Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30006200
Length (bp)1625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30006200) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30006200) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30006200) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30006200) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006200

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006200SMESG000024474.1 SmedASXL_012582SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30006200SMESG000024474.1 dd_Smed_v4_22211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006200SMESG000024474.1 dd_Smed_v6_22211_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30006200SMESG000024474.1 OX_Smed_1.0.00616ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  135 AAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKN 365
            A G PKP + W +DGR I     I + ++  +GE+ ++  + V S  SG ++C+ EN NG +     +IV++ K  N
Sbjct: 13779 AVGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIA-ECVVSKTSGIFSCKAENPNGTVIAETQVIVQRMKPAN 13854          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  135 AAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKN 365
            A G PKP + W +DGR I     I + ++  +GE+ ++  + V S  SG ++C+ EN NG +     +IV++ K  N
Sbjct: 13779 AVGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIA-ECVVSKTSGIFSCKAENPNGTVIAETQVIVQRMKPAN 13854          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  135 AAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKN 365
            A G PKP + W +DGR I     I + ++  +GE+ ++  + V S  SG ++C+ EN NG +     +IV++ K  N
Sbjct: 13794 AVGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIA-ECVVSKTSGIFSCKAENPNGTVIAETQVIVQRMKPAN 13869          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  135 AAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKN 365
            A G PKP + W +DGR I     I + ++  +GE+ ++  + V S  SG ++C+ EN NG +     +IV++ K  N
Sbjct: 13794 AVGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIA-ECVVSKTSGIFSCKAENPNGTVIAETQVIVQRMKPAN 13869          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 52.373 bits (124), Expect = 1.001e-6
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  135 AAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKN 365
            A G PKP + W +DGR I     I + ++  +GE+ ++  + V S  SG ++C+ EN NG +     +IV++ K  N
Sbjct: 13779 AVGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIA-ECVVSKTSGIFSCKAENPNGTVIAETQVIVQRMKPAN 13854          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: obscnb (obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF b [Source:ZFIN;Acc:ZDB-GENE-070119-5])

HSP 1 Score: 50.447 bits (119), Expect = 5.734e-6
Identity = 27/83 (32.53%), Postives = 42/83 (50.60%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKNDNPD 377
            C  +  P P   W +DGR +     I    I  E ++S L++++V SL+SG+Y CRV+N  G  +    L+V  +     N D
Sbjct:  131 CRVSAHPAPNFDWEKDGRYLGETNRIK---ITSESDSSSLRIQSVRSLDSGTYNCRVQNSIGRAQSAATLVVDLQDTHLLNAD 210          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4Z2CRY1 (Schwann cell myelin protein (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_008013 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.007e-6
Identity = 48/165 (29.09%), Postives = 72/165 (43.64%), Query Frame = 3
Query:   15 VDLRITKFNANISELVHSESIPRNGKXXXXXXXXXXXXCSAAGRPKPEIHWFQDGRRIQS--QKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQTGACFFDKTKVKCSCFP 503
            V++RI++F   +S+ +   S+     +++ EG  L L C   GRP P I W+ +   I+   +       I      S LQL NV+  ++ +Y C  EN+NGHIRK + +IVK          +          S      C  NYC  G C+       C C P
Sbjct:   31 VEVRISQFMVLMSDPLQMRSLYHEDVLKVNEGNDLLLSCRVRGRPTPLISWYVNQTEIKYPWRLETGRGIIQKSRYLSKLQLSNVHPTDNANYTCLAENVNGHIRKSVKVIVKATTTLPPPTTTTLATTELTTASV---HPCH-NYCHRGHCYIIDGNPYCRCDP 191          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A2H1CLL8 (Immunoglobulin domain protein OS=Fasciola hepatica OX=6192 GN=D915_04233 PE=4 SV=1)

HSP 1 Score: 59.6918 bits (143), Expect = 2.113e-6
Identity = 40/112 (35.71%), Postives = 58/112 (51.79%), Query Frame = 3
Query:   15 VDLRITKFNANISELVHSESIPRNGKXXXXXXXXXXXXCSAAGRPKPEIHWFQDGRRIQS--QKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIV 344
            V++RIT+F   IS  +    +    ++ + EG  L L C   GRP P I WF +   I++  +  +    I      S LQL  V+   +G+Y C  EN+NGHIRK + LIV
Sbjct:   51 VEVRITQFMVLISYPLQMRPLYHADQLSVDEGNDLLLSCQVRGRPTPLISWFFNDVEIKTPWKFGVKQGIIQTSRHLSKLQLAKVSPDQTGNYTCLAENLNGHIRKSVQLIV 162          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5N5T661 (Uncharacterized protein OS=Armadillidium nasatum OX=96803 GN=Anas_13710 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.295e-6
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKE 353
            C   GRPKP+I W +DG  I      +N  +++  +  IL+ K       G Y C VEN  GHI+ + N+I++ E
Sbjct:   15 CYVEGRPKPKITWLKDGENIDEIIE-NNVEVSLSDDNQILEFKFATKKYEGKYECNVENRVGHIQPFANVIIEDE 88          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A5N5T1W3 (Platelet-derived growth factor receptor alpha (Fragment) OS=Armadillidium nasatum OX=96803 GN=Pdgfra_1 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.530e-6
Identity = 36/98 (36.73%), Postives = 52/98 (53.06%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNL---IVKKEKKKNDNPDSVNNELFPFRNS 413
            C   GRPKP+I W +DG  I  + + +N  +++  +  IL  K       G Y C VEN  GHI+ + N+   I++ +K KN   D +  ELF FRN 
Sbjct:   30 CYVEGRPKPKITWLKDGENID-EITENNYEVSLNDDNQILDFKYAIKKYEGKYECNVENRVGHIQPYTNVIIEIIRNKKNKNIRNDMLQLELFFFRNG 126          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A444T815 (Ig-like domain-containing protein OS=Armadillidium vulgare OX=13347 GN=Avbf_10113 PE=4 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 3.862e-6
Identity = 26/75 (34.67%), Postives = 42/75 (56.00%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKE 353
            C   GRPKP+I W +DG  I      +N  +++  +  IL+ K   +  +G Y C +EN  GHI+ + N+I++ E
Sbjct:   55 CYVEGRPKPKITWLKDGENIDEIIE-NNVEVSLRDDNQILEFKTATTKYAGKYECSIENRVGHIQPFANIIIEDE 128          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mylk5 (myosin light chain kinase, smooth muscle-like [Source:NCBI gene;Acc:103036671])

HSP 1 Score: 50.0618 bits (118), Expect = 6.295e-6
Identity = 27/81 (33.33%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQK-SISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKND 368
            C   G P PE+ W +DG  ++ ++ S+   Y   EG T  L L+NV+   +G+Y+CR  NI+G       L V  +++  D
Sbjct:  751 CHVTGYPDPEVVWLKDGEVLEEEEGSVQVEY--EEGGTCTLILENVSLEQNGTYSCRATNIHGEALCSAKLTVVDQEEDTD 829          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mylk5 (myosin light chain kinase, smooth muscle-like [Source:NCBI gene;Acc:103036671])

HSP 1 Score: 49.2914 bits (116), Expect = 9.685e-6
Identity = 27/81 (33.33%), Postives = 43/81 (53.09%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQK-SISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKND 368
            C   G P PE+ W +DG  ++ ++ S+   Y   EG T  L L+NV+   +G+Y+CR  NI+G       L V  +++  D
Sbjct:  780 CHVTGYPDPEVVWLKDGEVLEEEEGSVQVEY--EEGGTCTLILENVSLEQNGTYSCRATNIHGEALCSAKLTVVDQEEDTD 858          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.746e-7
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIV 344
            C   G+P PE+ W +D R IQ    +SN  +  EG   ILQ+K+V   ++G Y C   N  G  + + N+ V
Sbjct: 2771 CEVVGKPPPEVLWMKDRRLIQP---LSNVVMEQEGCHYILQIKDVKPTDAGVYVCEATNFIGEAKSFANVEV 2839          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007655.1 (pep scaffold:Pmarinus_7.0:GL494936:2020:2537:-1 gene:ENSPMAG00000006916.1 transcript:ENSPMAT00000007655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.1282 bits (100), Expect = 9.064e-6
Identity = 24/73 (32.88%), Postives = 39/73 (53.42%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVN-SLNSGSYACRVENINGHIRKWMNLIV 344
            C A G PKP I W + G+++ SQ+     Y N  G +S+L+++ +  + +   Y C   N+ G I K + L V
Sbjct:   23 CRATGDPKPNITWAKKGKKLSSQRFEIIDYDN--GASSVLRIQPLRPARDEAEYECVASNVLGQISKSVKLRV 93          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000024474.1 (SMESG000024474.1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 297/298 (99.66%), Postives = 298/298 (100.00%), Query Frame = 3
Query:  330 MNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQTGACFFDKTKVKCSCFPATQVKSQTEINANINISAERFLANKCNQVGCYSFNDQIFTIFETILVCLVTMLLFGIMFFLWHNKRKSCGSRRMGSFTKTTQVNLIGTVKVRDASIDTNTDTVEIYPERLFHIPIDRIMTIGCCSHQQEEKSCNNNFQPDLYSKSIFSQPLKYPIAKYKANNLNCNSLYRSLWPDMNYEESSLSYEDTQPLNQIRLGFHNERSPRDTISTFSDTGYSNSLKMNSEHIPQTEIPLTSIEFA 1223
            MNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQTGACFFDKTKVKCSCFPATQVKSQTEINANINISAERFLANKCNQVGCYSFNDQIFTIFETILVCLVTMLLFGIMFFLWHNKRKSCGSRRMGSFTKTTQVNLIGTVKVRDASIDTNTDTVEIYPERLFHIPIDRIMTIGCCSHQQEEKSCNNNFQPDLYSKSIFSQPLKYPIAKYKANNLNCNSLYRSLWPD+NYEESSLSYEDTQPLNQIRLGFHNERSPRDTISTFSDTGYSNSLKMNSEHIPQTEIPLTSIEFA
Sbjct:    1 MNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQTGACFFDKTKVKCSCFPATQVKSQTEINANINISAERFLANKCNQVGCYSFNDQIFTIFETILVCLVTMLLFGIMFFLWHNKRKSCGSRRMGSFTKTTQVNLIGTVKVRDASIDTNTDTVEIYPERLFHIPIDRIMTIGCCSHQQEEKSCNNNFQPDLYSKSIFSQPLKYPIAKYKANNLNCNSLYRSLWPDINYEESSLSYEDTQPLNQIRLGFHNERSPRDTISTFSDTGYSNSLKMNSEHIPQTEIPLTSIEFA 298          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000016260.1 (SMESG000016260.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.300e-22
Identity = 58/110 (52.73%), Postives = 79/110 (71.82%), Query Frame = 3
Query:    3 MSNIVDLRITKFNANISELVHSESIPRNGKXXXXXXXXXXXXCSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVE-GETSILQLKNVNSLNSGSYACRVENINGHIRKW 329
            +S+IVDLRI +F+A IS  V S +I +   + I  G I+EL C+A GRP PEI+WF+DG  I S KS+SN +I  + G TS L++ ++ S +SG+YACR ENINGHI+KW
Sbjct:    7 ISDIVDLRIARFDAVISSQVISHTISQKHNLNIKTGQIMELFCTAHGRPLPEINWFKDGGVITS-KSVSNKFIVSKFGATSSLRITDLKSSDSGTYACRAENINGHIKKW 115          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000016260.1 (SMESG000016260.1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.571e-22
Identity = 58/110 (52.73%), Postives = 79/110 (71.82%), Query Frame = 3
Query:    3 MSNIVDLRITKFNANISELVHSESIPRNGKXXXXXXXXXXXXCSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVE-GETSILQLKNVNSLNSGSYACRVENINGHIRKW 329
            +S+IVDLRI +F+A IS  V S +I +   + I  G I+EL C+A GRP PEI+WF+DG  I S KS+SN +I  + G TS L++ ++ S +SG+YACR ENINGHI+KW
Sbjct:   13 ISDIVDLRIARFDAVISSQVISHTISQKHNLNIKTGQIMELFCTAHGRPLPEINWFKDGGVITS-KSVSNKFIVSKFGATSSLRITDLKSSDSGTYACRAENINGHIKKW 121          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000026010.1 (SMESG000026010.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.397e-11
Identity = 47/167 (28.14%), Postives = 82/167 (49.10%), Query Frame = 3
Query:    3 MSNIVDLRITKFNANISELVHSESIPRNGKXXXXXXXXXXXXCSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQTGACFFDKTKVKCSCFP 503
            + +++DLRIT+F+ +I   V  +    N +I + EG +L++ C A G P P+I W+ +G +I  + +  +  I ++G  S L +  V + + G+++C   N NG + KW  + V K    +             R+STS +  C    C  G+C  +     C C P
Sbjct:   15 LDSLIDLRITEFSPSIYAPVLIKRPTNNNEITLQEGNLLKIKCQADGNPIPKIDWYLNGTKID-KSTYKDIQIEIKGNLSTLIIGKVGTRHEGNFSCIAHNNNGLLSKWAYVSVMKNYTMDTT----------IRSSTSVY-FCSQETCVYGSCIRENNTSFCRCLP 169          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000023969.1 (SMESG000023969.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.959e-10
Identity = 48/187 (25.67%), Postives = 83/187 (44.39%), Query Frame = 3
Query:  129 CSAAGRPKPEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVENINGHIRKWMNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRI---CQANYCQTGACFFDKTKVKCSCFPATQVKSQTEINANINISAERFLANKCNQVGCYSFNDQIFTIFETILVCLVTMLLFGIMF 680
            C A G+P P + W+++ + I  +K     Y       + L L+N++ +++G Y CR  N  G+++KWMN+ V                   F  S+  + +   C   YC  G C+FD+    C C  +       E   +  ISA + + N+ + +  YS  D I  +   +L+  + +L FG M 
Sbjct:   39 CEAIGQPIPTVDWYENRKIIFGRK-----YFLKNKSCNQLLLRNISMIDAGMYVCRASNSQGYVKKWMNINV-------------------FPKSSMYWWLKQKCHDQYCIHGDCYFDRNIRVCKCHHSYTGIRCDEKTHSKKISAPQ-INNQTSNILDYSHTDGIILLVLWLLIGFIFLLKFGCML 200          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttn-11.001e-633.77Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.001e-633.77Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.001e-633.77Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.001e-633.77Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-11.001e-633.77Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
obscnb5.734e-632.53obscurin, cytoskeletal calmodulin and titin-intera... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CRY11.007e-629.09Schwann cell myelin protein (Fragment) OS=Schistos... [more]
A0A2H1CLL82.113e-635.71Immunoglobulin domain protein OS=Fasciola hepatica... [more]
A0A5N5T6613.295e-636.00Uncharacterized protein OS=Armadillidium nasatum O... [more]
A0A5N5T1W33.530e-636.73Platelet-derived growth factor receptor alpha (Fra... [more]
A0A444T8153.862e-634.67Ig-like domain-containing protein OS=Armadillidium... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mylk56.295e-633.33myosin light chain kinase, smooth muscle-like [Sou... [more]
mylk59.685e-633.33myosin light chain kinase, smooth muscle-like [Sou... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002502.11.746e-736.11pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000007655.19.064e-632.88pep scaffold:Pmarinus_7.0:GL494936:2020:2537:-1 ge... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024474.10.000e+099.66SMESG000024474.1[more]
SMESG000016260.11.300e-2252.73SMESG000016260.1[more]
SMESG000016260.11.571e-2252.73SMESG000016260.1[more]
SMESG000026010.13.397e-1128.14SMESG000026010.1[more]
SMESG000023969.11.959e-1025.67SMESG000023969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006200 ID=SMED30006200|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1625bp
CGATGAGCAATATTGTCGACTTGAGAATTACAAAATTTAATGCTAATATA
TCAGAACTCGTGCATAGCGAGTCCATTCCAAGAAATGGTAAAATAGAAAT
TTACGAAGGAGGAATTTTAGAACTGATTTGTTCAGCGGCTGGACGACCTA
AACCAGAAATTCACTGGTTTCAGGATGGACGAAGAATTCAATCTCAAAAA
TCAATTTCAAATGCATATATCAACGTTGAAGGTGAAACATCAATCTTGCA
ACTGAAAAACGTCAATTCTTTGAATTCCGGAAGTTACGCGTGTCGGGTCG
AGAACATCAATGGCCATATTAGAAAATGGATGAATTTGATTGTTAAAAAA
GAAAAAAAGAAAAATGACAATCCCGATTCAGTGAACAATGAATTGTTCCC
ATTCCGGAATTCAACATCTAATTTCAGAATTTGCCAAGCAAATTATTGCC
AAACCGGAGCCTGCTTTTTCGATAAAACAAAAGTTAAATGCAGTTGCTTC
CCTGCCACCCAGGTTAAATCTCAAACGGAAATAAATGCCAATATCAACAT
TTCAGCGGAAAGGTTTCTAGCGAATAAATGTAATCAAGTTGGCTGCTACA
GTTTCAACGATCAGATTTTTACAATTTTCGAAACAATTCTCGTATGTTTA
GTCACGATGCTTCTGTTTGGGATAATGTTCTTTCTGTGGCATAACAAGCG
CAAATCATGCGGATCAAGAAGAATGGGATCATTCACAAAAACCACACAGG
TTAACCTTATAGGAACTGTAAAGGTTCGTGATGCCAGTATAGACACTAAT
ACGGACACGGTTGAGATATATCCAGAGCGCTTGTTTCATATTCCTATTGA
CCGAATAATGACAATTGGTTGTTGTAGTCACCAACAAGAAGAAAAATCTT
GCAATAACAACTTTCAGCCAGATTTGTACAGTAAATCTATTTTTTCGCAA
CCCTTAAAGTACCCTATTGCGAAATACAAAGCTAATAACTTAAATTGCAA
CTCACTCTATCGGTCGTTGTGGCCAGATATGAATTATGAAGAATCATCCT
TAAGCTATGAAGACACTCAGCCATTAAATCAAATCCGCTTGGGATTTCAT
AATGAAAGATCTCCGCGAGATACGATTTCAACCTTTTCCGATACTGGCTA
CAGCAACAGCCTGAAAATGAATTCAGAACATATTCCACAAACTGAGATCC
CATTGACCTCAATTGAGTTTGCCTGAGACAATGAAAAGGAAAACGGCTTG
TAAAGAAATATCTGATTTCTATGTGTATTTACATTTTCGTGTTAGTTTCT
AGTGGCCATTAACAATATTTGCGGAGTGATTAGAAATTCTCTGACAGACT
TCTCCAGACAACGAAAATCTCAAAATGGTTCTGTGTAAATATCCATGGAT
TGTTGTTTGCCCATTCAGTGAAACAGTTGCCTCTATCAATTCTTTGCGGG
CTGGGTCGTGTCATTCGTTTTCAGTCGGCAATGCCACTAAGTCATTTACG
TTCGACGGAAATAAGAAAGCTGTTTTCGAAATAAATTGTTAGTTGGAAAA
ATTATTTTATATATTGAAGGAGTTTTATTTGTCTGATTGTTACTTTTGTC
TATATTTGCTGATTTAATCGTGTTC
back to top

protein sequence of SMED30006200-orf-1

>SMED30006200-orf-1 ID=SMED30006200-orf-1|Name=SMED30006200-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=408bp
MSNIVDLRITKFNANISELVHSESIPRNGKIEIYEGGILELICSAAGRPK
PEIHWFQDGRRIQSQKSISNAYINVEGETSILQLKNVNSLNSGSYACRVE
NINGHIRKWMNLIVKKEKKKNDNPDSVNNELFPFRNSTSNFRICQANYCQ
TGACFFDKTKVKCSCFPATQVKSQTEINANINISAERFLANKCNQVGCYS
FNDQIFTIFETILVCLVTMLLFGIMFFLWHNKRKSCGSRRMGSFTKTTQV
NLIGTVKVRDASIDTNTDTVEIYPERLFHIPIDRIMTIGCCSHQQEEKSC
NNNFQPDLYSKSIFSQPLKYPIAKYKANNLNCNSLYRSLWPDMNYEESSL
SYEDTQPLNQIRLGFHNERSPRDTISTFSDTGYSNSLKMNSEHIPQTEIP
LTSIEFA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007399nervous system development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003598Ig_sub2
IPR003599Ig_sub
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 34..104
e-value: 4.5E-8
score: 42.8
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 28..115
e-value: 1.7E-5
score: 34.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 30..114
e-value: 9.8E-13
score: 48.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 12..116
e-value: 2.3E-16
score: 61.8
NoneNo IPR availablePANTHERPTHR45080:SF13NEURAL CELL ADHESION MOLECULE L1coord: 30..142
NoneNo IPR availablePANTHERPTHR45080FAMILY NOT NAMEDcoord: 30..142
NoneNo IPR availableCDDcd00096Igcoord: 39..108
e-value: 3.68005E-12
score: 59.178
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 26..101
score: 12.277
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 31..115