Aconitate hydratase, mitochondrial

Overview
NameAconitate hydratase, mitochondrial
Smed IDSMED30006208
Length (bp)3982
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aconitate hydratase, mitochondrial (SMED30006208) t-SNE clustered cells

Violin plots show distribution of expression levels for Aconitate hydratase, mitochondrial (SMED30006208) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aconitate hydratase, mitochondrial (SMED30006208) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aconitate hydratase, mitochondrial (SMED30006208) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006208

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006208SMESG000002905.1 SmedASXL_006866SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006208SMESG000002905.1 dd_Smed_v4_8058_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006208SMESG000036854.1 SMESG000002904.1 Contig39139newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006208SMESG000036854.1 SMESG000002904.1 Contig39139uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006208SMESG000002905.1 SMESG000002904.1 Contig11063newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006208SMESG000002905.1 SMESG000002904.1 Contig11063uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006208SMESG000002905.1 dd_Smed_v6_8058_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006208SMESG000002905.1 OX_Smed_1.0.20366ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006208SMESG000002904.1 dd_Smed_v4_979_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Match: ACO2 (aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118])

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 548/749 (73.16%), Postives = 626/749 (83.58%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EPN  ++Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP +Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL KVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFW+PGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGW+S KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R DIA  A ++KD L+  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP++E+GK A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT + G+KF+L  P  D LP   FD GQ+TYQ PP D S   V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L    PGKP++C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLV-PDPGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Match: ACO2 (aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118])

HSP 1 Score: 1110.52 bits (2871), Expect = 0.000e+0
Identity = 548/774 (70.80%), Postives = 626/774 (80.88%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTG-------------------------MGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EPN  ++Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP +Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL KVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFW+PGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGW+S KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTG                         M TICNMGAEIGATTS+FP+N+RM +YL  T R DIA  A ++KD L+  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP++E+GK A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT + G+KF+L  P  D LP   FD GQ+TYQ PP D S   V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L    PGKP++C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGEEGGQATWPLPCAGPDGSPVGSRSGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLV-PDPGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 804          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 262.692 bits (670), Expect = 7.532e-76
Identity = 122/273 (44.69%), Postives = 176/273 (64.47%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ ++KL + L  N     +N LERP  +D + L VY  + L+QI+DVDEKNQ+L TN+W+ + WTD++  W+   Y  + T+  P  ++W+PDILLYNSADERFDATF  N++V   G    +PPG+FKS+C I+++W+PFD Q CK+KFGSW+Y G  +DL               + +    + NGEWD++     RS   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   20 SLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL------------QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVF 275          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 262.692 bits (670), Expect = 7.532e-76
Identity = 122/273 (44.69%), Postives = 176/273 (64.47%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ ++KL + L  N     +N LERP  +D + L VY  + L+QI+DVDEKNQ+L TN+W+ + WTD++  W+   Y  + T+  P  ++W+PDILLYNSADERFDATF  N++V   G    +PPG+FKS+C I+++W+PFD Q CK+KFGSW+Y G  +DL               + +    + NGEWD++     RS   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   20 SLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL------------QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVF 275          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 262.307 bits (669), Expect = 2.240e-75
Identity = 122/273 (44.69%), Postives = 176/273 (64.47%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ ++KL + L  N     +N LERP  +D + L VY  + L+QI+DVDEKNQ+L TN+W+ + WTD++  W+   Y  + T+  P  ++W+PDILLYNSADERFDATF  N++V   G    +PPG+FKS+C I+++W+PFD Q CK+KFGSW+Y G  +DL               + +    + NGEWD++     RS   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   49 SLQGEFQRKLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL------------QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVF 304          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Match: aco-2 (Probable aconitate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34455])

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 546/755 (72.32%), Postives = 634/755 (83.97%), Query Frame = 3
Query:   60 TSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            +S  +  V +S+ EP S L Y+KL + + IVK +L RP TLSEKILY H D PK QD+ RG SYLRLRPDRVAMQDATAQMAMLQFISSGLPK AVPSTIHCDHLIEA+ GG+ DL RA   NKEV++FLATA SK+G+GFW+PGSGIIHQII+ENY FPG+LLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIG+ L G L+GWTS+KD+ILKVADILTVKGGTGAIVEY+G GV+SIS TGMGTICNMGAEIGATTS+FP+N  M +YL+AT R +IA+EA KYKD LLTAD+   YDQ+IEI+L+ L PH+NGPFTPDL+  I ++G+ AKKNGWP ++ V LIGSCTNSSYEDM RAAS+AKQALD+GLKAK  FTITPGSEQ+RATI RDG ++I + FGG+VLANACGPCIGQWDR+DVK G+KNTIVTSYNRNFTGRNDANPATH FVTSP+I TA+ I+G L+FNPL DELT + G KFKL  PTG  LP +G+D G++T+Q P       QV V P S RLQLL PF KWDGKDL DM IL+K+ GKCTTDHISAAG WLK+RGHLDNISNN+F+ A+NA+NGE+NK+ N  +GE+G VP+TAR+YK  G+ WV +GDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQGMLPLTF+ P DY+KI PSD +S++ L+  APGKP+    K  +G+K  ++L HTFNE QI+WFKAGSALNRMKE+
Sbjct:   22 SSSIWSKVAISKFEPKSYLPYEKLSQTVKIVKDRLKRPLTLSEKILYGHLDQPKTQDIERGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPKTAVPSTIHCDHLIEAQKGGAQDLARAKDLNKEVFNFLATAGSKYGVGFWKPGSGIIHQIILENYAFPGLLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGIKLTGKLNGWTSAKDVILKVADILTVKGGTGAIVEYFGPGVDSISATGMGTICNMGAEIGATTSVFPYNESMYKYLEATGRKEIAEEARKYKD-LLTADDGANYDQIIEINLDTLTPHVNGPFTPDLASSIDKLGENAKKNGWPLDVKVSLIGSCTNSSYEDMTRAASIAKQALDKGLKAKTIFTITPGSEQVRATIERDGLSKIFADFGGMVLANACGPCIGQWDRQDVKKGEKNTIVTSYNRNFTGRNDANPATHGFVTSPDITTAMAISGRLDFNPLTDELTAADGSKFKLQAPTGLDLPPKGYDPGEDTFQAP---SGSGQVDVSPSSDRLQLLSPFDKWDGKDLEDMKILIKVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYGAVPATARKYKADGVRWVAIGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDKIDPSDNVSIVGLSSFAPGKPLTAIFKKTNGSKVEVTLNHTFNEQQIEWFKAGSALNRMKEV 772          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Match: aco-2 (Probable aconitate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34455])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 503/682 (73.75%), Postives = 582/682 (85.34%), Query Frame = 3
Query:  279 MQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            MQDATAQMAMLQFISSGLPK AVPSTIHCDHLIEA+ GG+ DL RA   NKEV++FLATA SK+G+GFW+PGSGIIHQII+ENY FPG+LLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIG+ L G L+GWTS+KD+ILKVADILTVKGGTGAIVEY+G GV+SIS TGMGTICNMGAEIGATTS+FP+N  M +YL+AT R +IA+EA KYKD LLTAD+   YDQ+IEI+L+ L PH+NGPFTPDL+  I ++G+ AKKNGWP ++ V LIGSCTNSSYEDM RAAS+AKQALD+GLKAK  FTITPGSEQ+RATI RDG ++I + FGG+VLANACGPCIGQWDR+DVK G+KNTIVTSYNRNFTGRNDANPATH FVTSP+I TA+ I+G L+FNPL DELT + G KFKL  PTG  LP +G+D G++T+Q P       QV V P S RLQLL PF KWDGKDL DM IL+K+ GKCTTDHISAAG WLK+RGHLDNISNN+F+ A+NA+NGE+NK+ N  +GE+G VP+TAR+YK  G+ WV +GDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQGMLPLTF+ P DY+KI PSD +S++ L+  APGKP+    K  +G+K  ++L HTFNE QI+WFKAGSALNRMKE+
Sbjct:    1 MQDATAQMAMLQFISSGLPKTAVPSTIHCDHLIEAQKGGAQDLARAKDLNKEVFNFLATAGSKYGVGFWKPGSGIIHQIILENYAFPGLLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGIKLTGKLNGWTSAKDVILKVADILTVKGGTGAIVEYFGPGVDSISATGMGTICNMGAEIGATTSVFPYNESMYKYLEATGRKEIAEEARKYKD-LLTADDGANYDQIIEINLDTLTPHVNGPFTPDLASSIDKLGENAKKNGWPLDVKVSLIGSCTNSSYEDMTRAASIAKQALDKGLKAKTIFTITPGSEQVRATIERDGLSKIFADFGGMVLANACGPCIGQWDRQDVKKGEKNTIVTSYNRNFTGRNDANPATHGFVTSPDITTAMAISGRLDFNPLTDELTAADGSKFKLQAPTGLDLPPKGYDPGEDTFQAP---SGSGQVDVSPSSDRLQLLSPFDKWDGKDLEDMKILIKVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYGAVPATARKYKADGVRWVAIGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDKIDPSDNVSIVGLSSFAPGKPLTAIFKKTNGSKVEVTLNHTFNEQQIEWFKAGSALNRMKEV 678          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Match: aco-2 (Probable aconitate hydratase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34455])

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 503/682 (73.75%), Postives = 582/682 (85.34%), Query Frame = 3
Query:  279 MQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            MQDATAQMAMLQFISSGLPK AVPSTIHCDHLIEA+ GG+ DL RA   NKEV++FLATA SK+G+GFW+PGSGIIHQII+ENY FPG+LLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIG+ L G L+GWTS+KD+ILKVADILTVKGGTGAIVEY+G GV+SIS TGMGTICNMGAEIGATTS+FP+N  M +YL+AT R +IA+EA KYKD LLTAD+   YDQ+IEI+L+ L PH+NGPFTPDL+  I ++G+ AKKNGWP ++ V LIGSCTNSSYEDM RAAS+AKQALD+GLKAK  FTITPGSEQ+RATI RDG ++I + FGG+VLANACGPCIGQWDR+DVK G+KNTIVTSYNRNFTGRNDANPATH FVTSP+I TA+ I+G L+FNPL DELT + G KFKL  PTG  LP +G+D G++T+Q P       QV V P S RLQLL PF KWDGKDL DM IL+K+ GKCTTDHISAAG WLK+RGHLDNISNN+F+ A+NA+NGE+NK+ N  +GE+G VP+TAR+YK  G+ WV +GDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQGMLPLTF+ P DY+KI PSD +S++ L+  APGKP+    K  +G+K  ++L HTFNE QI+WFKAGSALNRMKE+
Sbjct:    1 MQDATAQMAMLQFISSGLPKTAVPSTIHCDHLIEAQKGGAQDLARAKDLNKEVFNFLATAGSKYGVGFWKPGSGIIHQIILENYAFPGLLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGIKLTGKLNGWTSAKDVILKVADILTVKGGTGAIVEYFGPGVDSISATGMGTICNMGAEIGATTSVFPYNESMYKYLEATGRKEIAEEARKYKD-LLTADDGANYDQIIEINLDTLTPHVNGPFTPDLASSIDKLGENAKKNGWPLDVKVSLIGSCTNSSYEDMTRAASIAKQALDKGLKAKTIFTITPGSEQVRATIERDGLSKIFADFGGMVLANACGPCIGQWDRQDVKKGEKNTIVTSYNRNFTGRNDANPATHGFVTSPDITTAMAISGRLDFNPLTDELTAADGSKFKLQAPTGLDLPPKGYDPGEDTFQAP---SGSGQVDVSPSSDRLQLLSPFDKWDGKDLEDMKILIKVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYGAVPATARKYKADGVRWVAIGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDKIDPSDNVSIVGLSSFAPGKPLTAIFKKTNGSKVEVTLNHTFNEQQIEWFKAGSALNRMKEV 678          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 258.455 bits (659), Expect = 6.309e-75
Identity = 121/267 (45.32%), Postives = 169/267 (63.30%), Query Frame = 3
Query: 2799 VIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            ++A  +     E++L   L  N     +N LERP  +  + + V++ + L QIIDVDEKNQ+++ N W+D  W DY+ VWD   Y NIT +  PA ++W+PD+LLYNS D  FD+T+  N++V   G +H VPPG+FK +C+I+I+W+PFD QKC  KFGSWTY+G  +DL              G  +    + NGEW +      R+   Y CCPE Y D+ +YL ++RRTLYY FNLI+PCI+ + M LLGF +PPDAGEKI+L
Sbjct:   12 ILAAPTLGSLQERRLYEDLMRN-----YNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDL----------QPATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITL 263          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 258.455 bits (659), Expect = 2.513e-74
Identity = 117/278 (42.09%), Postives = 181/278 (65.11%), Query Frame = 3
Query: 2769 KFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLG 3602
            +F  G  F   + +  + G  E++L   L +N     +N L RP +++ +++ V + +   QI+D+DEK+QI+++NVW+ + WTD++  WDP  + NI  + +P N +W+PD+LLYNS D++FD+T+P N VV Y G +  +PP + +S+C I+I ++PFDTQ C MKFGSWTY G   DL+    N T    T+          NGEW++L   + RS+  Y CCPE Y D+++ + I+RRTLYY FNL++PC++IS++ALL F +P D GEK++LG
Sbjct:    4 RFEIGIAFFFALFRVIWTGDHERRLYAKLAEN-----YNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLI----NTTISPATYKP--------NGEWELLGLTSQRSIFFYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLG 264          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Match: mAcon1 (gene:FBgn0010100 transcript:FBtr0346587)

HSP 1 Score: 1149.04 bits (2971), Expect = 0.000e+0
Identity = 556/759 (73.25%), Postives = 640/759 (84.32%), Query Frame = 3
Query:   54 KYTSRCYCS--VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            ++ + CY +  V +S+ + +  L Y+KL + L +V+ +LNRP TLSEK+LYSH DDP NQD+VRG SYLRLRPDRVAMQDATAQMA+LQFISSGL KVAVPST+HCDHLIEA+ GG  DL RA   NKEVYDFLA+  +K+GLGFW+PGSGIIHQII+ENY FPG+L+IGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGV+L G +SGWTS KD+ILKVADILTVKGGTGAI+EY+G+GV+SISCTGM TICNMGAEIGATTSLFPFN RM +YLK+T R+ IA EA KY+  +L+AD+NC+YD++IEI+L+ LEPH+NGPFTPDL HPIS++G+ +KKNG+P +I VGLIGSCTNSSYEDM R AS+AK A+  GLK+K  F +TPGSEQIRATI RDG +E+  KFGG VLANACGPCIGQWDRKDVK G KNTIVTSYNRNFTGRNDANPATH FVTSPE+VTAL I G L+FNPL DELT + G+KFKL  P GD LP++GFD GQ+TY  PP     ++V VDPKSTRLQLL+PF KW+G+DL D+ +L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA N EN E+N I N  +G WG VP  AR YK  GI WV VGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTF+ P DY+KIQP+ KISLLNL  LAPGKP++ EIK+ D   E I L HT N+ QI WFKAGSALNRMKEL
Sbjct:   28 QFHASCYTASKVALSKFDSDVYLPYEKLNKRLEVVRGRLNRPLTLSEKVLYSHLDDPANQDIVRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDELTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDKV-ERIKLNHTLNDLQIGWFKAGSALNRMKEL 785          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Match: mAcon1 (gene:FBgn0010100 transcript:FBtr0300425)

HSP 1 Score: 1149.04 bits (2971), Expect = 0.000e+0
Identity = 556/759 (73.25%), Postives = 640/759 (84.32%), Query Frame = 3
Query:   54 KYTSRCYCS--VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            ++ + CY +  V +S+ + +  L Y+KL + L +V+ +LNRP TLSEK+LYSH DDP NQD+VRG SYLRLRPDRVAMQDATAQMA+LQFISSGL KVAVPST+HCDHLIEA+ GG  DL RA   NKEVYDFLA+  +K+GLGFW+PGSGIIHQII+ENY FPG+L+IGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGV+L G +SGWTS KD+ILKVADILTVKGGTGAI+EY+G+GV+SISCTGM TICNMGAEIGATTSLFPFN RM +YLK+T R+ IA EA KY+  +L+AD+NC+YD++IEI+L+ LEPH+NGPFTPDL HPIS++G+ +KKNG+P +I VGLIGSCTNSSYEDM R AS+AK A+  GLK+K  F +TPGSEQIRATI RDG +E+  KFGG VLANACGPCIGQWDRKDVK G KNTIVTSYNRNFTGRNDANPATH FVTSPE+VTAL I G L+FNPL DELT + G+KFKL  P GD LP++GFD GQ+TY  PP     ++V VDPKSTRLQLL+PF KW+G+DL D+ +L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA N EN E+N I N  +G WG VP  AR YK  GI WV VGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTF+ P DY+KIQP+ KISLLNL  LAPGKP++ EIK+ D   E I L HT N+ QI WFKAGSALNRMKEL
Sbjct:   28 QFHASCYTASKVALSKFDSDVYLPYEKLNKRLEVVRGRLNRPLTLSEKVLYSHLDDPANQDIVRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDELTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDKV-ERIKLNHTLNDLQIGWFKAGSALNRMKEL 785          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Match: mAcon1 (gene:FBgn0010100 transcript:FBtr0081473)

HSP 1 Score: 1149.04 bits (2971), Expect = 0.000e+0
Identity = 556/759 (73.25%), Postives = 640/759 (84.32%), Query Frame = 3
Query:   54 KYTSRCYCS--VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            ++ + CY +  V +S+ + +  L Y+KL + L +V+ +LNRP TLSEK+LYSH DDP NQD+VRG SYLRLRPDRVAMQDATAQMA+LQFISSGL KVAVPST+HCDHLIEA+ GG  DL RA   NKEVYDFLA+  +K+GLGFW+PGSGIIHQII+ENY FPG+L+IGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGV+L G +SGWTS KD+ILKVADILTVKGGTGAI+EY+G+GV+SISCTGM TICNMGAEIGATTSLFPFN RM +YLK+T R+ IA EA KY+  +L+AD+NC+YD++IEI+L+ LEPH+NGPFTPDL HPIS++G+ +KKNG+P +I VGLIGSCTNSSYEDM R AS+AK A+  GLK+K  F +TPGSEQIRATI RDG +E+  KFGG VLANACGPCIGQWDRKDVK G KNTIVTSYNRNFTGRNDANPATH FVTSPE+VTAL I G L+FNPL DELT + G+KFKL  P GD LP++GFD GQ+TY  PP     ++V VDPKSTRLQLL+PF KW+G+DL D+ +L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA N EN E+N I N  +G WG VP  AR YK  GI WV VGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTF+ P DY+KIQP+ KISLLNL  LAPGKP++ EIK+ D   E I L HT N+ QI WFKAGSALNRMKEL
Sbjct:   28 QFHASCYTASKVALSKFDSDVYLPYEKLNKRLEVVRGRLNRPLTLSEKVLYSHLDDPANQDIVRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDELTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDKV-ERIKLNHTLNDLQIGWFKAGSALNRMKEL 785          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Match: mAcon1 (gene:FBgn0010100 transcript:FBtr0343871)

HSP 1 Score: 1149.04 bits (2971), Expect = 0.000e+0
Identity = 556/759 (73.25%), Postives = 640/759 (84.32%), Query Frame = 3
Query:   54 KYTSRCYCS--VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            ++ + CY +  V +S+ + +  L Y+KL + L +V+ +LNRP TLSEK+LYSH DDP NQD+VRG SYLRLRPDRVAMQDATAQMA+LQFISSGL KVAVPST+HCDHLIEA+ GG  DL RA   NKEVYDFLA+  +K+GLGFW+PGSGIIHQII+ENY FPG+L+IGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGV+L G +SGWTS KD+ILKVADILTVKGGTGAI+EY+G+GV+SISCTGM TICNMGAEIGATTSLFPFN RM +YLK+T R+ IA EA KY+  +L+AD+NC+YD++IEI+L+ LEPH+NGPFTPDL HPIS++G+ +KKNG+P +I VGLIGSCTNSSYEDM R AS+AK A+  GLK+K  F +TPGSEQIRATI RDG +E+  KFGG VLANACGPCIGQWDRKDVK G KNTIVTSYNRNFTGRNDANPATH FVTSPE+VTAL I G L+FNPL DELT + G+KFKL  P GD LP++GFD GQ+TY  PP     ++V VDPKSTRLQLL+PF KW+G+DL D+ +L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA N EN E+N I N  +G WG VP  AR YK  GI WV VGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTF+ P DY+KIQP+ KISLLNL  LAPGKP++ EIK+ D   E I L HT N+ QI WFKAGSALNRMKEL
Sbjct:   28 QFHASCYTASKVALSKFDSDVYLPYEKLNKRLEVVRGRLNRPLTLSEKVLYSHLDDPANQDIVRGTSYLRLRPDRVAMQDATAQMALLQFISSGLKKVAVPSTVHCDHLIEAQIGGPKDLARAKDLNKEVYDFLASTCAKYGLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVNLTGKISGWTSPKDVILKVADILTVKGGTGAIIEYHGKGVDSISCTGMATICNMGAEIGATTSLFPFNQRMADYLKSTGRAGIASEAQKYQAKILSADKNCEYDELIEINLDTLEPHVNGPFTPDLGHPISKLGENSKKNGYPMDIRVGLIGSCTNSSYEDMGRCASIAKDAMSHGLKSKIPFNVTPGSEQIRATIERDGISEVFDKFGGTVLANACGPCIGQWDRKDVKKGDKNTIVTSYNRNFTGRNDANPATHCFVTSPELVTALSIAGRLDFNPLTDELTGADGKKFKLKAPFGDELPAKGFDPGQDTYTAPPPSGENVKVAVDPKSTRLQLLEPFDKWNGQDLTDLTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNYENNEMNNIKNQRNGSWGGVPDVARDYKANGIKWVAVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIQPTSKISLLNLKSLAPGKPVDAEIKNGDKV-ERIKLNHTLNDLQIGWFKAGSALNRMKEL 785          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Match: mAcon2 (gene:FBgn0037862 transcript:FBtr0082336)

HSP 1 Score: 1093.57 bits (2827), Expect = 0.000e+0
Identity = 537/755 (71.13%), Postives = 617/755 (81.72%), Query Frame = 3
Query:   66 RCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELKS 2330
            RC   V MS  +    L YKKL ENL  +K +L  P TLSEK+LYSH D P +Q++ RG+SYLRLRPDRVA+QDATAQM +LQFISSGL KVAVPST+HCDHLIEA+  G  DL RA   NKEVYDFL++A +K+ LGFW+PGSGIIHQII+ENY FPG+L+IGTDSHTPNGGGLG LC+GVGGADAVDVMA+IPWELKCP VIG HL G +SGWTS KD+ILKVA+ILTVKGGTGAIVEY+G GV SISCTGM TI NMGAEIGATTS+FPFN RMV YL+AT R  IA EA K KD LL  DE CKYD+VIEI+L+ LEP +NGPFTPDL+HPIS++G+ ++KNG+P EI V LIGSCTNSSYEDM R AS+A  AL  GLK+   F +TPGSEQ+RATI RDG  ++L KFGG VLANACGPCIGQWDRKDVKMG+KNTIVTSYNRNFTGRNDANPATH FVTSPE+ TAL I G L+FNP+ DELT + G+ FKL  P G+ LPS+GFD G++TYQ PP     I+V VDPKS RLQLL+PF KWDGKD ID+++L+KIKGKCTTDHISAAG WLK+RGHLDNISNNMFIGA NAEN E+NK+ N  +G +  VP+ AR YK   I W  VG+ENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQGML LTF+ P DY+K+QPS KIS+LNL  LAPGKP++ EIK+ +G+ + I L HT NE QI WF+AGSALN MKEL +
Sbjct:   26 RCD-KVAMSNFDTGIPLPYKKLRENLDCIKGRLGGPLTLSEKVLYSHLDQPDSQEIERGKSYLRLRPDRVALQDATAQMTLLQFISSGLKKVAVPSTVHCDHLIEAQISGDKDLARAKDLNKEVYDFLSSACAKYNLGFWKPGSGIIHQIILENYAFPGLLMIGTDSHTPNGGGLGCLCVGVGGADAVDVMANIPWELKCPTVIGCHLTGKISGWTSPKDVILKVAEILTVKGGTGAIVEYHGPGVESISCTGMATITNMGAEIGATTSIFPFNERMVTYLRATGRGAIADEATKNKD-LLVPDEGCKYDKVIEINLDTLEPLVNGPFTPDLAHPISKLGQNSEKNGYPMEIKVSLIGSCTNSSYEDMGRCASIANDALGHGLKSCVPFNVTPGSEQVRATIARDGIIDVLEKFGGTVLANACGPCIGQWDRKDVKMGEKNTIVTSYNRNFTGRNDANPATHCFVTSPEMATALAIAGRLDFNPMTDELTGTDGKTFKLKEPHGEELPSKGFDPGEDTYQAPPAKADDIKVNVDPKSDRLQLLEPFEKWDGKDYIDLMVLIKIKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGATNAENNEMNKVKNQKTGSFDAVPAVARDYKANKIKWCAVGEENYGEGSSREHAALEPRHLGGVAIIVKSFARIHETNLKKQGMLALTFANPGDYDKVQPSSKISILNLKDLAPGKPVDAEIKN-NGSSDKIQLNHTLNELQIQWFQAGSALNLMKELAA 777          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Match: aco2 (aconitase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-1390])

HSP 1 Score: 1153.66 bits (2983), Expect = 0.000e+0
Identity = 555/749 (74.10%), Postives = 635/749 (84.78%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MSR EP+S +NY KL  N+ IV+K+LNRP TLSEKI+Y H DDP  Q++ RG +YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG+ DLQ+A + N+EVY FLA+A +K+G+GFW+PGSGIIHQII+ENY +PGV+LIGTDSHTPNGGGLG +CIGVGGADAVDVMA IPWELKCP VIGV L G+LSGW+S KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FPFN+RM  YL  T R +IA  A + KD LL  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP+S+IG  A+KNGWP ++ VGLIGSCTNSSYEDM RAASLAKQALD+GLK K  FT+TPGSEQIRATI RDG A++L   GGIVLANACGPCIGQWDR+DVK G+KNTIVTS+NRNFT RNDANPATHAFVTSPEIVTAL I G L FNP  D LT   G+KFKL PPTGD LP+R FD GQ+TYQ PP D S ++V V+P+S RLQLL+PF KW+GKDL D+ +L+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGAVN EN  VNK+ N+ +GE+  VP  AR YKK  I WVVVGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTFS P DY+KI+P DKIS++ L   APGKP++  IKH DG+ ETI L HTFNE QI+WF+AGSALNRMKE++
Sbjct:   42 VAMSRFEPSSYINYDKLRSNIDIVRKRLNRPLTLSEKIVYGHLDDPAGQEIARGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQTGGAQDLQKAKEVNQEVYSFLASAGAKYGVGFWKPGSGIIHQIILENYAYPGVMLIGTDSHTPNGGGLGCICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPFNHRMKTYLDKTGRGEIATLADENKD-LLVPDSGCHYDQLIEINLDELKPHINGPFTPDLAHPVSDIGSVAEKNGWPLDVKVGLIGSCTNSSYEDMGRAASLAKQALDKGLKCKAQFTVTPGSEQIRATIERDGYAKVLRDVGGIVLANACGPCIGQWDRRDVKKGEKNTIVTSFNRNFTARNDANPATHAFVTSPEIVTALAIAGTLKFNPETDYLTAPNGEKFKLEPPTGDELPARDFDPGQDTYQHPPADGSALKVDVNPQSNRLQLLEPFDKWNGKDLEDLQVLIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAVNIENDGVNKLRNLLTGEYSGVPDVARHYKKNNISWVVVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFSNPADYDKIRPDDKISIIGLKSFAPGKPLKAVIKHTDGSSETIELNHTFNETQIEWFQAGSALNRMKEMQ 789          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Match: aco2 (aconitase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GENE-030131-1390])

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 554/749 (73.97%), Postives = 635/749 (84.78%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MSR EP+S +NY KL  N+ IV+K+LNRP TLSEKI+Y H DDP  Q++ RG +YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG+ DLQ+A + N+EVY FLA+A +K+G+GFW+PGSGIIHQII+ENY +PGV+LIGTDSHTPNGGGLG +CIGVGGADAVDVMA IPWELKCP VIGV L G+LSGW+S KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FPFN+RM  YL  T R +IA  A + KD LL  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP+S+IG  A+KNGWP ++ VGLIGSCTNSSYEDM RAASLAKQALD+GLK K  FT+TPGSEQIRATI RDG A++L   GGIVLANACGPCIGQWDR+DVK G+KNTIVTS+NRNFT RNDANPATHAFVTSPEIVTAL I G L FNP  D LT   G+KFKL PPTGD LP+R FD GQ+TYQ PP D S ++V V+P+S RLQLL+PF KW+GKDL ++ +L+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGAVN EN  VNK+ N+ +GE+  VP  AR YKK  I WVVVGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTFS P DY+KI+P DKIS++ L   APGKP++  IKH DG+ ETI L HTFNE QI+WF+AGSALNRMKE++
Sbjct:   34 VAMSRFEPSSYINYDKLRSNIDIVRKRLNRPLTLSEKIVYGHLDDPAGQEIARGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQTGGAQDLQKAKEVNQEVYSFLASAGAKYGVGFWKPGSGIIHQIILENYAYPGVMLIGTDSHTPNGGGLGCICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPFNHRMKTYLDKTGRGEIATLADENKD-LLVPDSGCHYDQLIEINLDELKPHINGPFTPDLAHPVSDIGSVAEKNGWPLDVKVGLIGSCTNSSYEDMGRAASLAKQALDKGLKCKAQFTVTPGSEQIRATIERDGYAKVLRDVGGIVLANACGPCIGQWDRRDVKKGEKNTIVTSFNRNFTARNDANPATHAFVTSPEIVTALAIAGTLKFNPETDYLTAPNGEKFKLEPPTGDELPARDFDPGQDTYQHPPADGSALKVDVNPQSNRLQLLEPFDKWNGKDLEELQVLIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAVNIENDGVNKLRNLLTGEYSGVPDVARHYKKNNISWVVVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFSNPADYDKIRPDDKISIIGLKSFAPGKPLKAVIKHTDGSSETIELNHTFNETQIEWFQAGSALNRMKEMQ 781          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 263.848 bits (673), Expect = 1.994e-76
Identity = 127/280 (45.36%), Postives = 180/280 (64.29%), Query Frame = 3
Query: 2793 VLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            +L  +  S  G+ ++KL + L +N     +N LERP  +D   + V + + L+QIIDVDEKNQ+L TN W+ L WTD +  W+P  Y  + TL  P+N++W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWT+ G L+DL     + +T             + NGEWD++     R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   10 LLAGSGGSLQGEYQRKLYKELMEN-----YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQAVDIST------------YIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVF 272          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 265.003 bits (676), Expect = 2.218e-76
Identity = 128/273 (46.89%), Postives = 176/273 (64.47%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ +++L R L  N     +N LERP  +D  SL V+    LMQI+DVDEKNQ+L TN+W+ L WTDY+  W+   Y  + T+  P + +WRPDILLYNSADERFDATF  N++V   G    +PPG+FKSTC I+++W+PFD Q+C +KFGSWTY G  +DL     + T              + NGEWD++     R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IST+ALL FL+P D+GEKISLG    + +T F
Sbjct:   51 SLQGEHQRRLYRDLMKN-----YNPLERPVYNDSHSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDLQMINADIT------------GYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVF 306          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 263.462 bits (672), Expect = 2.380e-76
Identity = 127/280 (45.36%), Postives = 179/280 (63.93%), Query Frame = 3
Query: 2793 VLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            +L     S  G+ ++KL + L +N     +N LERP  +D   + V + + L+QIIDVDEKNQ+L TN W+ L WTD +  W+P  Y  + TL  P+N++W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWT+ G L+DL     + +T             + NGEWD++     R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:    2 MLAQLTRSLQGEYQRKLYKELMEN-----YNRLERPVLNDSAPIVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLSWNPDNYPGVQTLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGACQYIPPGILKSTCYIDVRWFPFDIQKCDLKFGSWTHNGWLLDLQMQAVDIST------------YIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVF 264          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Match: aco2 (aconitase 2 [Source:NCBI gene;Acc:496933])

HSP 1 Score: 1107.05 bits (2862), Expect = 0.000e+0
Identity = 545/749 (72.76%), Postives = 629/749 (83.98%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  E N  +NY++L +N+ IV+K+L+RP TLSEKI+Y H DDP  Q+VVRG++YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA++K+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCP VIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T RS IA  A ++K  L+  DE C+YDQ+IEI+L++L+PHINGPFTPDL++P+SE+G  A++ GWP +I VGLIGSCTNSSYEDM RAA++AKQAL  GLK K  FTITPGSEQIRATI RDG A +L   GG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L F+P  D LT + G+KFKL PP  D LP   FD GQ+TYQ PP + S ++V V P S RLQLL+PF KWDGKDL +M IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N EN + N + N  + E+G VP TAR YK  GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTFS P DY+KI P DKI++  L  LAPGKP++C I H++G++ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   34 VAMSHFEANEYINYERLDKNINIVRKRLDRPLTLSEKIVYGHIDDPVTQEVVRGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQLGGEKDLKRAKDINQEVYNFLATAAAKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGQLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLDKTGRSAIASLADEFKSHLV-PDEGCEYDQLIEINLDELKPHINGPFTPDLANPVSEVGAVAEQKGWPLDIRVGLIGSCTNSSYEDMGRAAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAAVLRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALSIAGTLKFDPEKDFLTGADGKKFKLQPPDADELPKSSFDPGQDTYQHPPKEGSSLKVDVSPTSQRLQLLEPFDKWDGKDLENMQILVKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINLENNKANSVKNCVNQEYGAVPDTARYYKAHGIKWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFSDPADYDKIHPEDKITIAELKHLAPGKPVKCIITHQNGSQETILLNHTFNETQIEWFQAGSALNRMKELQ 781          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Match: aco2 (aconitase 2 [Source:NCBI gene;Acc:496933])

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 544/750 (72.53%), Postives = 629/750 (83.87%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQ-AEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  E N  +NY++L +N+ IV+K+L+RP TLSEKI+Y H DDP  Q+VVRG++YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA++K+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCP VIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T RS IA  A ++K  L+  DE C+YDQ+IEI+L++L+PHINGPFTPDL++P+SE+G  A++ GWP +I VGLIGSCTNSSYEDM RAA++AKQAL  GLK K  FTITPGSEQIRATI RDG  + +L   GG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L F+P  D LT + G+KFKL PP  D LP   FD GQ+TYQ PP + S ++V V P S RLQLL+PF KWDGKDL +M IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N EN + N + N  + E+G VP TAR YK  GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTFS P DY+KI P DKI++  L  LAPGKP++C I H++G++ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   39 VAMSHFEANEYINYERLDKNINIVRKRLDRPLTLSEKIVYGHIDDPVTQEVVRGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQLGGEKDLKRAKDINQEVYNFLATAAAKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGQLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLDKTGRSAIASLADEFKSHLV-PDEGCEYDQLIEINLDELKPHINGPFTPDLANPVSEVGAVAEQKGWPLDIRVGLIGSCTNSSYEDMGRAAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYVSAVLRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALSIAGTLKFDPEKDFLTGADGKKFKLQPPDADELPKSSFDPGQDTYQHPPKEGSSLKVDVSPTSQRLQLLEPFDKWDGKDLENMQILVKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINLENNKANSVKNCVNQEYGAVPDTARYYKAHGIKWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFSDPADYDKIHPEDKITIAELKHLAPGKPVKCIITHQNGSQETILLNHTFNETQIEWFQAGSALNRMKELQ 787          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Match: aco2 (aconitase 2 [Source:NCBI gene;Acc:496933])

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 526/785 (67.01%), Postives = 608/785 (77.45%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYK------------------------------------KAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  E N  +NY++L +N+ IV+K+L+RP TLSEKI+Y H DDP  Q+VVRG++YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA++K+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCP VIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T RS IA  A ++K  L+  DE C+YDQ+IEI+L++L+PHINGPFTPDL++P+SE+G  A++ GWP +I VGLIGSCTNSSYEDM RAA++AKQAL  GLK K  FTITPGSEQIRATI RDG A +L   GG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L F+P  D LT + G+KFKL PP  D LP   FD GQ+TYQ PP + S ++V V P S RLQLL+PF KWDGKDL +M IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N EN + N + N  + E+G VP TAR YK                                      GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHE                         DKI++  L  LAPGKP++C I H++G++ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   26 VAMSHFEANEYINYERLDKNINIVRKRLDRPLTLSEKIVYGHIDDPVTQEVVRGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQLGGEKDLKRAKDINQEVYNFLATAAAKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGQLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLDKTGRSAIASLADEFKSHLV-PDEGCEYDQLIEINLDELKPHINGPFTPDLANPVSEVGAVAEQKGWPLDIRVGLIGSCTNSSYEDMGRAAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAAVLRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALSIAGTLKFDPEKDFLTGADGKKFKLQPPDADELPKSSFDPGQDTYQHPPKEGSSLKVDVSPTSQRLQLLEPFDKWDGKDLENMQILVKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINLENNKANSVKNCVNQEYGAVPDTARYYKVRAYELVCRLQQLPRPNIRPCAIDKSFNMGHNGSGLAHGIKWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHE-------------------------DKITIAELKHLAPGKPVKCIITHQNGSQETILLNHTFNETQIEWFQAGSALNRMKELQ 784          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Match: aco2 (aconitase 2 [Source:NCBI gene;Acc:496933])

HSP 1 Score: 1008.44 bits (2606), Expect = 0.000e+0
Identity = 496/749 (66.22%), Postives = 579/749 (77.30%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  E N  +NY++L +N+ IV+K+L+RP TLSEKI+Y H DDP  Q+VVRG++YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA++K+G+GFW+PGSGIIH                                                     +VIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T RS IA  A ++K  L+  DE C+YDQ+IEI+L++L+PHINGPFTPDL++P+SE+G  A++ GWP +I VGLIGSCTNSSYEDM RAA++AKQAL  GLK K  FTITPGSEQIRATI RDG A +L   GG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L F+P  D LT + G+KFKL PP  D LP   FD GQ+TYQ PP + S ++V V P S RLQLL+PF KWDGKDL +M IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N EN + N + N  + E+G VP TAR YK  GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTFS P DY+KI P DKI++  L  LAPGKP++C I H++G++ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   34 VAMSHFEANEYINYERLDKNINIVRKRLDRPLTLSEKIVYGHIDDPVTQEVVRGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQLGGEKDLKRAKDINQEVYNFLATAAAKYGVGFWKPGSGIIH-----------------------------------------------------QVIGVKLTGQLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLDKTGRSAIASLADEFKSHLV-PDEGCEYDQLIEINLDELKPHINGPFTPDLANPVSEVGAVAEQKGWPLDIRVGLIGSCTNSSYEDMGRAAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAAVLRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALSIAGTLKFDPEKDFLTGADGKKFKLQPPDADELPKSSFDPGQDTYQHPPKEGSSLKVDVSPTSQRLQLLEPFDKWDGKDLENMQILVKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINLENNKANSVKNCVNQEYGAVPDTARYYKAHGIKWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFSDPADYDKIHPEDKITIAELKHLAPGKPVKCIITHQNGSQETILLNHTFNETQIEWFQAGSALNRMKELQ 728          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Match: ENSXETT00000021532.1 (cholinergic receptor, nicotinic alpha 7 [Source:NCBI gene;Acc:100493611])

HSP 1 Score: 262.692 bits (670), Expect = 7.128e-76
Identity = 122/273 (44.69%), Postives = 176/273 (64.47%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ ++KL + L  N     +N LERP  +D   L VY  + LMQI+DVDEKNQ+L TN+W+ ++W DY+  W+   Y  +  +  P  ++W+PDILLYNSADERFDA+F  N++V   G    +PPG+FKS+C I+++W+PFD QKC +KFGSWTY G  +DL               + +    + NGEWD++     RS + Y CC E Y+D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   22 SLQGEYQRKLYKELMKN-----YNPLERPVLNDSHPLTVYFGMSLMQIMDVDEKNQVLTTNIWLQMQWIDYYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDASFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDIQKCNLKFGSWTYGGWSLDLQML------------ESDISEYISNGEWDLVGVPGKRSENYYECCKEPYLDVTFTIIMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVF 277          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Match: Aco2 (aconitase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:87880])

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 552/749 (73.70%), Postives = 628/749 (83.85%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EP+  + Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP NQ++ RG++YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFWRPGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R+DIA  A ++KD L+  D  C+YDQVIEI+LN+L+PHINGPFTPDL+HP++++G  A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT   G+KFKL  P  D LP   FD GQ+TYQ PP D S  +V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L   APGKP++C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPSEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHLV-PDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Match: Aco2 (aconitase 2, mitochondrial [Source:MGI Symbol;Acc:MGI:87880])

HSP 1 Score: 277.715 bits (709), Expect = 1.572e-85
Identity = 145/187 (77.54%), Postives = 165/187 (88.24%), Query Frame = 3
Query:  405 LQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVL 965
            + R    N+EVY+FLATA +K+G+GFWRPGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R+DIA  A ++KD L
Sbjct:    8 VTRLQDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHL 194          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 260.766 bits (665), Expect = 2.321e-75
Identity = 120/273 (43.96%), Postives = 177/273 (64.84%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G+ +++L + L  N     +N LERP  +D + L VY  + L+QI+DVDEKNQ+L TN+W+ + WTD++  W+   Y  +  +  P  ++W+PDILLYNSADERFDATF  N++V   G    +PPG+FKS+C I+++W+PFD Q+CK+KFGSW+Y G  +DL               + +  + + NGEWD++     R+   Y CC E Y D++Y + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   20 SLQGEFQRRLYKELVKN-----YNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL------------QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVF 275          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 222.631 bits (566), Expect = 4.063e-62
Identity = 108/278 (38.85%), Postives = 163/278 (58.63%), Query Frame = 3
Query: 2766 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            +  +C      V+A++     AE +L +HLF       +N   RP  +    + V   + + Q+IDVDEKNQ++ TNVW+  +W DY   WDP  + NIT+L +P+  +W PDI+LYN+AD  F  T      + + G +H VPP ++KS+C I++ ++PFD Q CKMKFGSWTY+   IDL           Q     + ++  E+GEW +++     +  KY CC E Y D++YY  I+R  L+YT NLI+PC++IS + +L F +P + GEKI+L
Sbjct:   14 LYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFG-----GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDL----------EQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITL 276          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 222.631 bits (566), Expect = 4.063e-62
Identity = 108/278 (38.85%), Postives = 163/278 (58.63%), Query Frame = 3
Query: 2766 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            +  +C      V+A++     AE +L +HLF       +N   RP  +    + V   + + Q+IDVDEKNQ++ TNVW+  +W DY   WDP  + NIT+L +P+  +W PDI+LYN+AD  F  T      + + G +H VPP ++KS+C I++ ++PFD Q CKMKFGSWTY+   IDL           Q     + ++  E+GEW +++     +  KY CC E Y D++YY  I+R  L+YT NLI+PC++IS + +L F +P + GEKI+L
Sbjct:   14 LYLWCLLLMPAVLAQQGSHTHAEDRLFKHLFG-----GYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDL----------EQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITL 276          
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q99KI0|ACON_MOUSE (Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1)

HSP 1 Score: 1133.63 bits (2931), Expect = 0.000e+0
Identity = 552/749 (73.70%), Postives = 628/749 (83.85%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EP+  + Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP NQ++ RG++YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFWRPGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R+DIA  A ++KD L+  D  C+YDQVIEI+LN+L+PHINGPFTPDL+HP++++G  A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT   G+KFKL  P  D LP   FD GQ+TYQ PP D S  +V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L   APGKP++C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPSEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHLV-PDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Match: sp|P20004|ACON_BOVIN (Aconitate hydratase, mitochondrial OS=Bos taurus OX=9913 GN=ACO2 PE=1 SV=4)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 551/749 (73.56%), Postives = 626/749 (83.58%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EPN  + Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP NQ++ RG++YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFWRPGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R+DIA  A ++KD L+  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP++E+G  A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GL+ K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT   G+KFKL  P  D LP   FD GQ+TYQ PP D S  QV V P S RLQLL+PF KWDG+DL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L   APGKP+ C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPNEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLV-PDSGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIKGLKDFAPGKPLTCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9ER34|ACON_RAT (Aconitate hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aco2 PE=1 SV=2)

HSP 1 Score: 1132.09 bits (2927), Expect = 0.000e+0
Identity = 552/749 (73.70%), Postives = 626/749 (83.58%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EP+  + Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP NQ++ RG++YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFWRPGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R+DIA  A ++KD L+  D  C+YDQVIEI+LN+L+PHINGPFTPDL+HP++++G  A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT   G+KFKL  P  D LP   FD GQ+TYQ PP D S  +V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L   APGKP+ C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPSEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGTLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLAEEFKDHLV-PDPGCQYDQVIEINLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLNCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Match: sp|P34455|ACON_CAEEL (Probable aconitate hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=aco-2 PE=3 SV=2)

HSP 1 Score: 1130.93 bits (2924), Expect = 0.000e+0
Identity = 546/755 (72.32%), Postives = 634/755 (83.97%), Query Frame = 3
Query:   60 TSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKEL 2324
            +S  +  V +S+ EP S L Y+KL + + IVK +L RP TLSEKILY H D PK QD+ RG SYLRLRPDRVAMQDATAQMAMLQFISSGLPK AVPSTIHCDHLIEA+ GG+ DL RA   NKEV++FLATA SK+G+GFW+PGSGIIHQII+ENY FPG+LLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIG+ L G L+GWTS+KD+ILKVADILTVKGGTGAIVEY+G GV+SIS TGMGTICNMGAEIGATTS+FP+N  M +YL+AT R +IA+EA KYKD LLTAD+   YDQ+IEI+L+ L PH+NGPFTPDL+  I ++G+ AKKNGWP ++ V LIGSCTNSSYEDM RAAS+AKQALD+GLKAK  FTITPGSEQ+RATI RDG ++I + FGG+VLANACGPCIGQWDR+DVK G+KNTIVTSYNRNFTGRNDANPATH FVTSP+I TA+ I+G L+FNPL DELT + G KFKL  PTG  LP +G+D G++T+Q P       QV V P S RLQLL PF KWDGKDL DM IL+K+ GKCTTDHISAAG WLK+RGHLDNISNN+F+ A+NA+NGE+NK+ N  +GE+G VP+TAR+YK  G+ WV +GDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQGMLPLTF+ P DY+KI PSD +S++ L+  APGKP+    K  +G+K  ++L HTFNE QI+WFKAGSALNRMKE+
Sbjct:   22 SSSIWSKVAISKFEPKSYLPYEKLSQTVKIVKDRLKRPLTLSEKILYGHLDQPKTQDIERGVSYLRLRPDRVAMQDATAQMAMLQFISSGLPKTAVPSTIHCDHLIEAQKGGAQDLARAKDLNKEVFNFLATAGSKYGVGFWKPGSGIIHQIILENYAFPGLLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGIKLTGKLNGWTSAKDVILKVADILTVKGGTGAIVEYFGPGVDSISATGMGTICNMGAEIGATTSVFPYNESMYKYLEATGRKEIAEEARKYKD-LLTADDGANYDQIIEINLDTLTPHVNGPFTPDLASSIDKLGENAKKNGWPLDVKVSLIGSCTNSSYEDMTRAASIAKQALDKGLKAKTIFTITPGSEQVRATIERDGLSKIFADFGGMVLANACGPCIGQWDRQDVKKGEKNTIVTSYNRNFTGRNDANPATHGFVTSPDITTAMAISGRLDFNPLTDELTAADGSKFKLQAPTGLDLPPKGYDPGEDTFQAP---SGSGQVDVSPSSDRLQLLSPFDKWDGKDLEDMKILIKVTGKCTTDHISAAGPWLKYRGHLDNISNNLFLTAINADNGEMNKVKNQVTGEYGAVPATARKYKADGVRWVAIGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDKIDPSDNVSIVGLSSFAPGKPLTAIFKKTNGSKVEVTLNHTFNEQQIEWFKAGSALNRMKEV 772          
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q99798|ACON_HUMAN (Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2)

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 548/749 (73.16%), Postives = 626/749 (83.58%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MS  EPN  ++Y  L +N+ IV+K+LNRP TLSEKI+Y H DDP +Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL KVAVPSTIHCDHLIEA+ GG  DL+RA   N+EVY+FLATA +K+G+GFW+PGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGW+S KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM +YL  T R DIA  A ++KD L+  D  C YDQ+IEI+L++L+PHINGPFTPDL+HP++E+GK A+K GWP +I VGLIGSCTNSSYEDM R+A++AKQAL  GLK K  FTITPGSEQIRATI RDG A+IL   GGIVLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFTGRNDANP THAFVTSPEIVTAL I G L FNP  D LT + G+KF+L  P  D LP   FD GQ+TYQ PP D S   V V P S RLQLL+PF KWDGKDL D+ IL+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGA+N ENG+ N + N  + E+G VP TAR YKK GI WVV+GDENYGEGSSREHAALEPRHLGGR II KSFARIHETNLKKQG+LPLTF+ P DYNKI P DK+++  L    PGKP++C IKH +GT+ETI L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGREDIANLADEFKDHLV-PDPGCHYDQLIEINLSELKPHINGPFTPDLAHPVAEVGKVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDLGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDYLTGTDGKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Match: A0A023GLX2 (Aconitate hydratase, mitochondrial OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 1195.65 bits (3092), Expect = 0.000e+0
Identity = 576/767 (75.10%), Postives = 656/767 (85.53%), Query Frame = 3
Query:   27 FRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            F QS    I   S     V +SR E +  L Y+KL +NL IV+K+LNRP TLSEKILYSH D P+ Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL +VAVPSTIHCDHLIEA+ GG+ DL RA   NKEVY+FL+TA SK+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCP VIGV L G +SGWTS+KD+ILKVA ILTVKGGTGAIVEY+G GV SISCTGMGTICNMGAEIGATTS+FP+N+RM +YL ATNR +I   A  +K+ LLT D NCKYDQV+EI+LN+LEPH+NGPFTPDL+HPIS++GK AK NGWP +I VGLIGSCTNSSYEDM+RAA LAKQALD G+KAKC FT+TPGSEQIRATI RDGQ++I  +FGG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFT RND NPATHAFVTSPE+VTAL I G L+FNP+ DELT +KG+KFKL  P GD LPSRGFD G++TYQ PP D S + V VDP+S RLQLL PFPKWDGKDL DMV+L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA++ E+GE NK+ +  +GEWG VP TAR+YK  GI W VVGDENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQG+LPLTF  P DY+KI+  DKISLL L +LAPGKP++CEIKHKDG+K+TI+L HT N  Q++WF+AGSALNRM E+K
Sbjct:   17 FIQSRSLHISPLSSAAAQVAISRFESDRYLPYEKLEKNLQIVRKRLNRPLTLSEKILYSHLDQPEEQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQVGGAKDLARAKDLNKEVYNFLSTAGSKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPNVIGVKLTGKMSGWTSAKDVILKVAGILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATTSVFPYNSRMRDYLAATNRKEIGAAAEAHKE-LLTPDSNCKYDQVVEINLNELEPHVNGPFTPDLAHPISQLGKNAKANGWPVDIRVGLIGSCTNSSYEDMSRAAFLAKQALDHGIKAKCAFTVTPGSEQIRATIERDGQSKIFDEFGGMVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTSRNDGNPATHAFVTSPELVTALAIAGRLDFNPITDELTGAKGEKFKLKSPEGDELPSRGFDPGEDTYQAPPADGSSVSVDVDPQSQRLQLLSPFPKWDGKDLEDMVVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAISEESGEANKVQHRLTGEWGGVPDTARKYKAEGIKWCVVGDENYGEGSSREHAALEPRHLGGYAIIVKSFARIHETNLKKQGLLPLTFQNPADYDKIKSDDKISLLGLKELAPGKPVKCEIKHKDGSKDTITLNHTMNATQLEWFRAGSALNRMAEVK 782          
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Match: A0A023FKF7 (Aconitate hydratase, mitochondrial OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 1194.49 bits (3089), Expect = 0.000e+0
Identity = 577/767 (75.23%), Postives = 655/767 (85.40%), Query Frame = 3
Query:   27 FRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            F QS    I   S     V +SR EP+  L Y+KL +NL IV+K+LNRP TLSEKILYSH D P+ Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL +VAVPSTIHCDHLIEA+ GG+ DL RA   NKEVY+FL+TA SK+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCP VIGV L G +SGWTS+KD+ILKVA ILTVKGGTGAIVEY+G GV SISCTGMGTICNMGAEIGATTS+FP+N+RM +YL ATNR +I   A  +K+ LLT D NCKYDQV+EI+LN+LEPH+NGPFTPDL+HPIS++GK AK NGWP +I VGLIGSCTNSSYEDM+RAA LAKQALD G+KAKC FT+TPGSEQIRATI RDGQ++I  +FGG+VLANACGPCIGQWDRKDVK G+KNTIVTSYNRNFT RND NPATHAFVTSPE+VTAL I G L+FNPL DELT +KG+KFKL  P GD LP +GFD G++TYQ PP D S ++V VDPKS RLQLL PF KWDGKDL DMV+L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA++ E+GE NK+ +  SGEWG VP TAR+YK  GI W VVGDENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQG+LPLTF  P DY+KI+  D+ISLL L  LAPGKP++CEIKHKDG+K+TI+L HT N  Q++WF+AGSALNRM E+K
Sbjct:   17 FIQSRSLHISPLSSAAAQVALSRYEPDRYLPYEKLKKNLQIVRKRLNRPLTLSEKILYSHLDQPEEQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQIGGAKDLARAKDLNKEVYNFLSTAGSKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPNVIGVKLTGKMSGWTSAKDVILKVAGILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATTSVFPYNSRMRDYLVATNRKEIGAAAEAHKE-LLTPDNNCKYDQVVEINLNELEPHVNGPFTPDLAHPISQLGKNAKANGWPTDIRVGLIGSCTNSSYEDMSRAAFLAKQALDHGIKAKCAFTVTPGSEQIRATIERDGQSKIFDEFGGMVLANACGPCIGQWDRKDVKKGEKNTIVTSYNRNFTSRNDGNPATHAFVTSPELVTALAIAGRLDFNPLTDELTGAKGEKFKLKSPEGDELPRKGFDPGEDTYQAPPADGSSVRVDVDPKSQRLQLLSPFAKWDGKDLEDMVVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAISEESGEANKVQHRLSGEWGGVPDTARKYKAEGIKWCVVGDENYGEGSSREHAALEPRHLGGHAIIVKSFARIHETNLKKQGLLPLTFQNPADYDKIKSDDRISLLGLKDLAPGKPVKCEIKHKDGSKDTITLNHTMNATQLEWFRAGSALNRMAEVK 782          
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Match: A0A131XP84 (Aconitate hydratase, mitochondrial OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 1193.33 bits (3086), Expect = 0.000e+0
Identity = 577/767 (75.23%), Postives = 654/767 (85.27%), Query Frame = 3
Query:   27 FRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            F Q+    +   S     V +SR EP+  L Y+KL +NL +V+K+LNRP TLSEKILYSH D P+ Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL KVAVPSTIHCDHLIEA+ GG+ DL RA   NKEVY+FL+TA SK+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCP VIGV L G +SGWTS+KD+ILKVA ILTVKGGTGAIVEY+G GV SISCTGMGTICNMGAEIGATTS+FP+N+RM +YL ATNR +I   A  +K+ LLT D NCKYDQVIEI+LN+LEPH+NGPFTPDL+HPIS++GK AK  GWP +I VGLIGSCTNSSYEDM+RAA LAKQALD G+KAKC FT+TPGSEQIRATI RDGQ++I  +FGG+VLANACGPCIGQWDRKD+K G KNTIVTSYNRNFT RND NPATHAFVTSPE+VTAL I G L+FNPL DELT SKG+KFKL  P GD LP +GFD G++TYQ PP D S ++V VDPKS RLQLL PFPKWDGKDL DMVIL+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA++ E+GE NK+ +  +GEWG VP TAR+YK  GI W VVGDENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQG+LPLTF  P DY+KI+  DKISLL L  LAPGKP++CEIKHKDG+K+TI+L HT N  Q++WF+AGSALNRM E+K
Sbjct:   17 FIQARSLHVSPLSSAAAQVAISRFEPDRYLPYEKLEKNLQVVRKRLNRPLTLSEKILYSHLDQPEQQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLRKVAVPSTIHCDHLIEAQVGGAKDLARAKDLNKEVYNFLSTAGSKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPNVIGVKLTGKMSGWTSAKDVILKVAGILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATTSVFPYNSRMRDYLVATNRKEIGAAADAHKE-LLTPDSNCKYDQVIEINLNELEPHVNGPFTPDLAHPISQLGKNAKAAGWPIDIRVGLIGSCTNSSYEDMSRAAFLAKQALDHGVKAKCAFTVTPGSEQIRATIERDGQSKIFDEFGGMVLANACGPCIGQWDRKDIKKGDKNTIVTSYNRNFTSRNDGNPATHAFVTSPELVTALAIAGRLDFNPLTDELTGSKGEKFKLKSPEGDELPQKGFDPGEDTYQAPPADGSSVRVDVDPKSQRLQLLSPFPKWDGKDLEDMVILIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAISEESGEANKVQHRLTGEWGGVPDTARKYKAEGIKWCVVGDENYGEGSSREHAALEPRHLGGHAIIVKSFARIHETNLKKQGLLPLTFQNPADYDKIKSDDKISLLGLRDLAPGKPVKCEIKHKDGSKDTITLNHTMNATQLEWFRAGSALNRMAEVK 782          
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Match: A0A131Z0E6 (Aconitate hydratase, mitochondrial OS=Rhipicephalus appendiculatus OX=34631 PE=3 SV=1)

HSP 1 Score: 1189.87 bits (3077), Expect = 0.000e+0
Identity = 575/767 (74.97%), Postives = 654/767 (85.27%), Query Frame = 3
Query:   27 FRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            F QS    +   S     V +S+ EPN  L Y+KL  NL +V+K+LNRP TLSEKILYSH D P+ Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL +VAVPSTIHCDHLIEA+ GG+ DL RA   NKEVY+FL+TA SK+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCP VIGV L G +SGWTS+KD+ILKVA ILTVKGGTGAIVEY+G GV SISCTGMGTICNMGAEIGATTS+FP+N+RM +YL ATNR +I   A  +K+ LLT D  CKYDQVIEI+LN+LEP++NGPFTPDL+HPIS++GK AK  GWP +I VGLIGSCTNSSYEDM+RAA LAKQALD GLK+KC FT+TPGSEQIRATI RDGQ++I  +FGG+VLANACGPCIGQWDRKDVK G+KNTIVTSYNRNFT RND NPATHAFVTSPE+VTAL I G L+FNP+ DELT +KG+KFKL  P GD LP +GFD G++TYQ PP D S ++V VDPKS RLQLL PFPKWDGKDL DMVIL+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA++ E+GE NK+ N  +GEWG VP TAR+YK  GI W VVGDENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQG+LPLTF  P DY+KI+  D+ISLL+L  LAPGKP++CEIKHKDG+KETI+L HT N  Q++WF+AGSALNRM E+K
Sbjct:   17 FIQSRSLHVSPLSSAAAQVAISKFEPNRYLPYEKLERNLEVVRKRLNRPLTLSEKILYSHLDQPQEQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQVGGAKDLARAKDLNKEVYNFLSTAGSKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPNVIGVKLTGKMSGWTSAKDVILKVAGILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATTSVFPYNSRMKDYLVATNRKEIGAAADAHKE-LLTPDSGCKYDQVIEINLNELEPYVNGPFTPDLAHPISQLGKSAKAAGWPIDIRVGLIGSCTNSSYEDMSRAAFLAKQALDHGLKSKCEFTVTPGSEQIRATIERDGQSKIFDEFGGMVLANACGPCIGQWDRKDVKKGEKNTIVTSYNRNFTSRNDGNPATHAFVTSPELVTALAIAGRLDFNPMTDELTGAKGEKFKLEHPRGDELPRKGFDPGEDTYQAPPADGSSVRVDVDPKSQRLQLLSPFPKWDGKDLDDMVILIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAISEESGEANKVQNRITGEWGGVPDTARKYKAEGIKWCVVGDENYGEGSSREHAALEPRHLGGYAIIVKSFARIHETNLKKQGLLPLTFQNPADYDKIKSDDRISLLDLKGLAPGKPVKCEIKHKDGSKETITLNHTMNATQLEWFRAGSALNRMAEVK 782          
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Match: A0A224YM59 (Aconitate hydratase, mitochondrial OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 573/767 (74.71%), Postives = 654/767 (85.27%), Query Frame = 3
Query:   27 FRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            F QS    +   S     V +S+ EPN  L Y+KL  NL +V+K+LNRP TLSEKILYSH D P+ Q++ RG+SYLRLRPDRVAMQDATAQMAMLQFISSGL +VAVPSTIHCDHLIEA+ GG+ DL RA   NKEVY+FL+TA SK+G+GFW+PGSGIIHQII+ENY FPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCP VIGV L G +SGWTS+KD+ILKVA ILTVKGGTGAIVEY+G GV SISCTGMGTICNMGAEIGATTS+FP+N+RM +YL ATNR +I   A  +K+ LLT D  CKYDQVIEI+LN+LEP++NGPFTPDL+HPIS++GK AK  GWP +I VGLIGSCTNSSYEDM+RAA LAKQALD GLK+KC FT+TPGSEQIRATI RDGQ++I  +FGG+VLANACGPCIGQWDRKD+K G+KNTIVTSYNRNFT RND NPATHAFVTSPE+VTAL I G L+FNP+ DELT +KG+KFKL  P GD LP +GFD G++TYQ PP D S ++V VDPKS RLQLL PFPKWDGKDL +MVIL+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA++ E+GE NK+ N  +GEWG VP TAR+YK  GI W VVGDENYGEGSSREHAALEPRHLGG  IIVKSFARIHETNLKKQG+LPLTF  P DY+KI+  D+ISLL+L  LAPGKP++CEIKHKDG+KETI+L HT N  Q++WF+AGSALNRM E+K
Sbjct:   17 FIQSRSLHVSPLSSAAAQVAISKFEPNRYLPYEKLERNLEVVRKRLNRPLTLSEKILYSHLDQPQEQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLKRVAVPSTIHCDHLIEAQVGGAKDLARAKDLNKEVYNFLSTAGSKYGVGFWKPGSGIIHQIILENYAFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPNVIGVKLTGKMSGWTSAKDVILKVAGILTVKGGTGAIVEYFGPGVESISCTGMGTICNMGAEIGATTSVFPYNSRMKDYLVATNRKEIGAAADAHKE-LLTPDSGCKYDQVIEINLNELEPYVNGPFTPDLAHPISQLGKSAKAAGWPIDIRVGLIGSCTNSSYEDMSRAAFLAKQALDHGLKSKCAFTVTPGSEQIRATIERDGQSKIFDEFGGMVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTSRNDGNPATHAFVTSPELVTALAIAGRLDFNPMTDELTGAKGEKFKLEHPRGDELPRKGFDPGEDTYQAPPADGSSVRVDVDPKSQRLQLLSPFPKWDGKDLDNMVILIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAISEESGEANKVQNRITGEWGGVPDTARKYKAEGIKWCVVGDENYGEGSSREHAALEPRHLGGYAIIVKSFARIHETNLKKQGLLPLTFQNPADYDKIKSDDRISLLDLKDLAPGKPVKCEIKHKDGSKETITLNHTMNATQLEWFRAGSALNRMAEVK 782          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Match: aco2 (aconitate hydratase, mitochondrial [Source:NCBI gene;Acc:103029821])

HSP 1 Score: 1145.18 bits (2961), Expect = 0.000e+0
Identity = 552/749 (73.70%), Postives = 634/749 (84.65%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MSR E NS +NY+K+  N+ IV+K+LNRP TLSEKI+Y H DDP  Q++ RG +YLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+ GG+ DLQRA   N+EVY+FLA+A +K+G+GFW+PGSGIIHQII+ENY +PGV+LIGTDSHTPNGGGLG +CIGVGGADAVDVMA IPWELKCPKVIGV L G LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM  YL  T R DIA  A +Y+D LL  D  C+YDQ+IE++L++L+PHINGPFTPDL+HP+S+IG  A+KNGWP ++ VGLIGSCTNSSYEDM RAASLAKQALD+GL  K  FT++PGSEQIRATI RDG A+IL   GG+V+ANACGPCIGQWDR+DVK G+KNTIVTS+NRNFT RNDANPATHAFVTSPEIVTAL I G L FNP  D LT   G+KFKL PPTGD LP+R FD GQ+TYQ PP+D S ++V V+P+S RLQLL+PF KW G DL ++ +L+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGAVN EN  VNKI N  +GE+G VP  AR YK  GI WVVVGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTF+ P DY+KI+P DKIS+  L    PGKP++  IKH DG+KETI L HTFNE QI+WF+AGSALNRMK+L+
Sbjct:   34 VAMSRFESNSFVNYEKMQSNVNIVRKRLNRPLTLSEKIVYGHLDDPAGQEIARGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGAQDLQRAKDVNQEVYNFLASAGAKYGVGFWKPGSGIIHQIILENYAYPGVMLIGTDSHTPNGGGLGSICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGTLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMRTYLNKTGREDIAALADEYQD-LLVPDPGCEYDQLIELNLSELKPHINGPFTPDLAHPVSDIGAVAEKNGWPLDVKVGLIGSCTNSSYEDMGRAASLAKQALDKGLACKSIFTVSPGSEQIRATIERDGYAKILRDVGGVVMANACGPCIGQWDRRDVKKGEKNTIVTSFNRNFTARNDANPATHAFVTSPEIVTALAIAGTLKFNPETDFLTAPNGEKFKLEPPTGDELPARDFDPGQDTYQHPPSDGSGLRVDVNPQSNRLQLLEPFDKWQGGDLDNLQVLIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAVNIENEAVNKIRNQLTGEYGAVPDVARHYKSKGISWVVVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFANPADYDKIRPDDKISITGLKTFTPGKPLQAIIKHIDGSKETIELNHTFNETQIEWFQAGSALNRMKQLQ 781          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Match: ACO2 (aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118])

HSP 1 Score: 526.554 bits (1355), Expect = 2.980e-171
Identity = 255/350 (72.86%), Postives = 305/350 (87.14%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVG 1130
            V MSR E  S +NY+KL+ N+ IV+K+LNRP TL+EKI+Y H DDP  Q++ RG +YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DLQRA + N+EVY+FLA++++K+G+GFW+PGSGIIHQII+ENY +PGVLLIGTDSHTPNGGGLGG+CIGVGGADAVDVMA IPWELKCP VIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+S+SCTGM TICNMGAEIGATTS+FP+N RM  YL  T R +IA+ A +YK+ L+  D+ C+YDQ+IEI+L++L+PHINGPFTPDL+HP+SE+G  A+KNGWP E+ VG
Sbjct:   33 VAMSRFETGSAVNYEKLLNNINIVRKRLNRPLTLAEKIVYGHLDDPTGQEIARGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQTGGVQDLQRAKEVNQEVYNFLASSAAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSVSCTGMATICNMGAEIGATTSVFPYNKRMKTYLDKTGRKEIAELADEYKECLV-PDQGCQYDQLIEINLSELQPHINGPFTPDLAHPVSEVGAAAQKNGWPLEVKVG 381          

HSP 2 Score: 432.565 bits (1111), Expect = 1.107e-135
Identity = 206/304 (67.76%), Postives = 242/304 (79.61%), Query Frame = 3
Query: 1422 GRNDANPATHAFVTSPE--IVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            G + +   T  F  SP   IVTAL I G LNFNP  D LTD+KG+KFKL+ P+GD LP+R FD G++TYQ PPT+   ++V V+P+STRLQLL+PF KW+GKDL ++ +L+K+KGKCTTDHISAAG WLKFRGHLDNISNN+ IGAVN EN  VNKI N  +GE+G VP  AR YK  G+ WVVVGDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTFS P+DY+KI P D+IS+  L   APGKP+   IKH DG+ E I+L HTFNE QI+WF+AGSALNRMKEL+
Sbjct:  382 GSSSSMQLTALFFCSPHLFIVTALAIAGTLNFNPETDFLTDAKGEKFKLVAPSGDELPARDFDPGEDTYQHPPTEGVALRVDVNPQSTRLQLLEPFQKWNGKDLENLRVLIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAVNTENDAVNKIKNQLTGEYGGVPDVARFYKANGVEWVVVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFSDPQDYDKIHPDDQISITGLKSFAPGKPLIAVIKHIDGSSEKITLNHTFNETQIEWFQAGSALNRMKELQ 685          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 268.085 bits (684), Expect = 5.348e-78
Identity = 130/288 (45.14%), Postives = 184/288 (63.89%), Query Frame = 3
Query: 2781 GFFFVLVIA----KESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            G F  L +     + S  G+ +++L + L  N     +N LERP  +D +SL V     LMQI+DVDEKNQ+L +N+W+ L W D++  W+   Y  +T +  P N++W+PDILLYNSADERFDATF  N+VV  DG  H +PPG+FKSTC I++KW+PFD Q+C +KFGSWTY G  +DL               + +    + NGEWD++  +  R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IST+ALL FL+P D+GEKISLG    + +T F
Sbjct:    5 GVFLCLAVTICLWRVSLQGEHQRRLYQDLMKN-----YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM------------EADISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVF 275          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 264.618 bits (675), Expect = 6.221e-77
Identity = 129/277 (46.57%), Postives = 181/277 (65.34%), Query Frame = 3
Query: 2802 IAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            I+  S  G+ +++L + L  N     +N LERP  +D +SL V     LMQI+DVDEKNQ+L +N+W+ L W D++  W+   Y  +T +  P N++W+PDILLYNSADERFDATF  N+VV  DG  H +PPG+FKSTC I++KW+PFD Q+C +KFGSWTY G  +DL               + +    + NGEWD++  K  R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IST+ALL FL+P D+GEKISLG    + +T F
Sbjct:    3 ISLMSLQGEHQRRLYQDLMKN-----YNPLERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM------------EADISGYIANGEWDLVG-KGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVF 261          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Match: si:ch73-380n15.2 (si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-161])

HSP 1 Score: 263.848 bits (673), Expect = 2.629e-76
Identity = 126/281 (44.84%), Postives = 176/281 (62.63%), Query Frame = 3
Query: 2790 FVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            F   +   S  G+ +++L + L  N     +N LERP  +D   L V + + L+QIIDVDEKNQ+L TN W+ L WTD +  W+P  Y  +  L  P+N++W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWTY G L+DL               + +    + NGEWD++     R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   28 FPSAVLMNSLQGEHQRRLYKELLTN-----YNRLERPVANDSAPLVVELGLTLLQIIDVDEKNQVLITNAWLQLGWTDVYLTWNPDNYPGVQNLRFPSNQIWTPDILLYNSADERFDATFHTNVLVNASGTCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTYNGWLLDL------------QMQEVDISTYIPNGEWDLVGVPGKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVF 291          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 198.364 bits (503), Expect = 1.918e-55
Identity = 93/196 (47.45%), Postives = 127/196 (64.80%), Query Frame = 3
Query: 3045 IAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            + +  +  L    +++W PDILLYNSADERFDATF  N++V Y G    +PPGM KSTC I+++W+PFD QKC +KFGSWT++G LIDL               + +    + NGEWD++     R+   Y CC E Y D++Y L I+RRTLYY  NL+VPC++IS ++LL FL+P D+GEKISLG    + +T F
Sbjct:    1 MEHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQML------------EADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVF 184          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 199.904 bits (507), Expect = 2.480e-55
Identity = 97/271 (35.79%), Postives = 159/271 (58.67%), Query Frame = 3
Query: 2820 AGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            A +A  +L + LF      ++N   RP  +    + V   + + Q++ +DE NQI+ TN+W+   W DY F W+P  +  +  + +P++++W+PDI+LYN+AD  F        ++KYDG +  +PP +FKS+C+I++ ++PFD Q C MKFGSWTY+   IDL+              K N ++  E+GEW ++     +   KY CC + Y DI+Y + ++R  L+YT NLI+PC++IS + +L F +P D GEK++L     + +T F
Sbjct:    4 ASEAASRLYKTLFT-----SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGT----------KINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVF 259          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 192.2 bits (487), Expect = 4.327e-52
Identity = 89/219 (40.64%), Postives = 133/219 (60.73%), Query Frame = 3
Query: 2943 FLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            F   + D DEKNQ++ TNVW+  +W DY   WDP  Y N+T++ +P+  +W PDI+LYN+AD  F  T      + + G +   PP ++KS+C I++ ++PFD Q C MKFGSWTY+   IDL+    +           + ++  E+GEW ++      +  KY CCP+ Y DI+Y   I+R  L+YT NLI+PC++IS + +L F +P D GEKI+L
Sbjct:    6 FRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARDV----------DLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITL 214          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Match: aco1 (aconitase 1, soluble [Source:ZFIN;Acc:ZDB-GENE-031118-76])

HSP 1 Score: 195.282 bits (495), Expect = 2.887e-51
Identity = 217/816 (26.59%), Postives = 355/816 (43.50%), Query Frame = 3
Query:  258 LRPDRVAMQDATAQMAMLQFIS--------SGLPKVA---VPSTIHCDHLIEARDGGSADLQRANQS-----NKEVYDFLATASSKF-GLGFWRPGSGIIHQIIIENYGFPGVLL---------IGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALK--YKDVLLTAD-----ENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISE--------IGKRAKKNGW---PEE------------------------ISVGLIGSCTNSSYEDMARAAS-LAKQALDRGLKAKCTF--TITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQW----DRKDVKMGQKNTI---VTSYNRNFTGRNDANPATHA-FVTSPEIVTALVITGNLNFNPLVDEL-TDSKGQKFKL--LPPTGD---------TLPSR------GFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWD-----GKDLIDMVILMKIKGKCTTDHISAAG-----------------------KWLKFRGHLDNISNNMFIGA--VNAENGEVN-KIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPS--DKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRM 2315
             RP RV +QD T   A++ F +         G P       P+ +  DH ++       D  + NQ      NKE + FL   S  F  +    PG+GI+HQ+ +E       LL         +GTDSHT    GLG L  GVGG +A  VM   P  L  P+V+G  L G +S   +S D++L +   L   G     VE++G GV  +S     TI NM  E GAT + FPF+   + YL+ T R     + ++   K V L  D     ++  Y QV+E+DL  + P ++GP  P     + +        + ++    G+   PE                         + +  I SCTN+S   +  AA  LAK+A++ GL  K     +++PGS  +   +   G    + K G  V+   C  C+G      D     + Q N +   V S NRNF GR   +P+  A ++ SP +V A  I G ++ +   + L  +++G++  L  + PT +          +PS         + G + +   P  P       D KST ++    F K        + +++  +L+ +    TTDHIS AG                        +   RG+   ++   F  A  +N   G+   K  ++ SG+  D+   A +Y++ G P V++  ++YG GSSR+ AA  P  LG R ++ +S+ R+H +NL   G++PL F   ++   +  +  +K ++L   +  PG  I+ ++      +  + L+    E ++ +++ G  LN M
Sbjct:   88 FRPARVILQDFTGIPAVVDFAAMRDAVQRLGGDPSRVNPTCPADLVIDHSVQVDVSRKPDSLQKNQELEFERNKERFQFLKWGSHTFKNMLVVPPGTGIVHQVNLEYLARLVFLLDGLYYPDSLVGTDSHTTMINGLGILGWGVGGIEAESVMLGQPIGLLLPEVVGYKLTGRVSPLATSTDVVLTITKHLRQVGVVSKFVEFFGPGVVQLSIADRATIANMCPEYGATAAFFPFDTVGMMYLQQTGREGAKMKYVEDYLKAVKLFRDYSDTSQDPDYSQVVELDLASVVPSVSGPKRPQDRVAVEDMKTDFQCCLNQKVGFKGFQVPPERQRDVCPFRFEEDVEQAEYELAHGSVVIAAITSCTNTSNPSVMLAAGLLAKKAVEAGLSVKPYIKTSLSPGSGVVTYYLNASGVLPYMEKLGFEVVGYGCMTCVGNSGPLPDSVVQAISQANLVACGVLSGNRNFEGR--IHPSARANYLASPPLVIAYAIAGTVSIDLKSEPLGVNAEGKEVFLQDIWPTREEIQEVERQFVIPSMFREVYDKLEKGNDRWNSLPY-PDMTLYPWDTKSTFIKSPSFFEKLSLEPKPVETIVEAHVLLFLGDSITTDHISPAGSIPRNSPAARFLANLGMTPREFNSYGARRGNDAVMTRGTFANARLLNKLVGKPGPKTLHVPSGDTLDIYDAAERYQQHGQPLVILAGKDYGSGSSRDWAAKGPYLLGVRAVLAESYDRVHRSNLVGVGIVPLQFMPEQNAQNLGLTGREKFTILIPERPMPGMAIDVQLSTGKTFQAIMRLE---TEVELAYYQHGGILNYM 897          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 186.422 bits (472), Expect = 4.791e-51
Identity = 95/248 (38.31%), Postives = 145/248 (58.47%), Query Frame = 3
Query: 2895 RPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSV--DKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            RP      ++ V   + + Q++DVDEKNQ++ TNVW+  +W D +  W+P  Y  I ++ +PA+ +W PDI+LY++AD RF+ +     VVK+DG +   PP ++KS+C I++ ++PFD Q C MKFGSWTY+G L+DL+         N    +G      +NGEW+ L+    + V  D +   P     I+Y   I+R  L+YT  LIVPC+ +S + +  F +P D GEKISL     + +T F
Sbjct:   51 RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIM-------VNSDVDRGEY---FDNGEWEFLNATGNKGVRLDGHRFYPY----ITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVF 284          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Yeast
Match: ACO1 (Aconitase; required for the tricarboxylic acid (TCA) cycle and also independently required for mitochondrial genome maintenance; component of the mitochondrial nucleoid; mutation leads to glutamate auxotrophy; human homolog ACO2 can complement yeast null mutant [Source:SGD;Acc:S000004295])

HSP 1 Score: 1033.48 bits (2671), Expect = 0.000e+0
Identity = 497/741 (67.07%), Postives = 590/741 (79.62%), Query Frame = 3
Query:   96 LEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMK 2318
            LE +S +NYK+ VE L IV+K+LNRPFT +EKILY H DDP  QD+ RG SYL+LRPDRVA QDATAQMA+LQF+S+GLP+VA P T+HCDHLI+A+ GG  DL+RA   NKEVYDFLA+A++K+ +GFW+PGSGIIHQI++ENY FPG L+IGTDSHTPN GGLG L IGVGGADAVDVMA  PWELK PK++GV L G ++GWTS KDIILK+A I TVKGGTG IVEY+G+GV++ S TGMGTICNMGAEIGATTS+FPFN  M+EYL+AT R  IA  A  Y   LL+AD++ +YD+V+EIDLN LEP+INGPFTPDL+ P+S++ + A  N WP ++ VGLIGSCTNSSYEDM+R+AS+ K A   GLK+K  FT+TPGSEQIRATI RDGQ E   +FGGIVLANACGPCIGQWDR+D+K G KNTIV+SYNRNFT RND NP THAFV SPE+VTA  I G+L FNPL D+L D  G +F L PP GD LP RG+D+G+NTYQ PP D S ++VKV P S RLQLL PF  WDGKD  DM IL+K  GK TTDHIS AG WLK+RGHL+NISNN  IGA+NAEN + N + N+ +GE+  VP TAR Y+  GI WVV+GDEN+GEGSSREHAALEPR LGG  II KSFARIHETNLKKQG+LPL F  P DY+KI P D+I +L LA+LAPGKP+   +  K+G      L HTFN+ QI+WFK GSALN++K
Sbjct:   33 LEDHSFINYKQNVETLDIVRKRLNRPFTYAEKILYGHLDDPHGQDIQRGVSYLKLRPDRVACQDATAQMAILQFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVYDFLASATAKYNMGFWKPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGRPWELKAPKILGVKLTGKMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGDGVDTFSATGMGTICNMGAEIGATTSVFPFNKSMIEYLEATGRGKIADFAKLYHKDLLSADKDAEYDEVVEIDLNTLEPYINGPFTPDLATPVSKMKEVAVANNWPLDVRVGLIGSCTNSSYEDMSRSASIVKDAAAHGLKSKTIFTVTPGSEQIRATIERDGQLETFKEFGGIVLANACGPCIGQWDRRDIKKGDKNTIVSSYNRNFTSRNDGNPQTHAFVASPELVTAFAIAGDLRFNPLTDKLKDKDGNEFMLKPPHGDGLPQRGYDAGENTYQAPPADRSTVEVKVSPTSDRLQLLKPFKPWDGKDAKDMPILIKAVGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNVYTGEYKGVPDTARDYRDQGIKWVVIGDENFGEGSSREHAALEPRFLGGFAIITKSFARIHETNLKKQGLLPLNFKNPADYDKINPDDRIDILGLAELAPGKPVTMRVHPKNGKPWDAVLTHTFNDEQIEWFKYGSALNKIK 773          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Yeast
Match: ACO2 (Putative mitochondrial aconitase isozyme; similarity to Aco1p, an aconitase required for the TCA cycle; expression induced during growth on glucose, by amino acid starvation via Gcn4p, and repressed on ethanol [Source:SGD;Acc:S000003736])

HSP 1 Score: 831.247 bits (2146), Expect = 0.000e+0
Identity = 416/755 (55.10%), Postives = 547/755 (72.45%), Query Frame = 3
Query:  120 YKKLVENLGIVKKKLNR-PFTLSEKILYSHFDDPKNQ------DVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKY--KDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQK--NTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDP---SKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAP-----GKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            Y KL+ NL  +K+  N  P TL+EKILYSH  DP+          +RG  YL+L PDRVAMQDA+AQMA+LQF+++GL + +VP++IHCDHLI  +DG + DL  +  +N+EV+DFL + + ++G+ FW PGSGIIHQI++EN+  PG++++GTDSHTPN GGLG + IGVGGADAVD +   PWELK PK++GV L G L+GW++ KD+I K+A +LTV+GGTG IVEY+GEGV+++SCTGM TICNMGAEIGATTS FP+      YL+ATNR+++A+ A     K   L AD++ +YD+VIEIDL+ +EPH+NGPFTPDLS PIS+  +++ K  WP+++S GLIGSCTNSSY+DM+R   L KQA   GLK +  F +TPGSEQIRAT+ RDG  +I  + G  VLANACGPCIGQW+R+DV    K  NTI TS+NRNF  RND N  T  F+TSPEIVTA+  +G+  FNPL D +    G+ FK  PP GD LP RGF+ G++ +  P  DP   S +++KVDP S RLQLL+PF  W+GK+L    +L+K++GKCTTDHISAAG WLK++GHL+NIS N  IGA N E GEVNK +++   E+ D+P    ++K  G PW V+ + NYGEGS+REHAAL PR LGG +++VKSFARIHETNLKKQG+LPLTF+   DY+KI   D +  LNL  +       G  I+ +I   +G   TI  KHT +++QID+FKAGSA+N +  ++
Sbjct:   35 YAKLLTNLDKIKQITNNAPLTLAEKILYSHLCDPEESITSSDLSTIRGNKYLKLNPDRVAMQDASAQMALLQFMTTGLNQTSVPASIHCDHLIVGKDGETKDLPSSIATNQEVFDFLESCAKRYGIQFWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELKAPKILGVKLTGKLNGWSTPKDVITKLAGLLTVRGGTGYIVEYFGEGVSTLSCTGMATICNMGAEIGATTSTFPYQEAHKRYLQATNRAEVAEAADVALNKFNFLRADKDAQYDKVIEIDLSAIEPHVNGPFTPDLSTPISQYAEKSLKENWPQKVSAGLIGSCTNSSYQDMSRVVDLVKQASKAGLKPRIPFFVTPGSEQIRATLERDGIIDIFQENGAKVLANACGPCIGQWNREDVSKTSKETNTIFTSFNRNFRARNDGNRNTMNFLTSPEIVTAMSYSGDAQFNPLTDSIKLPNGKDFKFQPPKGDELPKRGFEHGRDKFY-PEMDPKPDSNVEIKVDPNSDRLQLLEPFKPWNGKEL-KTNVLLKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKETGEVNKAYDLDGTEY-DIPGLMMKWKSDGRPWTVIAEHNYGEGSAREHAALSPRFLGGEILLVKSFARIHETNLKKQGVLPLTFANESDYDKISSGDVLETLNLVDMIAKDGNNGGEIDVKITKPNGESFTIKAKHTMSKDQIDFFKAGSAINYIGNIR 786          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Yeast
Match: LYS4 (Homoaconitase; catalyzes the conversion of homocitrate to homoisocitrate, which is a step in the lysine biosynthesis pathway [Source:SGD;Acc:S000002642])

HSP 1 Score: 140.584 bits (353), Expect = 1.445e-34
Identity = 169/661 (25.57%), Postives = 283/661 (42.81%), Query Frame = 3
Query:  180 LSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTI--HCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIEN-YGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLK-------ATNRSDIAQE---ALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCT----FTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPL 2111
            L+EKI+ S+  +     VV    Y+ ++P      D +  +A L+F+  G  K+  PS I    DH          D+Q  ++ N   Y  +   + K  +  +  G GI HQI+IE  Y FP  + + +DSH+   GGLG L   +   DA  + A      + P V  V LKG L    S KDII+ +  +          +E+ G+ +N++      TI NM  E GA + LFP +  ++++ K         N   I  +   AL+ K  +  AD++  Y + + IDL  L  +++GP +  +S+ + ++ ++  K      I+   + SCTNS   D+  AA +     D     K      F +   S +I A   + G  E L K G I L + CGPCIG      ++ G+    +++ NRNF GR  +  A  A++ SP +V A  + G ++ +P  + L+ S+      +P          F   +    E P    ++  + +     +++L+ FP+    +L+           C  D+I+  G +     + D++     +  V  EN +      +  G+                  +VV   N+G GSSRE AA      G  +++  SF  I   N     +L L
Sbjct:   23 LTEKIVQSYAVNLPEGKVVHSGDYVSIKPAHCMSHDNSWPVA-LKFMGLGATKIKNPSQIVTTLDH----------DIQNKSEKNLTKYKNIENFAKKHHIDHYPAGRGIGHQIMIEEGYAFPLNMTVASDSHSNTYGGLGSLGTPIVRTDAAAIWATGQTWWQIPPVAQVELKGQLPQGVSGKDIIVALCGLFNNDQVLNHAIEFTGDSLNALPIDHRLTIANMTTEWGALSGLFPVDKTLIDWYKNRLQKLGTNNHPRINPKTIRALEEKAKIPKADKDAHYAKKLIIDLATLTHYVSGPNSVKVSNTVQDLSQQDIK------INKAYLVSCTNSRLSDLQSAADVVCPTGDLNKVNKVAPGVEFYVAAASSEIEADARKSGAWEKLLKAGCIPLPSGCGPCIG-LGAGLLEPGEVG--ISATNRNFKGRMGSKDAL-AYLASPAVVAASAVLGKIS-SP-AEVLSTSE------IP----------FSGVKTEIIENPVVEEEVNAQTEAPKQSVEILEGFPREFSGELV----------LCDADNINTDGIYPGKYTYQDDVPKEK-MAQVCMENYDAEFRTKVHPGD------------------IVVSGFNFGTGSSREQAATALLAKGINLVVSGSFGNIFSRNSINNALLTL 615          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Yeast
Match: LEU1 (Isopropylmalate isomerase; catalyzes the second step in the leucine biosynthesis pathway [Source:SGD;Acc:S000002977])

HSP 1 Score: 100.523 bits (249), Expect = 7.264e-22
Identity = 101/356 (28.37%), Postives = 156/356 (43.82%), Query Frame = 3
Query:  468 FGLGFWRPGSGIIHQI-IIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQE---ALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPIS-------EIGKRAKKNGWPEEIS-VGL---------------IGSCTNSSYEDMARAASLAK-QALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATH 1451
            FG+   R   GI+H I   E +  PG  ++  DSHT   G  G L  G+G ++   V+A         K + + + G LS   +SKD+IL +  ++   GGTG ++E+ GE + ++S     ++CNM  E GA   +   +    +Y K    +    E   A+ Y   L T DE  K+D  I I+   + P I    +P  + PI+        +    KK+G    ++ +GL               IGSCTN   ED+  AA++ + Q L   +K      + PGS  ++     +G  +I  + G       C  C+G     D+    +    TS NRNF GR  A   TH
Sbjct:  111 FGMSDAR--QGIVHTIGPEEGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEVEHVLATQTIIQAKSKNMRITVNGKLSPGITSKDLILYIIGLIGTAGGTGCVIEFAGEAIEALSMEARMSMCNMAIEAGARAGMIKPDETTFQYTKGRPLAPKGAEWEKAVAYWKTLKT-DEGAKFDHEINIEAVDVIPTITWGTSPQDALPITGSVPDPKNVTDPIKKSGMERALAYMGLEPNTPLKSIKVDKVFIGSCTNGRIEDLRSAAAVVRGQKLASNIKLA---MVVPGSGLVKKQAEAEGLDKIFQEAGFEWREAGCSICLGM--NPDILDAYERCASTS-NRNFEGRQGALSRTH 457          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Match: EDO47951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKR4])

HSP 1 Score: 1044.65 bits (2700), Expect = 0.000e+0
Identity = 503/679 (74.08%), Postives = 576/679 (84.83%), Query Frame = 3
Query:  279 MQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRM 2315
            MQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEA+DGGS DL +A   NKEVY+FLATAS+K+G+GFW+PGSGIIHQI++ENY FPGV+LIGTDSHTPNGGGLGG+C+GVGGADAVDVMA++PWELKCPKVIGV L G L GWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGMGTICNMGAEIGATTS+FP+N+RM  YL+AT RS +A+ A +YK  LL++DE   YDQVIEI+L+ LEPH+NGPFTPDL+HPIS++G+ AK+ GWP ++ VGLIGSCTNSSYEDM RAAS+A+QA+  G+K++  FT+TPGSEQIRATI RDG A  L +FGG VLANACGPCIGQW+R+D+K G+KNTIVTSYNRNFTGRNDANP THAFV SPEIVTAL I GNL FNP  D LT   G+ FKL  P GD LPS+GFD G++TYQ PP+D S + V VDP S RLQLL PF  WDGKDL DM +L+K+KGKCTTDHISAAG WLK+RGHLDNISNNMFIGA+N EN   NK+ N  +GE+G VP TAR YK  G+ W V+GDENYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQGMLPLTF+ P DY+ IQP DK+SL  L  +APGKP+EC I  KDG+  TI+L HT N+ QI WFKAGSALN+M
Sbjct:    1 MQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAKDGGSQDLAKAKDINKEVYNFLATASAKYGVGFWKPGSGIIHQIVLENYAFPGVMLIGTDSHTPNGGGLGGVCVGVGGADAVDVMANMPWELKCPKVIGVKLTGELKGWTSPKDVILKVAGILTVKGGTGAIVEYFGPGVDSISCTGMGTICNMGAEIGATTSIFPYNHRMEAYLRATERSKVAELANQYKH-LLSSDEGADYDQVIEINLSVLEPHVNGPFTPDLAHPISKLGQTAKQQGWPLDVKVGLIGSCTNSSYEDMTRAASIAEQAMKHGVKSRSIFTVTPGSEQIRATIERDGIAATLREFGGTVLANACGPCIGQWNRQDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVASPEIVTALSIAGNLAFNPETDTLTGKDGKPFKLDSPYGDELPSQGFDPGEDTYQAPPSDSSGVSVDVDPNSQRLQLLSPFDVWDGKDLDDMTVLIKVKGKCTTDHISAAGPWLKYRGHLDNISNNMFIGAINIENDTPNKVKNQLTGEYGGVPDTARDYKSKGVKWCVIGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGMLPLTFANPADYDSIQPEDKLSLKGLKDIAPGKPVECVITRKDGSSSTITLNHTMNDAQIGWFKAGSALNKM 678          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 201.83 bits (512), Expect = 4.890e-58
Identity = 99/259 (38.22%), Postives = 160/259 (61.78%), Query Frame = 3
Query: 2832 EKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDAT---FPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            E KLL+ LF N     +N   RP      S+ V + + L QIID+DE+NQIL +N+W+  KW +    WDP  + N+T++ +   R+WRPD++LYN+AD   D     F   + +K+DG    + P +FKSTC+ ++ ++PFD Q C +KFGSWTY+G  ++++   +N T           +  + NGEW++    A R+V  Y CC E Y D+++ L+I+R TL+Y  N+++PC +I+ + LL +++PP++GE+I+L
Sbjct:    2 ENKLLKDLFSN-----YNPSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIV--PENGTDIG-------IDKFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITL 246          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 202.986 bits (515), Expect = 4.609e-56
Identity = 101/259 (39.00%), Postives = 157/259 (60.62%), Query Frame = 3
Query: 2832 EKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDAT---FPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISL 3599
            E  LL  L      DAH +   P  +  + +  + L  L+Q+++VD+KNQI+ TNVW+  +WT+    WDP  Y  IT + I A+++W PDI+LYNSAD  F      +   +++ +DG      P  F+STCQI++ ++PFD Q C MKFGSWT+E  ++DL  F D +   +  +        M++ EWD+++    R+V+ Y CC   + D++     +R+ L+Y FNLIVPC+II+ M LLGF++PP++GE+I+L
Sbjct:   12 EHTLLGDLLKGYNKDAHPV---PILNKTQYMVTFGL-ELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFE--VVDLDIFADKSPLHSSQY--------MKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITL 256          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 198.749 bits (504), Expect = 6.230e-55
Identity = 100/271 (36.90%), Postives = 156/271 (57.56%), Query Frame = 3
Query: 2829 AEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDA---TFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            AEK+LL  LF N  ++      RP  +D   + V   + L+QII V+ K+Q++  +VWI  KWT+    W+   Y  I ++ +   ++W PDI+LYN+ADE +      +  +++   DG      P  F STC IN++++PFD+Q C +KFGSWTY GN + +    D+A          +    + NGEW +L+  A  +   Y CC   + D++ YLEI+R+ LYY FNLI+PC +I+T+ L+ F +PP++GEK+ LG    + +T F
Sbjct:   37 AEKRLLADLFRNYDSEV-----RPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSA----------DLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVF 292          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 192.2 bits (487), Expect = 3.151e-54
Identity = 91/260 (35.00%), Postives = 147/260 (56.54%), Query Frame = 3
Query: 2832 EKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDA---TFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLG 3602
            E++L+  L      +A     RP  +   +L V+  + ++QI++V+ +NQI+ TNVWI  +W +    W P  Y  + T+ + A  +W PDI+LY+SAD  F      +  ++++  DG      P  F+STC+I++ ++PFD Q C MKFGSWTY    +D+            +     +   +++ EWD++S    R    Y CCPE   D++  + I+R+ L+Y FNLI PC+I+ TM LLGF +PP++GE+I+L 
Sbjct:    1 EQRLISDLLQGYSRNA-----RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDI----------QASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLS 245          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Match: aco2 (aconitase 2 [Source:NCBI gene;Acc:101164929])

HSP 1 Score: 1147.11 bits (2966), Expect = 0.000e+0
Identity = 552/749 (73.70%), Postives = 634/749 (84.65%), Query Frame = 3
Query:   81 VPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELK 2327
            V MSR EP S + Y KL  N+ IV+K+LNRP TLSEKI+Y H DDP NQ++ RG +YLRLRPDRVAMQDATAQMAMLQFISSGLP+VAVPSTIHCDHLIEA+ GG  DL RA + N+EVY+FL++A +K+G+GFW+PGSGIIHQII+ENY +PGV+LIGTDSHTPNGGGLG +CIGVGGADAVDVMA IPWELKCPKVIGV L G+LSGWTS KD+ILKVA ILTVKGGTGAIVEY+G GV+SISCTGM TICNMGAEIGATTS+FP+N+RM  YL+ T R++IA+ + K+KD LL  DE C+YDQ+IE++L++L+PHINGPFTPDL+HP+SEIG  AKKNGWP E+ VGLIGSCTNSSYEDM RAASLAKQALDRGLK K  FT+TPGSEQIRATI RDG  +ILS  GG+VLANACGPCIGQWDR+DVK G+KNTIVTS+NRNFT RNDANPATHAFVTSPEIVTAL I G L+FNP  D LT   G+KFKL  PTGD LP+R FD GQ+TYQ PP D   + V V P S RLQLL+PF KW G DL DM +L+K+KGKCTTDHISAAG WLKFRGHLDNISNNM IGAVN+EN  +NK+ N  +GE+G VP  AR YK  G+ WVVVGD+NYGEGSSREHAALEPRHLGGR IIVKSFARIHETNLKKQG+LPLTFS P DY++I+P DKIS+  L   APGKP+   +KH DG++ET+ L H+FNE QI+WF+AGSALNRMKEL+
Sbjct:   32 VAMSRFEPTSFVGYDKLQSNVEIVQKRLNRPLTLSEKIVYGHLDDPHNQEIDRGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPRVAVPSTIHCDHLIEAQSGGVNDLARAKEVNEEVYNFLSSAGAKYGVGFWKPGSGIIHQIILENYAYPGVMLIGTDSHTPNGGGLGAICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMRTYLEKTGRAEIAELSEKHKD-LLVPDEGCEYDQLIELNLDELKPHINGPFTPDLAHPVSEIGAVAKKNGWPLEVKVGLIGSCTNSSYEDMGRAASLAKQALDRGLKCKAQFTVTPGSEQIRATIERDGYTKILSDVGGVVLANACGPCIGQWDRRDVKKGEKNTIVTSFNRNFTARNDANPATHAFVTSPEIVTALAIAGTLDFNPETDYLTAPNGEKFKLEAPTGDELPARDFDPGQDTYQHPPPDGGALHVNVSPSSNRLQLLEPFDKWSGNDLEDMQVLIKVKGKCTTDHISAAGPWLKFRGHLDNISNNMLIGAVNSENDGINKLKNHLTGEYGGVPDVARHYKANGLSWVVVGDDNYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFSNPSDYDRIRPDDKISIRGLKTFAPGKPLTALVKHSDGSEETLQLNHSFNETQIEWFRAGSALNRMKELQ 779          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000017908.2 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101167346])

HSP 1 Score: 261.922 bits (668), Expect = 1.253e-75
Identity = 128/275 (46.55%), Postives = 176/275 (64.00%), Query Frame = 3
Query: 2808 KESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            +E   G  ++KL R L  N     +N LERP ++D   + V + I L+QIIDVDEKNQ+L TN W+ + WTD +  W P +Y  +  L  P+N +W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWT+ G L+DL     + +T             + NGEWD++   A R+   Y CC E Y D++Y + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   23 QECHGGVYQRKLYRDLMVN-----YNRLERPVQNDSAPIVVELGITLLQIIDVDEKNQVLITNAWLQMYWTDIYLSWSPESYPGVQNLRFPSNMVWVPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQMMDADIST------------YIPNGEWDLVGVPAKRNELYYDCCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVF 280          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 261.536 bits (667), Expect = 2.188e-75
Identity = 126/275 (45.82%), Postives = 177/275 (64.36%), Query Frame = 3
Query: 2808 KESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            K S  G+ ++KL + L  N     +N LERP  +D  ++ V +   L+QIIDVDEKNQ+L TN W+ L WTD +  W+P  Y  +  L  P++++W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWT+ G L+DL     + +T             + NGEWD++   A R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISLG    + +T F
Sbjct:   23 KGSMQGEYQRKLYKELLAN-----YNRLERPVVNDSAAILVELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQMLDVDIST------------YISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVF 280          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 259.996 bits (663), Expect = 3.414e-75
Identity = 123/275 (44.73%), Postives = 177/275 (64.36%), Query Frame = 3
Query: 2784 FFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH 3608
            + +   + K S  G+ ++KL + L  N     +N LERP  +D  ++ V +   L+QIIDVDEKNQ+L TN W+ L WTD +  W+P  Y  +  L  P++++W PDILLYNSADERFDATF  N++V   G    +PPG+ KSTC I+++W+PFD QKC +KFGSWT+ G L+DL     + +T             + NGEWD++   A R+   Y CC E Y D+++ + ++RRTLYY  NL++PC++IS +ALL FL+P D+GEKISL ++
Sbjct:   15 YIWAAFLFKGSMQGEYQRKLYKELLAN-----YNRLERPVVNDSAAILVELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQMLDVDIST------------YISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLAQY 272          
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000023459.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101168927])

HSP 1 Score: 258.84 bits (660), Expect = 4.996e-75
Identity = 126/273 (46.15%), Postives = 175/273 (64.10%), Query Frame = 3
Query: 2814 SFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            S  G  +++L + L  N     +N LERP  +D  SL V+    L+QI+DVDEKNQ+L TN+W+ L W D++  W+   Y  +T +  P +++WRPDILLYNSADERFDA+F  NI+V   G    +PPG+FKSTC I+++W+PFD Q+C +KFGSWTY G  +DL     NA T             + NGEWD++     RS   Y CC E Y D+++ + ++RRTLYY  N ++PC++IST+ALL FL+P D+GEKISLG    + +T F
Sbjct:    4 SLQGVHQRRLYKELIRN-----YNPLERPVSNDSHSLTVHFSFSLLQIMDVDEKNQVLTTNIWLQLYWKDFYLQWNMSDYPGVTNVRFPDSQIWRPDILLYNSADERFDASFHTNILVNSSGYCQYLPPGIFKSTCHIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMI--NADT----------TGYIANGEWDLVEVPGQRSERFYDCCKEPYPDVTFTVVMRRRTLYYGLNFLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVF 259          
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Match: SMESG000002904.1 (SMESG000002904.1)

HSP 1 Score: 1575.84 bits (4079), Expect = 0.000e+0
Identity = 775/776 (99.87%), Postives = 776/776 (100.00%), Query Frame = 3
Query:    3 MFQIFGLNFRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNXXXXXXXXXXXXXADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELKS 2330
            MFQIFGLNFRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKF+LLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELKS
Sbjct:    1 MFQIFGLNFRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIVKKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLATASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNGGGLGGLCIGVGGADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADILTVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVEYLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFTPDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQALDRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQWDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGNLNFNPLVDELTDSKGQKFRLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKIQVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWLKFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAGIPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGMLPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISLKHTFNENQIDWFKAGSALNRMKELKS 776          
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Match: SMESG000002905.1 (SMESG000002905.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 281/289 (97.23%), Postives = 283/289 (97.92%), Query Frame = 3
Query: 2766 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLG    + +T F
Sbjct:    1 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGVTILLSLTVF 289          
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Match: SMESG000011827.1 (SMESG000011827.1)

HSP 1 Score: 330.487 bits (846), Expect = 3.741e-100
Identity = 144/290 (49.66%), Postives = 208/290 (71.72%), Query Frame = 3
Query: 2766 MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPET-YIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            MKF    F +L        G   K+LL +LF++ +   HN LERP  D+ +SL V   + L+QI+D+DEKNQ+++TN+W+D+ WTDY+F W+P+ + NITTL++P+ ++W+PDIL+YNSADE+FD T+PAN+VV   G MH VPPGMFKSTC+INI W+PFD Q C MKFG+WTY G+ +D    CD  + C   +G  + E+ ++NGEW+++   A +  + YPCCPE+ +IDI ++++++R+ LYY FNL+ PCIIISTM+LL F +PP AGEKI++G    + +T F
Sbjct:    1 MKF---VFVLLGCLNVCHCGYHGKRLLSYLFNDSKFYGHNSLERPVVDENQSLEVQFKVTLLQILDLDEKNQVMNTNIWLDITWTDYNFKWNPLEFGNITTLILPSEKVWKPDILMYNSADEKFDGTYPANVVVTNQGLMHMVPPGMFKSTCKINITWFPFDQQSCVMKFGTWTYTGDKVDFRLKCDEGSNCTGQYGSADTESFLKNGEWEIVDVPAEKHTETYPCCPESPFIDIKFHVKMRRKALYYIFNLMTPCIIISTMSLLVFTLPPGAGEKITMGVTIMLSLTMF 287          
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 311.997 bits (798), Expect = 2.848e-93
Identity = 154/292 (52.74%), Postives = 202/292 (69.18%), Query Frame = 3
Query: 2775 YCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFC----DNATT--CNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            +  F+ +L+   E   G  EKKLLR+LFD  R DAHNILERP+K+D + + V +  FL Q+IDVDEKNQI+HTN+W+DLKW DYHF W+P  Y  I+   IPA+R+W+PD+LL+NSAD++FD T+P N+VVK    M  VPPGMFKSTC I+I W+PFD+Q C +KFGSWTY G  IDL   C    DN  T  C +T    N E+ + NGE+D++     R   +Y    ETY++I   + ++R+ LYY FNLI+PC++ISTMALL F +PPDAGEKISLG    + +T F
Sbjct:   12 FAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTET-SVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMF 300          
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Match: SMESG000068777.1 (SMESG000068777.1)

HSP 1 Score: 311.997 bits (798), Expect = 3.948e-93
Identity = 154/292 (52.74%), Postives = 202/292 (69.18%), Query Frame = 3
Query: 2775 YCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDKKSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNITTLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKSTCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFC----DNATT--CNQTFGKGNAENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFNLIVPCIIISTMALLGFLIPPDAGEKISLGKH*YICITDF 3632
            +  F+ +L+   E   G  EKKLLR+LFD  R DAHNILERP+K+D + + V +  FL Q+IDVDEKNQI+HTN+W+DLKW DYHF W+P  Y  I+   IPA+R+W+PD+LL+NSAD++FD T+P N+VVK    M  VPPGMFKSTC I+I W+PFD+Q C +KFGSWTY G  IDL   C    DN  T  C +T    N E+ + NGE+D++     R   +Y    ETY++I   + ++R+ LYY FNLI+PC++ISTMALL F +PPDAGEKISLG    + +T F
Sbjct:   27 FAVFWLILISLSEFHCGINEKKLLRYLFDQNRPDAHNILERPSKNDSQPVEVRMKAFLTQLIDVDEKNQIIHTNIWLDLKWKDYHFQWNPSVYGGISGFKIPADRVWKPDLLLFNSADDKFDGTYPTNVVVKNSSLMQWVPPGMFKSTCDIDITWFPFDSQNCTVKFGSWTYSGKYIDLRLQCPDDDDNEKTGVCTET-SVINLESYVLNGEFDIVDCPINRL--QYSFNNETYMNILMTIRMQRKPLYYIFNLIIPCVLISTMALLEFTLPPDAGEKISLGVTILLSMTMF 315          
The following BLAST results are available for this feature:
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACO20.000e+073.16aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118][more]
ACO20.000e+070.80aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118][more]
CHRNA77.532e-7644.69cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.17.532e-7644.69cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA72.240e-7544.69cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aco-20.000e+072.32Probable aconitate hydratase, mitochondrial [Sour... [more]
aco-20.000e+073.75Probable aconitate hydratase, mitochondrial [Sour... [more]
aco-20.000e+073.75Probable aconitate hydratase, mitochondrial [Sour... [more]
acr-166.309e-7545.32Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-192.513e-7442.09AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mAcon10.000e+073.25gene:FBgn0010100 transcript:FBtr0346587[more]
mAcon10.000e+073.25gene:FBgn0010100 transcript:FBtr0300425[more]
mAcon10.000e+073.25gene:FBgn0010100 transcript:FBtr0081473[more]
mAcon10.000e+073.25gene:FBgn0010100 transcript:FBtr0343871[more]
mAcon20.000e+071.13gene:FBgn0037862 transcript:FBtr0082336[more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aco20.000e+074.10aconitase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GE... [more]
aco20.000e+073.97aconitase 2, mitochondrial [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch73-380n15.21.994e-7645.36si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
FO907089.12.218e-7646.89neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.22.380e-7645.36si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aco20.000e+072.76aconitase 2 [Source:NCBI gene;Acc:496933][more]
aco20.000e+072.53aconitase 2 [Source:NCBI gene;Acc:496933][more]
aco20.000e+067.01aconitase 2 [Source:NCBI gene;Acc:496933][more]
aco20.000e+066.22aconitase 2 [Source:NCBI gene;Acc:496933][more]
ENSXETT00000021532.17.128e-7644.69cholinergic receptor, nicotinic alpha 7 [Source:NC... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aco20.000e+073.70aconitase 2, mitochondrial [Source:MGI Symbol;Acc:... [more]
Aco21.572e-8577.54aconitase 2, mitochondrial [Source:MGI Symbol;Acc:... [more]
Chrna72.321e-7543.96cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna24.063e-6238.85cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna24.063e-6238.85cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99KI0|ACON_MOUSE0.000e+073.70Aconitate hydratase, mitochondrial OS=Mus musculus... [more]
sp|P20004|ACON_BOVIN0.000e+073.56Aconitate hydratase, mitochondrial OS=Bos taurus O... [more]
sp|Q9ER34|ACON_RAT0.000e+073.70Aconitate hydratase, mitochondrial OS=Rattus norve... [more]
sp|P34455|ACON_CAEEL0.000e+072.32Probable aconitate hydratase, mitochondrial OS=Cae... [more]
sp|Q99798|ACON_HUMAN0.000e+073.16Aconitate hydratase, mitochondrial OS=Homo sapiens... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023GLX20.000e+075.10Aconitate hydratase, mitochondrial OS=Amblyomma tr... [more]
A0A023FKF70.000e+075.23Aconitate hydratase, mitochondrial OS=Amblyomma ca... [more]
A0A131XP840.000e+075.23Aconitate hydratase, mitochondrial OS=Hyalomma exc... [more]
A0A131Z0E60.000e+074.97Aconitate hydratase, mitochondrial OS=Rhipicephalu... [more]
A0A224YM590.000e+074.71Aconitate hydratase, mitochondrial OS=Rhipicephalu... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aco20.000e+073.70aconitate hydratase, mitochondrial [Source:NCBI ge... [more]
ACO22.980e-17172.86aconitase 2 [Source:HGNC Symbol;Acc:HGNC:118][more]
chrna75.348e-7845.14neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna76.221e-7746.57neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.22.629e-7644.84si:ch73-380n15.2 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008550.11.918e-5547.45pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrna32.480e-5535.79cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna2a4.327e-5240.64cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
aco12.887e-5126.59aconitase 1, soluble [Source:ZFIN;Acc:ZDB-GENE-031... [more]
chrnb3b4.791e-5138.31cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
ACO10.000e+067.07Aconitase; required for the tricarboxylic acid (TC... [more]
ACO20.000e+055.10Putative mitochondrial aconitase isozyme; similari... [more]
LYS41.445e-3425.57Homoaconitase; catalyzes the conversion of homocit... [more]
LEU17.264e-2228.37Isopropylmalate isomerase; catalyzes the second st... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479510.000e+074.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436424.890e-5838.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448964.609e-5639.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420546.230e-5536.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479693.151e-5435.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aco20.000e+073.70aconitase 2 [Source:NCBI gene;Acc:101164929][more]
ENSORLT00000017908.21.253e-7546.55neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.22.188e-7545.82neuronal acetylcholine receptor subunit alpha-7 [S... [more]
si:ch73-380n15.23.414e-7544.73neuronal acetylcholine receptor subunit alpha-7 [S... [more]
ENSORLT00000023459.24.996e-7546.15neuronal acetylcholine receptor subunit alpha-7 [S... [more]
back to top
BLAST of Aconitate hydratase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002904.10.000e+099.87SMESG000002904.1[more]
SMESG000002905.10.000e+097.23SMESG000002905.1[more]
SMESG000011827.13.741e-10049.66SMESG000011827.1[more]
SMESG000068777.12.848e-9352.74SMESG000068777.1[more]
SMESG000068777.13.948e-9352.74SMESG000068777.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006208 ID=SMED30006208|Name=Aconitate hydratase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3982bp
CCATGTTTCAAATTTTTGGTTTAAATTTTCGTCAATCCTTACTCAATCAG
ATAAAATATACATCAAGATGTTATTGCTCTGTTCCTATGAGCAGACTAGA
ACCGAATTCGAAACTGAATTACAAAAAATTGGTTGAGAATTTAGGGATTG
TTAAAAAAAAATTAAATCGGCCATTTACTCTTTCGGAGAAAATACTTTAT
AGCCACTTCGATGATCCGAAAAACCAAGATGTAGTACGTGGGGAAAGCTA
TTTACGATTACGACCGGATCGGGTAGCCATGCAAGATGCTACTGCTCAAA
TGGCAATGTTACAGTTTATTAGCAGTGGATTGCCGAAAGTAGCTGTACCA
TCAACAATTCATTGTGATCATTTAATTGAAGCTAGGGATGGTGGCTCTGC
TGATTTACAAAGAGCAAATCAATCTAATAAAGAAGTCTATGATTTTTTAG
CAACAGCTTCTTCAAAATTTGGATTAGGATTTTGGCGTCCAGGAAGTGGA
ATAATCCATCAAATAATTATTGAGAATTATGGATTTCCGGGAGTATTGCT
AATTGGCACTGATTCCCATACACCAAATGGTGGAGGGCTAGGTGGGTTGT
GTATCGGAGTGGGTGGTGCCGATGCAGTGGACGTCATGGCTGATATTCCA
TGGGAGCTTAAGTGTCCAAAAGTGATTGGTGTGCACCTTAAAGGCGCATT
GAGTGGTTGGACCAGTAGCAAGGATATCATATTAAAAGTAGCAGATATTC
TGACAGTAAAAGGCGGCACTGGTGCCATTGTTGAATATTATGGTGAAGGA
GTAAATTCAATTAGCTGCACTGGAATGGGAACAATCTGCAATATGGGTGC
TGAAATCGGTGCAACAACAAGCTTGTTTCCATTCAATAATCGGATGGTAG
AATATCTGAAGGCGACTAACCGGTCAGATATTGCTCAGGAGGCATTAAAA
TACAAGGACGTTCTTCTAACTGCCGATGAGAATTGCAAATACGATCAGGT
GATTGAGATCGATCTCAATAAATTGGAACCGCACATCAATGGTCCATTCA
CGCCCGATTTGTCACACCCTATTTCCGAAATTGGGAAACGCGCCAAGAAA
AATGGATGGCCGGAAGAAATATCTGTCGGATTAATCGGATCATGTACCAA
TTCATCATATGAAGACATGGCTAGGGCTGCGTCTCTCGCTAAACAAGCTC
TTGATCGAGGATTGAAGGCTAAATGTACGTTTACAATAACACCAGGCAGT
GAGCAGATTCGGGCGACTATTACTCGTGATGGCCAGGCGGAAATTCTCAG
CAAGTTTGGTGGTATTGTGCTGGCAAATGCCTGTGGACCTTGTATTGGTC
AGTGGGATCGCAAGGATGTGAAAATGGGCCAGAAAAACACGATAGTTACA
TCTTACAATCGGAATTTCACCGGGCGAAACGATGCCAATCCTGCAACCCA
TGCATTCGTGACGAGCCCTGAAATCGTCACCGCATTGGTCATCACTGGAA
ATCTCAATTTTAATCCACTTGTTGATGAATTGACTGATTCAAAAGGACAG
AAATTCAAATTATTACCGCCTACTGGTGACACGTTGCCATCTCGTGGATT
CGATTCTGGACAAAACACCTATCAAGAACCTCCAACTGATCCATCTAAAA
TCCAAGTGAAAGTTGATCCGAAAAGCACTCGATTACAGCTTTTGGATCCA
TTTCCAAAGTGGGATGGAAAGGATCTGATCGATATGGTTATTCTCATGAA
GATCAAAGGTAAATGTACCACCGATCACATTAGTGCCGCTGGGAAATGGC
TCAAATTTCGTGGTCATCTGGATAACATATCAAATAACATGTTTATTGGC
GCGGTCAATGCAGAAAATGGTGAGGTTAACAAAATCCATAATATTACCTC
GGGCGAGTGGGGGGATGTTCCATCCACTGCACGTCAATATAAGAAAGCAG
GGATCCCGTGGGTTGTGGTCGGGGATGAGAATTACGGTGAAGGCAGCAGT
AGAGAACATGCGGCATTGGAGCCTAGACATCTCGGTGGTCGAGTCATCAT
CGTGAAAAGCTTTGCCAGAATTCACGAAACCAACCTCAAGAAACAAGGAA
TGTTGCCATTGACATTCTCAAAACCTGAAGATTATAACAAAATCCAGCCT
AGTGATAAAATATCACTGCTTAATCTTGCCAAACTTGCCCCTGGAAAGCC
TATCGAGTGTGAAATCAAGCACAAGGATGGAACGAAAGAAACGATATCTC
TGAAACACACATTCAACGAAAATCAAATTGATTGGTTCAAAGCAGGCAGT
GCATTGAACCGCATGAAAGAGCTCAAATCATAATTCAATTTCTATTTTGT
ACAATAGTTGTTACCTTGTCTATCCCATCGAGTTGATATGGACATAGAAA
ATGCTCGATAAAGCTAGATTTGAGTAATAAATGAACGATTTAGTTTATTT
TTCTTCTACAGATTTCCAATGCTTGTTTGTTTGTGTGTTATTTATTCATC
TGGCTGTTTGCTTGTGTGTATTCATGTTTGTGTGTTATTCGTTGATGTGT
GTGTGTGTTGCATTCATCGGTTTTTCTTTGTGTTGCTGTGATGTTCATTC
ATTCTTCTTTTTGTGTGTTTGTCTGACTGCGAATCGGAGTTCGAGTCAGC
AATAAGAATGAGAATTTTACAAGTAGTAGCGAATTGAGAATTACAGAATT
CAATGTTTGAGATTTTAAAGTTAGTTCAAATGTTCAACGGAATTGCTTGA
TTGGATTTTTTATAAATGAAATTTTATTGTGGATTTTTTTTCGTATTGGT
TATTGCTAAAGAGTCTTTTGCTGGTAAAGCAGAAAAGAAGTTATTGCGTC
ACTTATTTGATAATAAACGTACAGACGCTCACAATATTTTGGAAAGACCA
GCTAAGGATGATAAGAAATCTTTAGCTGTTTACATATTAATTTTTTTAAT
GCAGATCATCGATGTGGATGAGAAAAATCAAATTCTTCATACAAATGTGT
GGATAGATCTGAAATGGACAGATTATCATTTCGTTTGGGATCCGATTGCT
TATAATAATATAACAACTCTAGTCATTCCAGCAAATCGCTTGTGGCGACC
GGATATTTTGCTTTACAACAGCGCAGATGAACGGTTTGATGCGACTTTTC
CTGCGAATATTGTTGTTAAATACGACGGGGAAATGCATACCGTACCTCCA
GGAATGTTTAAGTCAACTTGTCAAATTAATATAAAATGGTATCCATTTGA
TACTCAAAAGTGTAAAATGAAATTTGGAAGTTGGACATATGAGGGTAACT
TAATTGATCTACTGTTTTTTTGTGACAATGCAACAACGTGTAATCAAACG
TTTGGAAAAGGCAATGCAGAAAATATAATGGAAAATGGAGAATGGGATGT
CTTAAGCTTCAAAGCTATTAGAAGTGTCGATAAATATCCTTGTTGTCCTG
AAACGTATATAGATATATCCTATTATTTAGAGATCAAACGTAGAACTCTC
TATTATACGTTTAACCTAATCGTTCCATGTATTATTATTTCAACAATGGC
ATTACTAGGATTCCTTATTCCTCCTGATGCTGGAGAAAAGATTTCTCTGG
GTAAACATTGATATATTTGTATAACAGATTTTCAAATAATAAATATTCTT
ATAAATAGATTGATAAATTTCTCAGGTGTAAAAATTTTATTCTTATTATT
AAAAATTTTAGCCATTAAATTTTAAAATAATCATCCTATAAATCAAGTTA
ACTAAGCAGGGAGTCGCATCATAATTGATCGCCAGGGTCAAATTGAAAAT
CCTCATAAATGTATTAAAATGAAATAAGTAATGTTGTACATCCGATGTTA
CTCATTTATGTCCACTTAGACATGTATTTAAGTAGGTAGAAATGTCCCAC
CTGGCGCACTTTTTGGTACCCCTCCTATAAATTTTTTTTACATAAACACA
TTAATTGTAAAAATAATGAATACGAACAAGAA
back to top

protein sequence of SMED30006208-orf-1

>SMED30006208-orf-1 ID=SMED30006208-orf-1|Name=SMED30006208-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MKFYCGFFFVLVIAKESFAGKAEKKLLRHLFDNKRTDAHNILERPAKDDK
KSLAVYILIFLMQIIDVDEKNQILHTNVWIDLKWTDYHFVWDPIAYNNIT
TLVIPANRLWRPDILLYNSADERFDATFPANIVVKYDGEMHTVPPGMFKS
TCQINIKWYPFDTQKCKMKFGSWTYEGNLIDLLFFCDNATTCNQTFGKGN
AENIMENGEWDVLSFKAIRSVDKYPCCPETYIDISYYLEIKRRTLYYTFN
LIVPCIIISTMALLGFLIPPDAGEKISLGKH*
back to top

protein sequence of SMED30006208-orf-2

>SMED30006208-orf-2 ID=SMED30006208-orf-2|Name=SMED30006208-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=777bp
MFQIFGLNFRQSLLNQIKYTSRCYCSVPMSRLEPNSKLNYKKLVENLGIV
KKKLNRPFTLSEKILYSHFDDPKNQDVVRGESYLRLRPDRVAMQDATAQM
AMLQFISSGLPKVAVPSTIHCDHLIEARDGGSADLQRANQSNKEVYDFLA
TASSKFGLGFWRPGSGIIHQIIIENYGFPGVLLIGTDSHTPNGGGLGGLC
IGVGGADAVDVMADIPWELKCPKVIGVHLKGALSGWTSSKDIILKVADIL
TVKGGTGAIVEYYGEGVNSISCTGMGTICNMGAEIGATTSLFPFNNRMVE
YLKATNRSDIAQEALKYKDVLLTADENCKYDQVIEIDLNKLEPHINGPFT
PDLSHPISEIGKRAKKNGWPEEISVGLIGSCTNSSYEDMARAASLAKQAL
DRGLKAKCTFTITPGSEQIRATITRDGQAEILSKFGGIVLANACGPCIGQ
WDRKDVKMGQKNTIVTSYNRNFTGRNDANPATHAFVTSPEIVTALVITGN
LNFNPLVDELTDSKGQKFKLLPPTGDTLPSRGFDSGQNTYQEPPTDPSKI
QVKVDPKSTRLQLLDPFPKWDGKDLIDMVILMKIKGKCTTDHISAAGKWL
KFRGHLDNISNNMFIGAVNAENGEVNKIHNITSGEWGDVPSTARQYKKAG
IPWVVVGDENYGEGSSREHAALEPRHLGGRVIIVKSFARIHETNLKKQGM
LPLTFSKPEDYNKIQPSDKISLLNLAKLAPGKPIECEIKHKDGTKETISL
KHTFNENQIDWFKAGSALNRMKELKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR006248Aconitase_mito-like
IPR036008Aconitase_4Fe-4S_dom
IPR002394Nicotinic_acetylcholine_rcpt
IPR006201Neur_channel
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
IPR006029Neurotrans-gated_channel_TM
IPR001030Acoase/IPM_deHydtase_lsu_aba
IPR015932Aconitase_dom2
IPR000573AconitaseA/IPMdHydase_ssu_swvl
IPR015931Acnase/IPM_dHydase_lsu_aba_1/3
IPR015928Aconitase/3IPM_dehydase_swvl
IPR018136Aconitase_4Fe-4S_BS
Vocabulary: cellular component
TermDefinition
GO:0045211postsynaptic membrane
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005739mitochondrion
Vocabulary: molecular function
TermDefinition
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0003994aconitate hydratase activity
GO:0016829lyase activity
GO:0046872metal ion binding
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0008152metabolic process
GO:0006099tricarboxylic acid cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001030Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha domainPRINTSPR00415ACONITASEcoord: 192..207
score: 47.96
coord: 343..357
score: 37.01
coord: 135..148
score: 27.26
coord: 178..191
score: 52.92
coord: 268..281
score: 46.65
coord: 158..166
score: 41.04
coord: 377..388
score: 67.52
coord: 254..267
score: 56.56
coord: 436..449
score: 44.9
IPR001030Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha domainPFAMPF00330Aconitasecoord: 62..499
e-value: 4.7E-147
score: 490.7
IPR015928Aconitase/3-isopropylmalate dehydratase, swivelGENE3DG3DSA:3.20.19.10coord: 557..776
e-value: 2.1E-103
score: 346.6
IPR006248Aconitase, mitochondrial-likeTIGRFAMTIGR01340TIGR01340coord: 40..771
e-value: 0.0
score: 1297.4
IPR015931Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3GENE3DG3DSA:3.30.499.10coord: 339..513
e-value: 1.1E-62
score: 212.4
IPR015931Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3GENE3DG3DSA:3.30.499.10coord: 24..224
e-value: 6.4E-89
score: 299.2
IPR015932Aconitase, domain 2GENE3DG3DSA:3.40.1060.10coord: 225..338
e-value: 5.7E-41
score: 140.9
IPR000573Aconitase A/isopropylmalate dehydratase small subunit, swivel domainPFAMPF00694Aconitase_Ccoord: 580..707
e-value: 1.1E-44
score: 152.0
NoneNo IPR availablePANTHERPTHR43160FAMILY NOT NAMEDcoord: 24..775
NoneNo IPR availablePANTHERPTHR43160:SF3ACONITATE HYDRATASE, MITOCHONDRIALcoord: 24..775
NoneNo IPR availableCDDcd01584AcnA_Mitochondrialcoord: 90..501
e-value: 0.0
score: 803.581
NoneNo IPR availableSUPERFAMILYSSF52016LeuD/IlvD-likecoord: 553..772
IPR018136Aconitase family, 4Fe-4S cluster binding sitePROSITEPS01244ACONITASE_2coord: 436..449
IPR018136Aconitase family, 4Fe-4S cluster binding sitePROSITEPS00450ACONITASE_1coord: 373..389
IPR036008Aconitase, iron-sulfur domainSUPERFAMILYSSF53732Aconitase iron-sulfur domaincoord: 29..547