  ++Y ++  +L   F+  G I RIT++ NK +G P+G+A+IE+
Sbjct:  102 KTLFVARINYDTSESKLRREFEVYGPIRRITMIYNKVSGKPRGYAFIEY 150          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 45.4394 bits (106), Expect = 9.476e-6
Identity = 26/92 (28.26%), Postives = 44/92 (47.83%), Query Frame = 3
Query:  261 CLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKV 536
            C+ S+ P+ +     E D R+++   +     AK+LE  F   G +  + +++++ +   KG AYIEF   DSV  A+ L         I V
Sbjct:  155 CIRSHRPSTSTLTPEERDSRTVFCMQLAARIRAKDLEEFFSAVGKVRDVRLISDRNSRRSKGIAYIEFVDLDSVPLAIGLTGQRLLGVPIIV 246          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Match: SGN1 (Cytoplasmic RNA-binding protein; contains an RNA recognition motif (RRM); may have a role in mRNA translation, as suggested by genetic interactions with genes encoding proteins involved in translational initiation [Source:SGD;Acc:S000001440])

HSP 1 Score: 92.4337 bits (228), Expect = 1.183e-22
Identity = 41/88 (46.59%), Postives = 59/88 (67.05%), Query Frame = 3
Query:  306 ELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYS 569
            E D RSI+VGN+    T +++E HFK CG I RIT+L ++ TG PKG+ YIEF  P   + A+ L+  E + ++I V  KRTN+PG++
Sbjct:   60 EADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKALQLNGGELKGKKIAVSRKRTNIPGFN 147          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Match: NOP12 (Nucleolar protein involved in pre-25S rRNA processing; also involved in biogenesis of large 60S ribosomal subunit; contains an RNA recognition motif (RRM); binds to Ebp2; similar to Nop13p and Nsr1p [Source:SGD;Acc:S000005401])

HSP 1 Score: 60.077 bits (144), Expect = 9.552e-11
Identity = 27/70 (38.57%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQ 527
            RSI+VGN+D+    + L  HF+ CG I  + I+ +  T   KGFAY++F    SV+ A+LL++   +S++
Sbjct:  279 RSIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKALLLNEKPMKSQK 348          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Match: HRB1 (Poly(A+) RNA-binding protein; key surveillance factor for the selective export of spliced mRNAs from the nucleus to the cytoplasm; preference for intron-containing genes; similar to Npl3p; HRB1 has a paralog, GBP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004949])

HSP 1 Score: 46.595 bits (109), Expect = 2.088e-6
Identity = 25/65 (38.46%), Postives = 36/65 (55.38%), Query Frame = 3
Query:  321 SIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEF 515
            SI+VGN+ Y ST ++L   F   G + R  I+T++  GH +G   +EF   D VD A+   D  F
Sbjct:  162 SIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSR--GHHRGMGTVEFTNSDDVDRAIRQYDGAF 224          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Match: CBC2 (Small subunit of the heterodimeric cap binding complex with Sto1p; interacts with Npl3p, possibly to package mRNA for export from the nucleus; may have a role in telomere maintenance; contains an RNA-binding motif [Source:SGD;Acc:S000006099])

HSP 1 Score: 45.0542 bits (105), Expect = 3.483e-6
Identity = 21/73 (28.77%), Postives = 41/73 (56.16%), Query Frame = 3
Query:  321 SIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAM-LLDDSEFRSRQIKV 536
            +IYVGN+ + ++ +++   F  CG I RI +  +++   P GF +I ++ PD    A+  L D++   + I +
Sbjct:   47 TIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKLDEKTITI 119          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 45.0542 bits (105), Expect = 7.937e-6
Identity = 25/82 (30.49%), Postives = 40/82 (48.78%), Query Frame = 3
Query:  249 DDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAM 494
            DD   +   PP+           R ++VGN+ +  T   L  HF+ CG I +I + T + +G  KGFA+I+F   +    A+
Sbjct:  227 DDLVAMSKNPPS-----------RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNAL 297          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Match: EDO46407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPZ7])

HSP 1 Score: 144.436 bits (363), Expect = 7.252e-43
Identity = 67/105 (63.81%), Postives = 85/105 (80.95%), Query Frame = 3
Query:  276 PPAL----TDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            PPA     T +EKAE+D RS+YVGNVDY +TA+ELE HF GCG++NR+TIL +K++GHPKGFAY+EF+  DSVD A+LL DS F+ RQIKV+ KRTN PG S+T+
Sbjct:   22 PPAASGPKTFEEKAEVDARSVYVGNVDYSATAEELEQHFHGCGSVNRVTILCDKFSGHPKGFAYVEFSDKDSVDNAVLLSDSLFKGRQIKVVLKRTNRPGVSSTD 126          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Match: EDO37342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY3])

HSP 1 Score: 54.299 bits (129), Expect = 2.396e-8
Identity = 26/77 (33.77%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  309 LDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAML-LDDSEFRSRQIKV 536
            LD  +++V N+ + +   E+E  F   G + ++ ++TN+  G PKG+ Y+E+    S  TA+L LD +E + R I V
Sbjct:  691 LDKHTLFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNR-AGKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTISV 766          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Match: EDO38117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDQ4])

HSP 1 Score: 54.299 bits (129), Expect = 2.699e-8
Identity = 27/101 (26.73%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  285 LTDDEKAELDVRSIYVGNVDY-------------GSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKR 548
            L  ++KA    RS+++GN+ +                 + L   F  CG +  + ++ ++ TG  KGF Y+ F   D+V  A+ ++++EF+ R+I+V P +
Sbjct:  760 LASNDKAHDHQRSVFIGNLPFVLIQNPKSFVFVPNIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSK 860          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Match: EDO29724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U1])

HSP 1 Score: 49.2914 bits (116), Expect = 5.751e-8
Identity = 22/71 (30.99%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  327 YVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAM-LLDDSEFRSRQIKV 536
            Y+GN+ Y    + LE  F GC  ++ + ++T++ TG P+GF ++ F   + ++ A+   D  +F  R +KV
Sbjct:    8 YIGNLSYSVDEQALEEKFHGCDVVD-VKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKV 77          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Match: EDO35156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMB2])

HSP 1 Score: 48.521 bits (114), Expect = 9.212e-8
Identity = 22/71 (30.99%), Postives = 41/71 (57.75%), Query Frame = 3
Query:  327 YVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAM-LLDDSEFRSRQIKV 536
            Y+GN+ Y    + LE  F GC  ++ + ++T++ TG P+GF ++ F   + ++ A+   D  +F  R +KV
Sbjct:    8 YIGNLSYSVDEQALEEKFHGCDVVD-VKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKV 77          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Match: pabpn1 (poly(A) binding protein nuclear 1 [Source:NCBI gene;Acc:101157012])

HSP 1 Score: 150.214 bits (378), Expect = 8.045e-44
Identity = 71/101 (70.30%), Postives = 83/101 (82.18%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   84 PVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Match: pabpn1 (poly(A) binding protein nuclear 1 [Source:NCBI gene;Acc:101157012])

HSP 1 Score: 149.443 bits (376), Expect = 5.236e-43
Identity = 71/101 (70.30%), Postives = 83/101 (82.18%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   84 PVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Match: pabpn1 (poly(A) binding protein nuclear 1 [Source:NCBI gene;Acc:101157012])

HSP 1 Score: 149.443 bits (376), Expect = 6.341e-43
Identity = 71/101 (70.30%), Postives = 83/101 (82.18%), Query Frame = 3
Query:  276 PPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            P  ++ +EK E D RSIYVGNVDYG+TA+ELEAHF GCG++NR+TIL +KYTGHPKGFAYIEFA  +SV TAM LD+S FR RQIKV  KRTN PG STT+
Sbjct:   84 PVIMSIEEKMEADGRSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKYTGHPKGFAYIEFADKESVRTAMALDESLFRGRQIKVGAKRTNRPGISTTD 184          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Match: PABPN1L (PABPN1 like, cytoplasmic [Source:NCBI gene;Acc:101170990])

HSP 1 Score: 130.183 bits (326), Expect = 5.740e-36
Identity = 56/98 (57.14%), Postives = 78/98 (79.59%), Query Frame = 3
Query:  285 LTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            +T +E+ + D RS+YVGNVDYG+TA ELE HF GCG +NR+TIL ++++GHPKGFAYIEF+   +  +A+ L ++ FR R +KV+PKRTN+PG STT+
Sbjct:   68 MTPEERMDADNRSVYVGNVDYGATADELEIHFNGCGPVNRVTILCDRFSGHPKGFAYIEFSDRSAAQSAVGLHETMFRGRVLKVLPKRTNMPGISTTD 165          
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Match: rbm34 (RNA binding motif protein 34 [Source:NCBI gene;Acc:101172304])

HSP 1 Score: 57.3806 bits (137), Expect = 4.952e-9
Identity = 25/73 (34.25%), Postives = 42/73 (57.53%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKV 536
            RS++VGN+ +    +    HF+ CG +  + ++ +K +G  KGF Y+ F   DSV  A+ L+ S+   R I+V
Sbjct:  264 RSVFVGNLPFDIHEQAFRKHFETCGTVEAVRLVRDKDSGLGKGFGYVLFESADSVQLALELNASKLEGRSIRV 336          
BLAST of polyadenylate-binding protein 2 vs. Planmine SMEST
Match: SMESG000011330.1 (SMESG000011330.1)

HSP 1 Score: 334.724 bits (857), Expect = 7.006e-117
Identity = 198/208 (95.19%), Postives = 200/208 (96.15%), Query Frame = 3
Query:   75 MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNXXXXXXXXXXXXXXXFHPVIXXXXXXXXXXXXXSYHYAPY 698
            MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPK +       +SYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY
Sbjct:    1 MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKGV-----NSKSYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY 203          
BLAST of polyadenylate-binding protein 2 vs. Planmine SMEST
Match: SMESG000011330.1 (SMESG000011330.1)

HSP 1 Score: 334.339 bits (856), Expect = 8.931e-117
Identity = 199/208 (95.67%), Postives = 199/208 (95.67%), Query Frame = 3
Query:   75 MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNXXXXXXXXXXXXXXXFHPVIXXXXXXXXXXXXXSYHYAPY 698
            MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPK         ESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY
Sbjct:    1 MVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHIQSSVHPK---------ESYPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFRRRGSYHYAPY 199          
BLAST of polyadenylate-binding protein 2 vs. Planmine SMEST
Match: SMESG000017886.1 (SMESG000017886.1)

HSP 1 Score: 119.398 bits (298), Expect = 3.927e-32
Identity = 55/102 (53.92%), Postives = 75/102 (73.53%), Query Frame = 3
Query:  273 YPPALTDDEKAELDVRSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFRSRQIKVMPKRTNLPGYSTTN 578
            YP  L+D+E+ E D RSI+V NVDY ++ +EL  HF+GCG IN+ITI T+KY   PKG+AYIEF   D+V  + +LDDSEF++R+IK+  KRTN+ G +  N
Sbjct:   56 YPAPLSDEERFEKDSRSIHVSNVDYSASVEELGKHFRGCGVINKITIPTSKYNNCPKGYAYIEFDNIDAVKVSKMLDDSEFKNRKIKITLKRTNIHGITKNN 157          
BLAST of polyadenylate-binding protein 2 vs. Planmine SMEST
Match: SMESG000009931.1 (SMESG000009931.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.287e-6
Identity = 22/76 (28.95%), Postives = 44/76 (57.89%), Query Frame = 3
Query:  318 RSIYVGNVDYGSTAKELEAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAML-LDDSEFRSRQIKVMP 542
            RSI+VGN+ Y +T ++L   F   G +    ++ ++ +G PKG+ + E+  P    +A+  LD+ ++  R +++ P
Sbjct:   10 RSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGP 85          
The following BLAST results are available for this feature:
BLAST of polyadenylate-binding protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PABPN17.833e-4467.00poly(A) binding protein nuclear 1 [Source:HGNC Sym... [more]
PABPN11.178e-4367.00poly(A) binding protein nuclear 1 [Source:HGNC Sym... [more]
BCL2L2-PABPN13.716e-4266.34BCL2L2-PABPN1 readthrough [Source:HGNC Symbol;Acc:... [more]
BCL2L2-PABPN13.716e-4266.34BCL2L2-PABPN1 readthrough [Source:HGNC Symbol;Acc:... [more]
PABPN13.869e-4267.00poly(A) binding protein nuclear 1 [Source:HGNC Sym... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabp-24.952e-3858.76PolyA Binding Protein (Nuclear) [Source:UniProtKB... [more]
EEED8.129.232e-2838.06Putative RNA-binding protein EEED8.12 [Source:Uni... [more]
EEED8.43.960e-2738.46Putative RNA-binding protein EEED8.4 [Source:UniP... [more]
sgnh-11.954e-2647.96SGN1 Homolog [Source:UniProtKB/TrEMBL;Acc:O44530][more]
rbm-3.17.505e-1239.73RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pabp23.748e-4443.68gene:FBgn0005648 transcript:FBtr0088785[more]
Pabp23.748e-4443.68gene:FBgn0005648 transcript:FBtr0088786[more]
sqd1.331e-735.44gene:FBgn0263396 transcript:FBtr0082854[more]
sqd1.538e-735.44gene:FBgn0263396 transcript:FBtr0309094[more]
sqd1.538e-735.44gene:FBgn0263396 transcript:FBtr0082856[more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpn11.142e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn11.610e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn12.592e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn17.692e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn1l6.376e-3963.27PABPN1 like, cytoplasmic [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpn1l2.143e-4358.97poly(A) binding protein, nuclear 1-like (cytoplasm... [more]
ccdc1134.501e-4368.32coiled-coil domain containing 113 [Source:Xenbase;... [more]
ccdc1132.531e-2553.47coiled-coil domain containing 113 [Source:Xenbase;... [more]
rbm344.195e-1033.33RNA binding motif protein 34 [Source:NCBI gene;Acc... [more]
tada2a3.431e-633.33transcriptional adaptor 2A [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pabpn13.130e-4466.34poly(A) binding protein, nuclear 1 [Source:MGI Sym... [more]
Pabpn16.054e-4467.00poly(A) binding protein, nuclear 1 [Source:MGI Sym... [more]
Pabpn16.054e-4467.00poly(A) binding protein, nuclear 1 [Source:MGI Sym... [more]
Pabpn11.047e-4367.00poly(A) binding protein, nuclear 1 [Source:MGI Sym... [more]
Gm205214.240e-4266.34predicted gene 20521 [Source:MGI Symbol;Acc:MGI:51... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7KNF2|PABP2_DROME3.757e-4343.68Polyadenylate-binding protein 2 OS=Drosophila mela... [more]
sp|Q6TY21|EPA2B_XENLA1.020e-4258.47Embryonic polyadenylate-binding protein 2-B OS=Xen... [more]
sp|Q28ZX3|PABP2_DROPS2.015e-4256.91Polyadenylate-binding protein 2 OS=Drosophila pseu... [more]
sp|Q6NVP7|PABP2_XENTR2.385e-4268.32Polyadenylate-binding protein 2 OS=Xenopus tropica... [more]
sp|Q804A5|EPA2A_XENLA3.179e-4258.12Embryonic polyadenylate-binding protein 2-A OS=Xen... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023ZS935.491e-11595.24Polyadenylate-binding protein 2 OS=Schmidtea medit... [more]
A0A5K3F8S89.011e-4850.87Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183S8S69.287e-4848.30RRM domain-containing protein OS=Schistocephalus s... [more]
A0A183WXB09.927e-4865.79RRM domain-containing protein OS=Trichobilharzia r... [more]
A0A183QFQ42.772e-4750.00RRM domain-containing protein OS=Schistosoma rodha... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpn15.537e-4468.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn12.051e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
pabpn15.293e-4368.22poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
PABPN1L4.544e-4165.98PABPN1 like, cytoplasmic [Source:HGNC Symbol;Acc:H... [more]
pabpn11.296e-3966.98poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpn15.239e-4566.04poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
rbm341.554e-1030.85RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-... [more]
snrnp705.152e-734.69small nuclear ribonucleoprotein 70 (U1) [Source:ZF... [more]
snrnp705.982e-734.69small nuclear ribonucleoprotein 70 (U1) [Source:ZF... [more]
RBM399.476e-628.26RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SGN11.183e-2246.59Cytoplasmic RNA-binding protein; contains an RNA r... [more]
NOP129.552e-1138.57Nucleolar protein involved in pre-25S rRNA process... [more]
HRB12.088e-638.46Poly(A+) RNA-binding protein; key surveillance fac... [more]
CBC23.483e-628.77Small subunit of the heterodimeric cap binding com... [more]
NOP137.937e-630.49Nucleolar protein found in preribosomal complexes;... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464077.252e-4363.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373422.396e-833.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381172.699e-826.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297245.751e-830.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351569.212e-830.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpn18.045e-4470.30poly(A) binding protein nuclear 1 [Source:NCBI gen... [more]
pabpn15.236e-4370.30poly(A) binding protein nuclear 1 [Source:NCBI gen... [more]
pabpn16.341e-4370.30poly(A) binding protein nuclear 1 [Source:NCBI gen... [more]
PABPN1L5.740e-3657.14PABPN1 like, cytoplasmic [Source:NCBI gene;Acc:101... [more]
rbm344.952e-934.25RNA binding motif protein 34 [Source:NCBI gene;Acc... [more]
back to top
BLAST of polyadenylate-binding protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000011330.17.006e-11795.19SMESG000011330.1[more]
SMESG000011330.18.931e-11795.67SMESG000011330.1[more]
SMESG000017886.13.927e-3253.92SMESG000017886.1[more]
SMESG000009931.11.287e-628.95SMESG000009931.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006209
GenBankAHY82409.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006209 ID=SMED30006209|Name=polyadenylate-binding protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=886bp
TAACATATAAGTTGTTAATTATTTGAATCAATTGCATTTTTTATATCTTT
AGCTTTCTTTTAAAATTTATGAATATGGTCGATAGCCTAAATGACAGCTC
AGATGACAATTTTGTATCAGAAATAAGTAAAGATCTAGAGATGGATAACG
AGTATGCATCATCAAAATTACTAGAACTTGACAATACTGTTGATGACGAT
AATCTTGATCAGCATATCCAAAGCTCTGTACATCCTAAAGCAATCATCGA
TGATTACGAATGCTTAGAATCCTATCCACCCGCTTTAACCGATGATGAAA
AAGCGGAATTGGATGTCCGGTCGATCTACGTGGGCAATGTTGATTACGGA
TCAACTGCCAAAGAATTGGAAGCCCATTTCAAAGGCTGTGGTGCAATCAA
TAGGATCACGATCCTTACAAATAAATATACTGGTCATCCGAAAGGATTTG
CCTACATCGAGTTTGCCATGCCGGATTCTGTGGATACCGCGATGCTCCTC
GATGATAGCGAGTTTCGCAGTCGTCAGATAAAAGTAATGCCGAAACGGAC
CAATCTACCGGGTTATTCAACAACCAATCGTCCTCCTAGGCGAATCCGTG
GGGGGCGATCAATGATCGGTCGGTTTCATCCAGTTATCGGTGGAAGGCCG
AGAACATCACGATTCAGGCGCAGAGGCAGTTATCACTATGCTCCTTATTA
GTGCTGTCCCTGTTCCCAGAGCCACAACCGGGGAATTCATTTTATGTTCT
AATGAATAAATCATTACGATTTCTTTTCGGGTTTTAGAACTTTTTCAATT
GTAAATATATATAAATTGTTTTCTCTTCAATGTCTACTAATGTGTGTTTT
GTTATGAGTAATAATTGGATAGATTTTACACCTGGC
back to top

protein sequence of SMED30006209-orf-1

>SMED30006209-orf-1 ID=SMED30006209-orf-1|Name=SMED30006209-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MNMVDSLNDSSDDNFVSEISKDLEMDNEYASSKLLELDNTVDDDNLDQHI
QSSVHPKAIIDDYECLESYPPALTDDEKAELDVRSIYVGNVDYGSTAKEL
EAHFKGCGAINRITILTNKYTGHPKGFAYIEFAMPDSVDTAMLLDDSEFR
SRQIKVMPKRTNLPGYSTTNRPPRRIRGGRSMIGRFHPVIGGRPRTSRFR
RRGSYHYAPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 85..157
e-value: 8.7E-19
score: 78.4
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 86..155
e-value: 3.9E-14
score: 52.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 84..161
score: 15.306
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 79..165
e-value: 3.4E-22
score: 80.4
NoneNo IPR availablePANTHERPTHR23236EUKARYOTIC TRANSLATION INITIATION FACTOR 4B/4Hcoord: 70..181
NoneNo IPR availablePANTHERPTHR23236:SF21PABPN1 PROTEIN-RELATEDcoord: 70..181
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 73..181