Methyltranfer_dom domain-containing protein

Overview
NameMethyltranfer_dom domain-containing protein
Smed IDSMED30006203
Length (bp)1404
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltranfer_dom domain-containing protein (SMED30006203) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltranfer_dom domain-containing protein (SMED30006203) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltranfer_dom domain-containing protein (SMED30006203) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltranfer_dom domain-containing protein (SMED30006203) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006203

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006203SMESG000013679.1 Contig2840GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006203SMESG000031406.1 Contig2840GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30006203SMESG000031406.1 dd_Smed_v4_3811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006203SMESG000031406.1 dd_Smed_v4_3811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006203SMESG000031406.1 dd_Smed_v4_3811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006203SMESG000031406.1 dd_Smed_v4_3811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006203SMESG000031406.1 dd_Smed_v6_3811_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Match: mettl24 (methyltransferase like 24 [Source:NCBI gene;Acc:100145735])

HSP 1 Score: 54.299 bits (129), Expect = 1.811e-7
Identity = 45/190 (23.68%), Postives = 83/190 (43.68%), Query Frame = 3
Query:  456 ITKNSFTCNYSIRIGRPDDG-----GWDVCFVGNFNL----KKSNCLSYSFGV----NNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIM-----KMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTE----ELQGRTTSLASY 959
            IT     C++ I+ G+ D        W VC    FNL    +   C  YS G+    NN   F+  MA +  C V  FDPS+     ++     +W +++ +   D   +     +     K+ ++L +F      +    ++   +EW   E++I +G++ ++ Q++FE H      E+ G  +S+  Y
Sbjct:  122 ITTTQIICSHRIKNGQTDQSVDASKPWTVCLDEKFNLAHQIRNKQCRVYSLGLGEDDNN---FEVNMASR-GCEVHRFDPSIAS--TQIHEGERLWHHRLSIDWRDPKPAIATHKLHITTKKLGTILNEFGHWKIDVLKADMES--AEWKILENLILEGVVEQIGQLIFEIHLHWPGFEVSGNDSSVVRY 303          
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Match: sp|B1WB06|MET24_XENTR (Methyltransferase-like protein 24 OS=Xenopus tropicalis OX=8364 GN=mettl24 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 9.596e-7
Identity = 45/190 (23.68%), Postives = 83/190 (43.68%), Query Frame = 3
Query:  456 ITKNSFTCNYSIRIGRPDDG-----GWDVCFVGNFNL----KKSNCLSYSFGV----NNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIM-----KMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTE----ELQGRTTSLASY 959
            IT     C++ I+ G+ D        W VC    FNL    +   C  YS G+    NN   F+  MA +  C V  FDPS+     ++     +W +++ +   D   +     +     K+ ++L +F      +    ++   +EW   E++I +G++ ++ Q++FE H      E+ G  +S+  Y
Sbjct:  122 ITTTQIICSHRIKNGQTDQSVDASKPWTVCLDEKFNLAHQIRNKQCRVYSLGLGEDDNN---FEVNMASR-GCEVHRFDPSIAS--TQIHEGERLWHHRLSIDWRDPKPAIATHKLHITTKKLGTILNEFGHWKIDVLKADMES--AEWKILENLILEGVVEQIGQLIFEIHLHWPGFEVSGNDSSVVRY 303          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267FSJ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001702g1 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 3.959e-55
Identity = 109/239 (45.61%), Postives = 150/239 (62.76%), Query Frame = 3
Query:  402 LNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSN-CLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKED-TTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            +NLG  T  Q E+ Y+A + +    C +S R+G   DGGWDVCF   F++ +S+ C+++SFG+NNIW+FDD++A+KY C V  FDPSMTG  D  QR    WFY+ GLG E+    S+GWK+  +  LL +    +R IDI+KIDIE  EW S E  IQ+G L +VKQ+LFE+HT E+   +T    Y R +++W  L+N GFR WK H N         T   R CC+EHY++NT  +
Sbjct:  374 VNLGNQTERQVEDMYFAFVEQQQIACPFSRRVGDSGDGGWDVCFTAPFDISRSDPCVAFSFGINNIWKFDDQLAEKYRCKVYMFDPSMTGTSDH-QRKQTSWFYRTGLGAENKVDSSSGWKMRTLCHLLDELGYVNRPIDIVKIDIEHWEWSSLERAIQEGCLHQVKQLLFESHTGEMVQVST---DYTRLVRVWLGLFNIGFRSWKWHKNPTSIIYRSRTGAERACCYEHYMLNTKLI 608          

HSP 2 Score: 161.384 bits (407), Expect = 1.019e-39
Identity = 98/256 (38.28%), Postives = 147/256 (57.42%), Query Frame = 3
Query:  345 IRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            IR +S +    P   +   LN     V++ E  Y   + + +  C+ + R+GR DDGGW++C  G F  K+  C S+SFG+NNIWEFDD++AK ++C V TFDPSM    +   R   + F   GL     T  + W +      L++F  +DR+IDILKIDIE SEW + ++ ++DG L  VKQ+L ETH +    R  +   Y+ +  +  +L++ GFR W  +WN FG + S++    RTCC E Y +N+N+L
Sbjct:   91 IRLRSNRQRHYPRGNQLATLN-----VSELESLYENVLLELTAECSTNRRLGRTDDGGWNLCLTGPFGPKQP-CYSFSFGINNIWEFDDQVAKLFKCRVITFDPSMNK--ESFVRSEQIVFLNEGLHAAKGTL-HSWPVDSYLGFLRRFKAEDRVIDILKIDIEHSEWPALKTAVKDGSLKNVKQLLLETHIK----RKATANDYLEYFAVLESLHSLGFRLWHYNWNTFGNFISRHDATLRTCCHELYYINSNFL 333          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267G515 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001919g1 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.805e-54
Identity = 107/239 (44.77%), Postives = 149/239 (62.34%), Query Frame = 3
Query:  402 LNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSN-CLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKED-TTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            +NL   T  Q E+ Y+A + +    C +S R+G   DGGWDVCF   F++ +S+ C+++SFG+NNIW+FDD++A+KY C V  FDPSMTG  D  QR    WFY+ GLG E+    S+GWK+  +  LL +    +R ID++KIDIE  EW S E  IQ+G L +VKQ+LFE+HT E+   +T    Y R +++W  L+N GFR WK H N         T   R CC+EHY++NT  +
Sbjct:  374 VNLSNQTERQVEDMYFAFVEQQQIACPFSRRVGDSGDGGWDVCFTAPFDISRSDPCVAFSFGINNIWKFDDQLAEKYRCKVYMFDPSMTGTSDH-QRKQTSWFYRTGLGAENKVDSSSGWKMRTLCHLLDELGYVNRPIDLVKIDIEHWEWSSLERAIQEGCLHQVKQLLFESHTGEMVQVST---DYTRLVRVWLGLFNIGFRSWKWHKNPTSIIYRSRTGAERACCYEHYMLNTKLI 608          

HSP 2 Score: 161.384 bits (407), Expect = 1.039e-39
Identity = 98/256 (38.28%), Postives = 147/256 (57.42%), Query Frame = 3
Query:  345 IRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            IR +S +    P   +   LN     V++ E  Y   + + +  C+ + R+GR DDGGW++C  G F  K+  C S+SFG+NNIWEFDD++AK ++C V TFDPSM    +   R   + F   GL     T  + W +      L++F  +DR+IDILKIDIE SEW + ++ ++DG L  VKQ+L ETH +    R  +   Y+ +  +  +L++ GFR W  +WN FG + S++    RTCC E Y +N+N+L
Sbjct:   91 IRLRSNRQRHYPRGNQLATLN-----VSELESLYENVLLELTAECSTNRRLGRTDDGGWNLCLTGPFGPKQP-CYSFSFGINNIWEFDDQVAKLFKCRVITFDPSMNK--ESFVRSERIVFLNEGLHAAKGTL-HSWPVDSYLGFLRRFKAEDRVIDILKIDIEHSEWPALKTAVKDGSLKNVKQLLLETHIK----REATANDYLEYFAVLESLHSLGFRLWHYNWNTFGNFISRHDATLRTCCHELYYINSNFL 333          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267GUE8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031174g1 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.587e-48
Identity = 101/234 (43.16%), Postives = 143/234 (61.11%), Query Frame = 3
Query:  420 TVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSN-CLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY--SSKNTFKTRTCCFEHYLVNTNYL 1112
            T  Q E  Y+  + +    C YS+RIG   DGGWDVCF   FN+++S  C+++SFG+NNIW +DD +A KY C V  FDPSM    ++ QR +  WFY+ GL  E+    NGWK+  + +L  +   +++ IDILKIDIE  EW SFE    +G L+ VKQ+LFE+HT EL       + Y R +++W  L+  GFR WK H N    +  S+ +  + R CC+EHY++NTN +
Sbjct:  370 TSVQLEVMYFGILEQVHVNCPYSMRIGGTADGGWDVCFSRPFNIEESKPCIAFSFGINNIWSYDDILADKYHCNVHMFDPSMNA--NDHQRKTTSWFYRTGLSSENKVEGNGWKMRTLCTLFSELGYRNKKIDILKIDIEHWEWTSFEKAFSEGCLTNVKQLLFESHTSEL---VRQKSDYGRLIRVWQGLFKLGFRTWKWHKNPQSLFFKSAASPKEQRACCYEHYMLNTNLV 598          

HSP 2 Score: 146.362 bits (368), Expect = 2.218e-34
Identity = 92/231 (39.83%), Postives = 131/231 (56.71%), Query Frame = 3
Query:  423 VTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY-SSKNTFKTRTCCFEHYLVNTNYL 1112
            V + E+ Y + + + +  C+   R GR  +GGW++C VG F   K  C SYSFGVNNIWEFDDE+A  + C V  FDP M+   +   R   V F K G+  +  T  NGW +      LK+F  ++ IIDILK D+E  EW + E+ ++DG L  VKQ+L ET  E    +T +  ++ ++  +  +LY+ GFRQWK++WN    Y SS N       C E Y +N N+L
Sbjct:  104 VAELEDLYESVVLETTADCSTERRFGRKGNGGWELCLVGPFTPTKP-CFSYSFGVNNIWEFDDEVAATFRCQVTAFDPRMSQ--ESHMRNDKVAFIKEGVYSKQGTL-NGWSVDSYLGHLKRFGAENFIIDILKFDVESLEWPALETAVRDGSLGNVKQLLLETRIE----KTRTKKNFKKYFSVLKSLYDTGFRQWKHNWNTNCNYRSSLNKDLDGKFCHELYYININFL 326          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267EB56 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031174g2 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.312e-48
Identity = 101/234 (43.16%), Postives = 142/234 (60.68%), Query Frame = 3
Query:  420 TVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSN-CLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY--SSKNTFKTRTCCFEHYLVNTNYL 1112
            T  Q E  Y+  + +    C YS+RIG   DGGWDVCF   FN+++S  C+++SFG+NNIW +DD +A KY C V  FDPSM     + QR +  WFY+ GL  E+    NGWK+  + +L  +   +++ IDILKIDIE  EW SFE    +G L+ VKQ+LFE+HT EL       + Y R +++W  L+  GFR WK H N    +  S+ +  + R CC+EHY++NTN +
Sbjct:  370 TSVQLEVMYFGILEQVHVNCPYSMRIGGTADGGWDVCFSRPFNIEESKPCIAFSFGINNIWSYDDILADKYHCNVHMFDPSMNA--KDHQRKTTSWFYRTGLSSENKVEGNGWKMRTLCTLFSELGYRNKKIDILKIDIEHWEWTSFEKAFSEGCLTNVKQLLFESHTSEL---VRQKSDYGRLIRVWQGLFKLGFRTWKWHKNPQSLFFKSAASPKEQRACCYEHYMLNTNLV 598          

HSP 2 Score: 144.436 bits (363), Expect = 1.253e-33
Identity = 91/231 (39.39%), Postives = 130/231 (56.28%), Query Frame = 3
Query:  423 VTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY-SSKNTFKTRTCCFEHYLVNTNYL 1112
            V + E+ Y + + + +  C+   R GR  +GGW++C VG F   K  C SYSFGVNNIWEFDDE+A  + C V  FDP M+   +   R   V F K G+  +  T  NGW +      LK+F  ++ IIDILK D+E  EW + E+ ++DG L  VKQ+L ET  E    +T +  ++ ++  +  +LY+ GFRQWK++W     Y SS N       C E Y +N N+L
Sbjct:  104 VAELEDLYESVVLETTADCSTERRFGRKGNGGWELCLVGPFTPTKP-CFSYSFGVNNIWEFDDEVAATFRCQVTAFDPRMSQ--ESHMRNDKVAFIKEGVYSKQGTL-NGWSVDSYLGHLKRFGAENFIIDILKFDVESLEWPALETAVRDGSLGNVKQLLLETRIE----KTRTKKNFKKYFSVLKSLYDTGFRQWKHNWKTNCNYRSSLNKDLDGKFCHELYYININFL 326          
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Match: A0A267DQX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031174g3 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.360e-48
Identity = 101/234 (43.16%), Postives = 142/234 (60.68%), Query Frame = 3
Query:  420 TVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSN-CLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY--SSKNTFKTRTCCFEHYLVNTNYL 1112
            T  Q E  Y+  + +    C YS+RIG   DGGWDVCF   FN+++S  C+++SFG+NNIW +DD +A KY C V  FDPSM     + QR +  WFY+ GL  E+    NGWK+  + +L  +   +++ IDILKIDIE  EW SFE    +G L+ VKQ+LFE+HT EL       + Y R +++W  L+  GFR WK H N    +  S+ +  + R CC+EHY++NTN +
Sbjct:  370 TSVQLEVMYFGILEQVHVNCPYSMRIGGTADGGWDVCFSRPFNIEESKPCIAFSFGINNIWSYDDILADKYHCNVHMFDPSMNA--KDHQRKTTSWFYRTGLSSENKVEGNGWKMRTLCTLFSELGYRNKKIDILKIDIEHWEWTSFEKAFSEGCLTNVKQLLFESHTSEL---VRQKSDYGRLIRVWQGLFKLGFRTWKWHKNPQSLFFKSAASPKEQRACCYEHYMLNTNLV 598          

HSP 2 Score: 146.747 bits (369), Expect = 1.935e-34
Identity = 92/231 (39.83%), Postives = 131/231 (56.71%), Query Frame = 3
Query:  423 VTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY-SSKNTFKTRTCCFEHYLVNTNYL 1112
            V + E+ Y + + + +  C+   R GR  +GGW++C VG F   K  C SYSFGVNNIWEFDDE+A  + C V  FDP M+   +   R   V F K G+  +  T  NGW +      LK+F  ++ IIDILK D+E  EW + E+ ++DG L  VKQ+L ET  E    +T +  ++ ++  +  +LY+ GFRQWK++WN    Y SS N       C E Y +N N+L
Sbjct:  104 VAELEDLYESVVLETTADCSTERRFGRKGNGGWELCLVGPFTPTKP-CFSYSFGVNNIWEFDDEVAATFRCQVTAFDPRMSQ--ESHMRNDKVAFIKEGVYSKQGTL-NGWSVDSYLGHLKRFGAENFIIDILKFDVESLEWPALETAVRDGSLGNVKQLLLETRIE----KTRTKKNFKKYFSVLKSLYDTGFRQWKHNWNTNCNYRSSLNKDLDGKFCHELYYININFL 326          
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Medaka
Match: mettl24 (methyltransferase like 24 [Source:NCBI gene;Acc:101164366])

HSP 1 Score: 50.8322 bits (120), Expect = 1.633e-6
Identity = 45/192 (23.44%), Postives = 85/192 (44.27%), Query Frame = 3
Query:  519 WDVCFVGNFNL----KKSNCLSYSFGVN-NIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIM--------KMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTE----ELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQY 1043
            W VC    ++L    K  +C  YSFG+  + W  +  + +   C V  FDPS+       Q+ + +W +++ +   D    N   ++        K++++L  F  +   +  + ++   +EW   E+++ +G+L  V Q+L E H      E+ G   S+  Y  +  +   L +AGF  +  H N    Y
Sbjct:  149 WAVCLDPKYSLIQKTKSKSCRVYSFGLGVSDWSLERFLGRS-GCQVHCFDPSLKQL---HQQEAEMWLHRLSVDWRDP---NPAAVVQNQHANSKKLATILNDFGHRKVDVLKVDMES--AEWKILENLVLEGVLDSVGQLLLEIHLHWAGFEVGGDDPSVVRY--WFSLLKELEDAGFHLFHTHTNPSKPY 329          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000031406.1 (SMESG000031406.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 287/319 (89.97%), Postives = 293/319 (91.85%), Query Frame = 3
Query:  156 LYFTNVNSRSAMKKKIKNIIQSEYLKKIKDTYENPSLISLLESNETLIRSFXXXXXXXXXESKIRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            +YFTNVNS+SAMK K  NIIQ EYLKK K+ YEN S  SLLESNETLI            ESKIRNK TKY T+P KKK+ ELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGY DEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKF+EKDRIIDILKIDIEFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL
Sbjct:    1 MYFTNVNSQSAMKNKFINIIQREYLKKNKNMYENSSRKSLLESNETLI-----------TESKIRNKPTKYITKPSKKKSLELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYPDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFNEKDRIIDILKIDIEFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 308          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000031406.1 (SMESG000031406.1)

HSP 1 Score: 508.064 bits (1307), Expect = 0.000e+0
Identity = 265/288 (92.01%), Postives = 268/288 (93.06%), Query Frame = 3
Query:  249 YENPSLISLLESNETLIRSFXXXXXXXXXESKIRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            YEN S  SLLESNETLI            ESKIRNK TKY T+P KKK+ ELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGY DEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKF+EKDRIIDILKIDIEFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL
Sbjct:    2 YENSSRKSLLESNETLI-----------TESKIRNKPTKYITKPSKKKSLELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYPDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFNEKDRIIDILKIDIEFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 278          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000073324.1 (SMESG000073324.1)

HSP 1 Score: 345.51 bits (885), Expect = 1.763e-117
Identity = 168/256 (65.62%), Postives = 211/256 (82.42%), Query Frame = 3
Query:  345 IRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            ++N ++K   +P  + +  L L F+T  +AEE+YY TITKN+FTCN ++RIGR DDGGWD+C + +F  K SNCL YSFG+NN+WEFDD +A+KY+CTVRTFDPSMT   D+MQRPS VWFYKIGLGKEDT WSNGWKIMKMSS LK F+EKD++ID LKIDIE+SEW++FESMIQDGILSKVKQ+LFETHT E+QGR T+   +VR+L++ N LY +GF+QWK+H+NHFG+Y SK +   RTCC+EHY VNTN+L
Sbjct:   12 LQNSNSKSENEPTAE-SMGLKLEFSTDIEAEEYYYQTITKNTFTCNSAVRIGREDDGGWDICIMPSFAAKVSNCLLYSFGINNVWEFDDGIAQKYQCTVRTFDPSMTNLPDQMQRPSKVWFYKIGLGKEDTKWSNGWKIMKMSSFLKMFEEKDKVIDFLKIDIEYSEWEAFESMIQDGILSKVKQLLFETHTAEVQGRVTTTEEFVRYLRVLNKLYKSGFQQWKHHFNHFGKYDSKRSKLPRTCCYEHYFVNTNFL 266          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000073324.1 (SMESG000073324.1)

HSP 1 Score: 345.895 bits (886), Expect = 3.260e-117
Identity = 168/256 (65.62%), Postives = 211/256 (82.42%), Query Frame = 3
Query:  345 IRNKSTKYTTQPIKKKTFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            ++N ++K   +P  + +  L L F+T  +AEE+YY TITKN+FTCN ++RIGR DDGGWD+C + +F  K SNCL YSFG+NN+WEFDD +A+KY+CTVRTFDPSMT   D+MQRPS VWFYKIGLGKEDT WSNGWKIMKMSS LK F+EKD++ID LKIDIE+SEW++FESMIQDGILSKVKQ+LFETHT E+QGR T+   +VR+L++ N LY +GF+QWK+H+NHFG+Y SK +   RTCC+EHY VNTN+L
Sbjct:   38 LQNSNSKSENEPTAE-SMGLKLEFSTDIEAEEYYYQTITKNTFTCNSAVRIGREDDGGWDICIMPSFAAKVSNCLLYSFGINNVWEFDDGIAQKYQCTVRTFDPSMTNLPDQMQRPSKVWFYKIGLGKEDTKWSNGWKIMKMSSFLKMFEEKDKVIDFLKIDIEYSEWEAFESMIQDGILSKVKQLLFETHTAEVQGRVTTTEEFVRYLRVLNKLYKSGFQQWKHHFNHFGKYDSKRSKLPRTCCYEHYFVNTNFL 292          
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Match: SMESG000062732.1 (SMESG000062732.1)

HSP 1 Score: 194.126 bits (492), Expect = 1.090e-58
Identity = 106/224 (47.32%), Postives = 152/224 (67.86%), Query Frame = 3
Query:  444 YYATITKNSFTCNYSIRIGRPDDGGWDVCFVGNFNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSM-TGYLDEMQRPSNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFXXXXXXXXXXXXXXXFSEWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLYNAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL 1112
            Y+  I  NS  CN  +++ + ++    +C   NF+L+K+NCL YSF V+  W F+D +A +Y C VRTF PSM T Y+  +QRPSNV FY IGLGK D     GWK  ++S++++ F+E+ R+ID+L IDI+F EWD+FESMI+D +L  VKQ++F++HTE++  R T+  S++RF KIW TLYN GFRQW++     G + S     ++ CC  HYLVN +YL
Sbjct:   37 YFHAIGNNSIKCNEVLKVDKFENDETYLCVEKNFDLEKNNCLVYSFKVDYTWTFEDNIASQYGCIVRTFIPSMGTNYV--IQRPSNVLFYSIGLGKFDEVSLEGWKFQRLSTMIRNFNEEFRVIDVLFIDIDFGEWDAFESMIEDQLLFFVKQLIFQSHTEDVLNRPTTARSFIRFWKIWKTLYNIGFRQWRSGNLSTGYHKSIQYSPSQPCCAVHYLVNIHYL 258          
The following BLAST results are available for this feature:
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl241.811e-723.68methyltransferase like 24 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|B1WB06|MET24_XENTR9.596e-723.68Methyltransferase-like protein 24 OS=Xenopus tropi... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSJ73.959e-5545.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G5153.805e-5444.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GUE81.587e-4843.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EB562.312e-4843.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DQX32.360e-4843.16Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl241.633e-623.44methyltransferase like 24 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Methyltranfer_dom domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031406.10.000e+089.97SMESG000031406.1[more]
SMESG000031406.10.000e+092.01SMESG000031406.1[more]
SMESG000073324.11.763e-11765.63SMESG000073324.1[more]
SMESG000073324.13.260e-11765.63SMESG000073324.1[more]
SMESG000062732.11.090e-5847.32SMESG000062732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006203 ID=SMED30006203|Name=Methyltranfer_dom domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1404bp
ATTACTTTATTATTTTATTAACACTAATCAACCAAGGAGTATGTATATTT
GTTATCGTTATAACCTTTTTAAGGTAAATTAATAAACTAAAAATGCGGTT
TCTTAAAGCTTATTATTATTGTATACTATTATCTATGGCTGTTGTGATAT
ATTATTTGTACTTTACAAATGTAAATTCACGATCAGCAATGAAAAAAAAA
ATTAAAAATATTATCCAAAGTGAATATTTAAAAAAAATTAAAGACACGTA
CGAAAACCCGTCCCTAATATCTTTGCTAGAATCGAATGAAACTCTAATTA
GAAGTTTTAACAATTTATCATCATTATTATTATTAGAATCAAAAATCAGA
AATAAATCCACTAAATATACCACTCAACCAATTAAAAAGAAAACTTTCGA
ATTAAATCTCGGATTTACAACAGTTACACAAGCGGAAGAGTTTTATTATG
CAACAATAACGAAAAATTCCTTCACCTGCAATTATTCCATCAGAATCGGT
CGCCCAGACGACGGTGGATGGGATGTTTGTTTTGTGGGAAATTTTAATTT
AAAAAAATCAAATTGTTTGTCATATTCTTTCGGTGTCAATAATATTTGGG
AATTCGATGATGAGATGGCAAAGAAATACGAGTGCACTGTGAGAACATTT
GATCCCTCAATGACTGGATACCTTGATGAAATGCAGCGTCCATCGAATGT
TTGGTTCTATAAAATCGGATTGGGTAAAGAAGACACAACCTGGTCAAATG
GTTGGAAAATCATGAAAATGTCGTCATTGTTAAAAAAATTTGATGAAAAA
GATAGAATTATTGATATTCTTAAAATTGATATTGAATTTTCCGAATGGGA
TTCTTTTGAATCGATGATCCAGGATGGGATTTTGTCGAAAGTTAAGCAGA
TTCTATTTGAAACCCACACAGAAGAATTGCAAGGTCGAACTACTTCATTG
GCAAGCTATGTGAGATTCTTGAAAATCTGGAATACTCTCTACAATGCTGG
ATTTCGACAATGGAAAAACCACTGGAATCATTTCGGTCAATATTCATCGA
AAAACACATTTAAAACTCGAACATGTTGCTTTGAGCACTACTTAGTCAAT
ACAAACTATCTTTGAATATTTTTTATTTATTTTTTGAATGAAAATTTGAC
GTAATAAACCTTTTTTTATTATTCTTATCAAAATGAAATATTTTTTCTTA
TTTTTATTAAACGAGAAATTTATTTTGTTGTGATTGAAAAATAATTATAT
GTAATTTGAATTTTCAACAATCACATTTTTATCGATTTGTGAATTTTTCA
TTGGAATCATTCAAGTGTTATTATCATGTAGTATGTAAAATATTTTAGTT
TATTAATATATGCAGAGGAATTTCTATTATATTTCTAATTGCGGAGTGAA
TAGC
back to top

protein sequence of SMED30006203-orf-1

>SMED30006203-orf-1 ID=SMED30006203-orf-1|Name=SMED30006203-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MRFLKAYYYCILLSMAVVIYYLYFTNVNSRSAMKKKIKNIIQSEYLKKIK
DTYENPSLISLLESNETLIRSFNNLSSLLLLESKIRNKSTKYTTQPIKKK
TFELNLGFTTVTQAEEFYYATITKNSFTCNYSIRIGRPDDGGWDVCFVGN
FNLKKSNCLSYSFGVNNIWEFDDEMAKKYECTVRTFDPSMTGYLDEMQRP
SNVWFYKIGLGKEDTTWSNGWKIMKMSSLLKKFDEKDRIIDILKIDIEFS
EWDSFESMIQDGILSKVKQILFETHTEELQGRTTSLASYVRFLKIWNTLY
NAGFRQWKNHWNHFGQYSSKNTFKTRTCCFEHYLVNTNYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR026913METTL24
IPR025714Methyltranfer_dom
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025714Methyltransferase domainPFAMPF13383Methyltransf_22coord: 6..138
e-value: 3.5E-10
score: 39.9
NoneNo IPR availablePANTHERPTHR32026:SF10METHYLTRANSFERASE-LIKE PROTEIN 24coord: 1..165
IPR026913Methyltransferase-like protein 24PANTHERPTHR32026FAMILY NOT NAMEDcoord: 1..165