Acetyl-coenzyme A synthetase

Overview
NameAcetyl-coenzyme A synthetase
Smed IDSMED30006199
Length (bp)2357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetyl-coenzyme A synthetase (SMED30006199) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetyl-coenzyme A synthetase (SMED30006199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetyl-coenzyme A synthetase (SMED30006199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetyl-coenzyme A synthetase (SMED30006199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30006199h1SMcG0014430 Contig4606GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006199h1SMcG0014430 dd_Smed_v4_1817_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 392/669 (58.59%), Postives = 496/669 (74.14%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHV--TCYGIGKCTEA--PGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            + P     + AH+ S+  Y +L+  S++ P +FW + A++F+WK  P     L+YNF   +G I++   K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  + TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI EL +AMLACARIGA+H ++F GFS+ES+ ERI D +C +L+T D  +RG KL++LK ++D+A++ C++ G PV CCIVVKH+     G+G  T    P  R    + ++     D WWHE M ++    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD  RLW I++KY VTKFYTAPT IR LMK GD+ V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSAT PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NHER+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GD ST+ADP+VI  + +
Sbjct:   29 WSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWK-TPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFS 694          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 794.653 bits (2051), Expect = 0.000e+0
Identity = 393/682 (57.62%), Postives = 496/682 (72.73%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHV--TCYGIGKCTEA--------PGCRPARKLLVNMTNPR-------DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            + P     + AH+ S+  Y +L+  S++ P +FW + A++F+WK  P     L+YNF   +G I++   K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  + TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI EL +AMLACARIGA+H ++F GFS+ES+ ERI D +C +L+T D  +RG KL++LK ++D+A++ C++ G PV CCIVVKH+     G+G  T          P  +   K       P+       D WWHE M ++    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD  RLW I++KY VTKFYTAPT IR LMK GD+ V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSAT PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NHER+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GD ST+ADP+VI  + +
Sbjct:   29 WSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWK-TPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDLWWHELMQEAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFS 707          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 526.939 bits (1356), Expect = 2.083e-177
Identity = 282/651 (43.32%), Postives = 395/651 (60.68%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPG--CTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESN-FGDTSTLADPNVIDAILNI 2127
            Y  L  ++ + P  FW   A        P +  V   +F   +    +  F  G  N+  N LD+ + +   + +A  WE ++P    + TY  L    C+ A  L+  G+ +GDRVAIY+P+      AMLACARIGAVH VIF GFSAES+A RI+D  CK+++T +   RG ++++LK I D+A+K C     P    ++V H T                    V+M +  D    + M+  + +  C  E + SE  LF+L+TSGSTG PKG+VHT  GY++Y ++T+K VFDH+  D++ C ADIGWITGHSYV+YGP+  GAT ++FE  P YP+AGR W+ +E+  + +FY APT +R L+K GD +V KY R SL+ LG+VGEPIN   W W + VVG++RC +VDT+WQTETGG  I P P      + P  A  PFFG+   L+DE G  + G    G L   + WPG+ RT+Y +H+R+ D YFK + GYY TGDGA R   GYY ITGR+DD++N+SGH + TA++E A+  HP + E+A +  PH++KGE  F F+ + D+    + +  EL   V TKI  +AVPD I  V  LPKTRSGK+MRR+LRKI  +E+   GDT+TL DP++I  IL++
Sbjct:   58 YPALSAQAAREPAAFWGPLARDTLVWDTPYH-TVWDCDFSTGK----IGWFLGGQLNVSVNCLDQHVRKS-PESVALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHC-----PTVQHVLVAHRT-----------------DNKVHMGD-LDVPLEQEMAKEDPV--CAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSV 677          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 503.442 bits (1295), Expect = 5.923e-170
Identity = 260/552 (47.10%), Postives = 357/552 (64.67%), Query Frame = 1
Query:  484 CKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPG--CTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESN-FGDTSTLADPNVIDAILNI 2127
            C+ A  L+  G+ +GDRVAIY+P+      AMLACARIGAVH VIF GFSAES+A RI+D  CK+++T +   RG ++++LK I D+A+K C     P    ++V H T                    V+M +  D    + M+  + +  C  E + SE  LF+L+TSGSTG PKG+VHT  GY++Y ++T+K VFDH+  D++ C ADIGWITGHSYV+YGP+  GAT ++FE  P YP+AGR W+ +E+  + +FY APT +R L+K GD +V KY R SL+ LG+VGEPIN   W W + VVG++RC +VDT+WQTETGG  I P P      + P  A  PFFG+   L+DE G  + G    G L   + WPG+ RT+Y +H+R+ D YFK + GYY TGDGA R   GYY ITGR+DD++N+SGH + TA++E A+  HP + E+A +  PH++KGE  F F+ + D+    + +  EL   V TKI  +AVPD I  V  LPKTRSGK+MRR+LRKI  +E+   GDT+TL DP++I  IL++
Sbjct:   30 CRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHC-----PTVQHVLVAHRT-----------------DNKVHMGD-LDVPLEQEMAKEDPV--CAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSV 556          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 425.631 bits (1093), Expect = 1.210e-139
Identity = 225/530 (42.45%), Postives = 314/530 (59.25%), Query Frame = 1
Query:  184 DYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPG--CTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNV 1764
             Y  L  ++ + P  FW   A        P +  V   +F   +    +  F  G  N+  N LD+ + +   + +A  WE ++P    + TY  L    C+ A  L+  G+ +GDRVAIY+P+      AMLACARIGAVH VIF GFSAES+A RI+D  CK+++T +   RG ++++LK I D+A+K C     P    ++V H T                    V+M +  D    + M+  + +  C  E + SE  LF+L+TSGSTG PKG+VHT  GY++Y ++T+K VFDH+  D++ C ADIGWITGHSYV+YGP+  GAT ++FE  P YP+AGR W+ +E+  + +FY APT +R L+K GD +V KY R SL+ LG+VGEPIN   W W + VVG++RC +VDT+WQTETGG  I P P      + P  A  PFFG+   L+DE G  + G    G L   + WPG+ RT+Y +H+R+ D YFK + GYY TGDGA R   GYY ITGR+DD++N+
Sbjct:   57 SYPALSAQAAREPAAFWGPLARDTLVWDTPYH-TVWDCDFSTGK----IGWFLGGQLNVSVNCLDQHVRKS-PESVALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHC-----PTVQHVLVAHRT-----------------DNKVHMGD-LDVPLEQEMAKEDPV--CAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINI 555          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 339/677 (50.07%), Postives = 453/677 (66.91%), Query Frame = 1
Query:  112 MSTNI-ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLG----DCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIAN-NESNFGDTSTLADPNVIDAILN 2124
            +ST I +++ P       AH   +  YH LY  SI   D+FW   + +  ++Q       L++NF    G ++V       TN+ YN L+R I++G G+KIA+ +EGN+P D + +TY  LHA+V +F+ +LR+ G+K+GD VA+YLPMI EL +AMLACARIGA+H V+F GFSAES+A R+ D  C++LVT DGV+RG K I LK I+D A  +  +    VE  I+V+H+      + T+  G    +    ++T          + DS +L     D PVEW++SE PLFIL+TSGSTGKPKG+ HTT GYM Y   T K+ FD ++DDVYWCTAD GWITGHSY+LYGP+  G  GI +EG+PTYP   R+W + +KY VTK YT+PT  R+LM  G+ ++    R++LK++GTVGEPINP  W+W Y+ VG +   IVDT+WQTETGGH+IT +PG T +KPG+A +PFFG    L+D  G+ I GPGEG L F + WPG+MR +Y + +R+  TY   F GYY TGDGA RD +GY  ITGR+DD++NVSGHL+STA++ESALV+H K+ EAA V  PH++KG   + FVTL      +E L  EL   VR KIGA AVPD IQ+ P LPKTRSGK+ RRILRKIA  +ES  GDT+TL D +VI  +++
Sbjct:    4 VSTRIFQIFLPPAPLLAGAHCAGLQSYHDLYRSSINDADEFWRTVSSELHFEQ--GTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLK-----RVTKPDGVELPKVDYTDIT---------VIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLIS 664          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 336/671 (50.07%), Postives = 449/671 (66.92%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLG----DCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIAN-NESNFGDTSTLADPNVIDAILN 2124
            +++ P       AH   +  YH LY  SI   D+FW   + +  ++Q       L++NF    G ++V       TN+ YN L+R I++G G+KIA+ +EGN+P D + +TY  LHA+V +F+ +LR+ G+K+GD VA+YLPMI EL +AMLACARIGA+H V+F GFSAES+A R+ D  C++LVT DGV+RG K I LK I+D A  +  +    VE  I+V+H+      + T+  G    +    ++T          + DS +L     D PVEW++SE PLFIL+TSGSTGKPKG+ HTT GYM Y   T K+ FD ++DDVYWCTAD GWITGHSY+LYGP+  G  GI +EG+PTYP   R+W + +KY VTK YT+PT  R+LM  G+ ++    R++LK++GTVGEPINP  W+W Y+ VG +   IVDT+WQTETGGH+IT +PG T +KPG+A +PFFG    L+D  G+ I GPGEG L F + WPG+MR +Y + +R+  TY   F GYY TGDGA RD +GY  ITGR+DD++NVSGHL+STA++ESALV+H K+ EAA V  PH++KG   + FVTL      +E L  EL   VR KIGA AVPD IQ+ P LPKTRSGK+ RRILRKIA  +ES  GDT+TL D +VI  +++
Sbjct:   20 DIFLPPAPLLAGAHCAGLQSYHDLYRSSINDADEFWRTVSSELHFEQ--GTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLK-----RVTKPDGVELPKVDYTDIT---------VIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLIS 674          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 336/671 (50.07%), Postives = 449/671 (66.92%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLG----DCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIAN-NESNFGDTSTLADPNVIDAILN 2124
            +++ P       AH   +  YH LY  SI   D+FW   + +  ++Q       L++NF    G ++V       TN+ YN L+R I++G G+KIA+ +EGN+P D + +TY  LHA+V +F+ +LR+ G+K+GD VA+YLPMI EL +AMLACARIGA+H V+F GFSAES+A R+ D  C++LVT DGV+RG K I LK I+D A  +  +    VE  I+V+H+      + T+  G    +    ++T          + DS +L     D PVEW++SE PLFIL+TSGSTGKPKG+ HTT GYM Y   T K+ FD ++DDVYWCTAD GWITGHSY+LYGP+  G  GI +EG+PTYP   R+W + +KY VTK YT+PT  R+LM  G+ ++    R++LK++GTVGEPINP  W+W Y+ VG +   IVDT+WQTETGGH+IT +PG T +KPG+A +PFFG    L+D  G+ I GPGEG L F + WPG+MR +Y + +R+  TY   F GYY TGDGA RD +GY  ITGR+DD++NVSGHL+STA++ESALV+H K+ EAA V  PH++KG   + FVTL      +E L  EL   VR KIGA AVPD IQ+ P LPKTRSGK+ RRILRKIA  +ES  GDT+TL D +VI  +++
Sbjct:   20 DIFLPPAPLLAGAHCAGLQSYHDLYRSSINDADEFWRTVSSELHFEQ--GTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLK-----RVTKPDGVELPKVDYTDIT---------VIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVPTYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDAEGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERINEKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSESGIGDTTTLVDESVIKQLIS 674          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Match: sur-5 (Acetoacetyl-CoA synthetase [Source:UniProtKB/Swiss-Prot;Acc:Q21166])

HSP 1 Score: 121.709 bits (304), Expect = 2.397e-28
Identity = 158/681 (23.20%), Postives = 275/681 (40.38%), Query Frame = 1
Query:  121 NIELYEPT--DHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICE--KNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNL-LGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGC-------TSLKPGSATLPFFGVETTLVDENGKEIIGPGE-GYLVFKKPWPGIMRTLYNNHE--RYEDTYFKKFAGYYTTGDGASRD-ANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXX-XXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVID 2112
            N+E +E +  +HF +  + K   DY + +  +  +   FW +  +    K   +   V+ +N      P +   F   T N   NV    IE+G    IA     +      +YTY  L  +V + A  LR  GI  GD V  ++P   +  +A+ A A +GA        F    V +R    + K+L T + V    KLID      Q  KI E  K    +E  +V    T        +A     + K          E +   ++D  L     PV + +   PLF++ +SG+TG PK +VHT GG ++     +    D K  D  +     GW+  +++++    ++G+  ++F+  P  PD   + +I  K   T       +    ++    +   Y    +  + + G P+    + +    +             + +GG   T I GC        S+ PG     F G++    +   +EII   E G LV   P+P +     N+ +  +Y D YF +   ++  GD    + + G   + GR D  LN  G  I TA++ S +   P I +   A  +  E   E    FV +        +++  +   +R  +    VP+ I  V  +P T SGK +   +++I + ++     S++ +P  +D
Sbjct:   53 NLETFELSLRNHFEEKTN-KKFADYREFHRFTCDNYGIFWEDLLKLSDVKLHQNYNQVIDHNLKINERPRW---FNGATLNYTENV----IERGTATDIAV-LNASIEETVTEYTYDNLRKDVYRIATSLRNYGIGPGDTVCGFVPNTYDTLVAVFATAAVGAAWCSASVDFGPAGVLDRFRQVHPKVLFTVNHVTYKKKLID------QTDKINEIVKELPTLEKIVVSDTFTSVKF----DATKYNQSDKF------SSLEEFKTPIADVVLPFVYTPVPFSD---PLFVMFSSGTTGIPKAMVHTVGGTLLKHIEEHLVQGDSKKHDRMFFYTTCGWMM-YNWMISFLYSKGSV-VLFDECPLAPDTHIIMKIAAKTQSTMIGMGAKLYDEYLRLQIPFNTLYDLSKIHTVYSTGSPLKKECFAYINTYIAPG------ALIASISGG---TDIIGCFVGGIKSLSITPGECQCLFLGMDIKSFNYMDEEIINSDEQGELVCVTPFPSMPSHFLNDTDGKKYRDAYFARLEPFWAHGDFVRVNHSTGGVEMLGRSDATLNRGGVRIGTAEIYSVVEKIPHIADCIVAGRLVEEGMDEEVLLFVKMVPGQELTHSIQAAIVSKLRNDMSPRHVPNKIYAVDDIPYTSSGKKVEVAVKQIVSGKA-VQKASSIRNPESLD 693          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Match: sur-5 (Acetoacetyl-CoA synthetase [Source:UniProtKB/Swiss-Prot;Acc:Q21166])

HSP 1 Score: 121.709 bits (304), Expect = 2.397e-28
Identity = 158/681 (23.20%), Postives = 275/681 (40.38%), Query Frame = 1
Query:  121 NIELYEPT--DHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICE--KNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNL-LGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGC-------TSLKPGSATLPFFGVETTLVDENGKEIIGPGE-GYLVFKKPWPGIMRTLYNNHE--RYEDTYFKKFAGYYTTGDGASRD-ANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXX-XXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVID 2112
            N+E +E +  +HF +  + K   DY + +  +  +   FW +  +    K   +   V+ +N      P +   F   T N   NV    IE+G    IA     +      +YTY  L  +V + A  LR  GI  GD V  ++P   +  +A+ A A +GA        F    V +R    + K+L T + V    KLID      Q  KI E  K    +E  +V    T        +A     + K          E +   ++D  L     PV + +   PLF++ +SG+TG PK +VHT GG ++     +    D K  D  +     GW+  +++++    ++G+  ++F+  P  PD   + +I  K   T       +    ++    +   Y    +  + + G P+    + +    +             + +GG   T I GC        S+ PG     F G++    +   +EII   E G LV   P+P +     N+ +  +Y D YF +   ++  GD    + + G   + GR D  LN  G  I TA++ S +   P I +   A  +  E   E    FV +        +++  +   +R  +    VP+ I  V  +P T SGK +   +++I + ++     S++ +P  +D
Sbjct:   53 NLETFELSLRNHFEEKTN-KKFADYREFHRFTCDNYGIFWEDLLKLSDVKLHQNYNQVIDHNLKINERPRW---FNGATLNYTENV----IERGTATDIAV-LNASIEETVTEYTYDNLRKDVYRIATSLRNYGIGPGDTVCGFVPNTYDTLVAVFATAAVGAAWCSASVDFGPAGVLDRFRQVHPKVLFTVNHVTYKKKLID------QTDKINEIVKELPTLEKIVVSDTFTSVKF----DATKYNQSDKF------SSLEEFKTPIADVVLPFVYTPVPFSD---PLFVMFSSGTTGIPKAMVHTVGGTLLKHIEEHLVQGDSKKHDRMFFYTTCGWMM-YNWMISFLYSKGSV-VLFDECPLAPDTHIIMKIAAKTQSTMIGMGAKLYDEYLRLQIPFNTLYDLSKIHTVYSTGSPLKKECFAYINTYIAPG------ALIASISGG---TDIIGCFVGGIKSLSITPGECQCLFLGMDIKSFNYMDEEIINSDEQGELVCVTPFPSMPSHFLNDTDGKKYRDAYFARLEPFWAHGDFVRVNHSTGGVEMLGRSDATLNRGGVRIGTAEIYSVVEKIPHIADCIVAGRLVEEGMDEEVLLFVKMVPGQELTHSIQAAIVSKLRNDMSPRHVPNKIYAVDDIPYTSSGKKVEVAVKQIVSGKA-VQKASSIRNPESLD 693          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0333126)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 381/672 (56.70%), Postives = 492/672 (73.21%), Query Frame = 1
Query:  112 MSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNK-YTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPAR-KLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAIL 2121
            M     +Y+P     + A++ S ++Y K Y+ES+ +P +FWS  A+QF W+   D    L+YNF+ ++GPI +   +  +TNLCYN+LDR +  GLGD+IA+YWEGN P D+++  TY  L  EVC+FA +L+  GI+KGDRV+IY+PMI+ELPIAMLACARIGAVH ++F GFS +S+AER+ D   K+L+T DG WRG K + LK + D A++  E+ G  VE CIVV H+             C+P   +  +  T+ RD WWHE M D      C  EW+++E PLF+L+TSGSTGKPKGV+HTT GY++Y + T+K VFD+K  D+YWCT D+GWITGH+YV+YGP+  GAT +IFEG P +P   R W +I+KY VT+FYTAPT IR+LMK G+  VLK+    LK+LG+VGEPINP  WLWYY+ +G+ +C IVDTFWQTETGGHVITP+PG T +KPGSA+ PFFGV+ TL+DE G EI G GEGYLVF +PWPG+MRTLYNNHER+EDTYF KF GYY TGDGA RDA+GY  ITGR+DDMLNVSGHL+STA+VES L  HP++ E+A V  PH VKGEC +CF+T  +   FD+ L ++L   VR +IG FA+PD IQ+ P LPKTRSGKIMRR+LRKIA N+ N GDTSTLAD  +++ + 
Sbjct:    1 MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLK--------RVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPA--CYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 662          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078413)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 381/672 (56.70%), Postives = 492/672 (73.21%), Query Frame = 1
Query:  112 MSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNK-YTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPAR-KLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAIL 2121
            M     +Y+P     + A++ S ++Y K Y+ES+ +P +FWS  A+QF W+   D    L+YNF+ ++GPI +   +  +TNLCYN+LDR +  GLGD+IA+YWEGN P D+++  TY  L  EVC+FA +L+  GI+KGDRV+IY+PMI+ELPIAMLACARIGAVH ++F GFS +S+AER+ D   K+L+T DG WRG K + LK + D A++  E+ G  VE CIVV H+             C+P   +  +  T+ RD WWHE M D      C  EW+++E PLF+L+TSGSTGKPKGV+HTT GY++Y + T+K VFD+K  D+YWCT D+GWITGH+YV+YGP+  GAT +IFEG P +P   R W +I+KY VT+FYTAPT IR+LMK G+  VLK+    LK+LG+VGEPINP  WLWYY+ +G+ +C IVDTFWQTETGGHVITP+PG T +KPGSA+ PFFGV+ TL+DE G EI G GEGYLVF +PWPG+MRTLYNNHER+EDTYF KF GYY TGDGA RDA+GY  ITGR+DDMLNVSGHL+STA+VES L  HP++ E+A V  PH VKGEC +CF+T  +   FD+ L ++L   VR +IG FA+PD IQ+ P LPKTRSGKIMRR+LRKIA N+ N GDTSTLAD  +++ + 
Sbjct:    1 MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLK--------RVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPA--CYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 662          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078414)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 315/526 (59.89%), Postives = 394/526 (74.90%), Query Frame = 1
Query:  547 LPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPAR-KLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAIL 2121
            +PMI+ELPIAMLACARIGAVH ++F GFS +S+AER+ D   K+L+T DG WRG K + LK + D A++  E+ G  VE CIVV H+             C+P   +  +  T+ RD WWHE M D      C  EW+++E PLF+L+TSGSTGKPKGV+HTT GY++Y + T+K VFD+K  D+YWCT D+GWITGH+YV+YGP+  GAT +IFEG P +P   R W +I+KY VT+FYTAPT IR+LMK G+  VLK+    LK+LG+VGEPINP  WLWYY+ +G+ +C IVDTFWQTETGGHVITP+PG T +KPGSA+ PFFGV+ TL+DE G EI G GEGYLVF +PWPG+MRTLYNNHER+EDTYF KF GYY TGDGA RDA+GY  ITGR+DDMLNVSGHL+STA+VES L  HP++ E+A V  PH VKGEC +CF+T  +   FD+ L ++L   VR +IG FA+PD IQ+ P LPKTRSGKIMRR+LRKIA N+ N GDTSTLAD  +++ + 
Sbjct:    1 MPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLK--------RVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPA--CYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 516          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0346110)

HSP 1 Score: 317.39 bits (812), Expect = 2.388e-97
Identity = 207/641 (32.29%), Postives = 318/641 (49.61%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQF----FWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCD-GVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWV--ESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTY-PDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDD--YVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGC-TSLKPG--SATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFC-FVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE 2064
            Y K Y +S+++P  FW            W++  DN N           P +   +  G  N CYN +DR I  G G  +A   +        + TY  L+ ++   A  L   G+ KGDRV IY+P+I E  IAMLA  R+GA+H V+FGGF+A  +  RI     K+++  + GV  G  +  L ++      I      P +  I+ +                 P    L  +T   D  W + +  +   G+ P+  V  E+  PL+IL+TSG+T KPKGV+ T GG+++    T + ++       +W  +D+GW+ GHSY+ YGP+  GAT +++EG P   PD G+ ++II++Y V   ++ PT  R + +   D  Y  +Y  +SL+ +   GE  +  T  W  +     + P+++ +WQTETG  V     G   +L P   S  LP  G +  ++  +G E      G +  K P  PG M TLY N E +   YF+KF GYY T D   +D  GY  +T R DD++NV+GH +ST+ +E A++ HP +V+ A   VP   KG+   C ++ + +    D  L TE+   +R  +G  A    +  V  LP+TRSGK MR+ +   A NE
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSN-----------PPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLAKLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHS---AISMSRWRPPQRNIIFRR------------DNVSPDTTKLDPLT---DVLWSDILKMAE--GERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTF---KVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNE 634          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0084606)

HSP 1 Score: 317.39 bits (812), Expect = 2.388e-97
Identity = 207/641 (32.29%), Postives = 318/641 (49.61%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQF----FWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCD-GVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWV--ESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTY-PDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDD--YVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGC-TSLKPG--SATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFC-FVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE 2064
            Y K Y +S+++P  FW            W++  DN N           P +   +  G  N CYN +DR I  G G  +A   +        + TY  L+ ++   A  L   G+ KGDRV IY+P+I E  IAMLA  R+GA+H V+FGGF+A  +  RI     K+++  + GV  G  +  L ++      I      P +  I+ +                 P    L  +T   D  W + +  +   G+ P+  V  E+  PL+IL+TSG+T KPKGV+ T GG+++    T + ++       +W  +D+GW+ GHSY+ YGP+  GAT +++EG P   PD G+ ++II++Y V   ++ PT  R + +   D  Y  +Y  +SL+ +   GE  +  T  W  +     + P+++ +WQTETG  V     G   +L P   S  LP  G +  ++  +G E      G +  K P  PG M TLY N E +   YF+KF GYY T D   +D  GY  +T R DD++NV+GH +ST+ +E A++ HP +V+ A   VP   KG+   C ++ + +    D  L TE+   +R  +G  A    +  V  LP+TRSGK MR+ +   A NE
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSN-----------PPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLAKLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHS---AISMSRWRPPQRNIIFRR------------DNVSPDTTKLDPLT---DVLWSDILKMAE--GERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRRADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTF---KVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEAQTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKKTDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNE 634          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 810.831 bits (2093), Expect = 0.000e+0
Identity = 394/668 (58.98%), Postives = 494/668 (73.95%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCY--GIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            L+ P D  +K AH+ S + Y +LY +S++SP++FW++ A+ FFWK K   +  L YNF   +G IY+   +  TTN+CYNVLDR + E+ LGD++AFYWEGN+P D    TY  L  +VCKFA +L+++G+KKGDRV+IY+PM++EL +AMLACARIGAVH ++F GFS+ES+ ERI D  C +L+T DG +RG+KLI+LK+I+D+A+K C     PVE CI++KH+T            P  R    L V      D  WH  +  ++   +C   W +SE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTL D   +++ L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +VI+ +  
Sbjct:   12 LHAPGD-LKKEAHIPSFEKYKELYIKSVESPEEFWADVAKDFFWKTKYTGK-FLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQGVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQVPWNPEVDMCWHSLIGGAS--EECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNERDLGDVSTLADSSVIEHLFE 675          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 395/684 (57.75%), Postives = 498/684 (72.81%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVT-----------------CYGIGKCTEAPGCRPARKLLVNMTNPR-DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            L+ P D  +K AH+ S + Y +LY +S++SP++FW++ A+ FFWK K   +  L YNF   +G IY+   +  TTN+CYNVLDR + E+ LGD++AFYWEGN+P D    TY  L  +VCKFA +L+++G+KKGDRV+IY+PM++EL +AMLACARIGAVH ++F GFS+ES+ ERI D  C +L+T DG +RG+KLI+LK+I+D+A+K C     PVE CI++KH+T                 C  + +  +    R  R       NP  D  WH  +  ++   +C   W +SE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTL D   +++ L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +VI+ +  
Sbjct:   12 LHAPGD-LKKEAHIPSFEKYKELYIKSVESPEEFWADVAKDFFWKTKYTGK-FLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQGVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGAS--EECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNERDLGDVSTLADSSVIEHLFE 691          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 376/684 (54.97%), Postives = 479/684 (70.03%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVT-----------------CYGIGKCTEAPGCRPARKLLVNMTNPR-DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            L+ P D  +K AH+ S + Y +LY +S++SP++FW++ A+ FFWK K   +  L YNF   +G IY+   +  TTN+CYNVLDR + E+ LGD++AFYWEGN+P D    TY  L  +VCKFA +L+++G+KKGDRV+IY+PM++EL +AMLACARIGAVH ++F GFS+ES+ ERI D  C +L+T DG +RG+KLI+LK+I+D+A+K C     PVE CI++KH+T                 C  + +  +    R  R       NP  D  WH  +  ++   +C   W +SE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTL D   +++ L  EL                          + GKIMRR+LRKIA NE + GD STLAD +VI+ +  
Sbjct:   12 LHAPGD-LKKEAHIPSFEKYKELYIKSVESPEEFWADVAKDFFWKTKYTGK-FLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQGVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGAS--EECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELK-------------------------KQGKIMRRVLRKIACNERDLGDVSTLADSSVIEHLFE 666          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Match: acss2l (acyl-CoA synthetase short chain family member 2 like [Source:ZFIN;Acc:ZDB-GENE-130530-723])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 362/693 (52.24%), Postives = 475/693 (68.54%), Query Frame = 1
Query:   85 PVQSDSDTIMSTNIE----LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGN---DPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKIC-EKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDE----WWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            PV   ++T +S+  E    +Y P D     AH+   D Y  LY++SI+ P++FW + A++FFWK KP +  +LQYNF   +G +++       TN+CYNVLDR + E+ LGDK+A+YW+ N       +N   + ++ +    F  L R      G  ++  +P+++ LP   L   R+ +  +V F GFS+ES+ ERI D  C ILVT DGV+RG+KLI+LK I+ +A+  C E + S V+ C+VVKH            P    +     ++  P DE    WW + M    +  +C  EW++SE PLFIL+TSGSTGKPKGVVHT  GYM+Y S+T+K+VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+P +P  GRLW+IIEKY V+KFYTAPT IR LMK G + + +Y   SL++LGTVGEPINP  WLWYY+VVG+ RCP++DTFWQTETGGHV+TP+P  T LKPGSAT PFFGV+  +++E+G+E+ G  EGYLVF++PWPGIMR ++ N ER+E TYF+KF G+Y TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESAL  HP + EAA V  PH VKGEC +CF+TL D   F+  L  EL   VR KIG  A PD+IQ+ P LPKTRSGKIMRR+LR+IA NE   GD STLADP V++ + +
Sbjct:    3 PVSDSTNTALSSPKEPEEKIYHPPDGIFTDAHVPDFDAYLALYKKSIEEPEEFWGDVAQEFFWK-KPPSGQMLQYNFDVTKGSVFIKFMDGAKTNICYNVLDRNVHERNLGDKVAYYWQSNLIHQNASYNVKKHSFIRSTA--FPGLGRG-----GSSLSTKIPLLLSLPSRSLFNRRLNSDLVVQFAGFSSESLCERIMDAQCNILVTADGVYRGDKLINLKKIASEALDRCKESSASSVQKCVVVKH------------PAFITSSDASSSLQTPWDELCDIWWDDLMD--GVSDECEPEWMDSEDPLFILYTSGSTGKPKGVVHTVTGYMLYTSLTFKYVFDYHHDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGVPVHPHVGRLWEIIEKYGVSKFYTAPTAIRLLMKYGKEPLQRYDLSSLRVLGTVGEPINPEAWLWYYDVVGQQRCPVIDTFWQTETGGHVLTPLPAATPLKPGSATCPFFGVQPAILNEHGEELEGEAEGYLVFRQPWPGIMRGVFGNQERFESTYFRKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALSEHPSVAEAAVVSCPHAVKGECLYCFITLKDQQEFNRTLMDELKRKVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKELGDLSTLADPKVVEVLFS 673          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 269/408 (65.93%), Postives = 319/408 (78.19%), Query Frame = 1
Query:  901 WHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            WH  +  ++   +C   W +SE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTL D   +++ L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +VI+ +  
Sbjct:    3 WHSLIGGAS--EECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTLNDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNERDLGDVSTLADSSVIEHLFE 408          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Match: ACSS2 (acyl-CoA synthetase short chain family member 2, gene 1 [Source:NCBI gene;Acc:100486264])

HSP 1 Score: 793.497 bits (2048), Expect = 0.000e+0
Identity = 400/683 (58.57%), Postives = 493/683 (72.18%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIE-QGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGI---GKCTEAPGCR-------------PARK-LLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++ P       AH+ S   Y +LYE SI+ PD+FW   A +F W+  P  +  L+YNF   +G I++   K G TN+CYNVLDR ++ + LGDKIAFYWEGN+P D    TY  L  +VC+FA +LR +GIKKGDRV+IY+PM+IEL +AMLACARIGA+H ++F GFS+ES+ ERI D NC +L+T DG +RG+KLI+LK I+D+A+K C +   P+  CIV+KH+    I   G    +P C+             P R    +N     D WWHE + D+++  +C  EW +SE  LFIL+TSGSTGKPKGVVHT GGYMIY + T+K+VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+P YPD  R+WQII+KY V+KFYTAPT IR LMK G++ V +Y R+SLK+LGTVGEPINP  WLWYY VVG+ RCPIVDTFWQTETGGHV+TP+PG T+ KPGSAT PFFGV   ++DE+G+E+ G  EGYLVFK+PWP +MRT+Y N ER+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  I EAA V  PH VKGEC +CFVTL D   F   L  +L   VR KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GD STLAD  VI  +  
Sbjct:    6 VFPPAPEVSAAAHIPSYARYQELYERSIRHPDEFWGEIANEFHWRVPP-AQPFLRYNFDVTKGKIFIEWMKGGVTNICYNVLDRNVQDKKLGDKIAFYWEGNEPGDSMSITYSELLRKVCQFANVLRGQGIKKGDRVSIYMPMVIELVVAMLACARIGAIHSIVFAGFSSESLCERILDSNCTLLITADGFFRGDKLINLKSIADEALKKCAEKNYPLSKCIVLKHLGRDEIVSDGPSKISPPCKRQCPDLQGKKQEKPKRSHPQINWKPSVDMWWHELIKDASV--ECEPEWCDSEDELFILYTSGSTGKPKGVVHTVGGYMIYTATTFKYVFDYHPDDVYWCTADIGWITGHSYLTYGPLANGATSVLFEGLPIYPDISRMWQIIDKYNVSKFYTAPTAIRLLMKYGEEPVKRYSRKSLKVLGTVGEPINPEAWLWYYNVVGDKRCPIVDTFWQTETGGHVLTPLPGATTAKPGSATFPFFGVVPAILDESGEELEGEAEGYLVFKQPWPALMRTVYGNQERFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHSSIAEAAVVSHPHPVKGECLYCFVTLRDGHEFTSTLVDQLKKLVREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAKNDRDLGDISTLADSTVIQQLFE 685          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Match: ENSXETT00000021220.1 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:NCBI gene;Acc:100492069])

HSP 1 Score: 779.245 bits (2011), Expect = 0.000e+0
Identity = 377/665 (56.69%), Postives = 478/665 (71.88%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR-FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            Y P    ++ AH+     Y ++Y+ S+ +P +FW   A +F+WK+ P  + VL YNF   +G I+V   K   TN+CYN+LDR  +E+ LGDK AF+WEGN   + +  TY  L   VCKFA +L   G++KGDRVAIYLPMI EL  AMLACARIGAVH ++F GFS+ES+ ERI D  C +LVT DGV+RG K I+LK I+D+A++ C++    V+ C+VVKH+     G             L     +  D W  E + D++   +C  EW+++E PLFIL+TSGSTGKPKGVVHT  GY++Y ++T+K+VFD+ +DDVYW TADIGWITGHSY++YGP+  GAT ++FEGIPTYP  GR W+I+EKY VT+FYTAPT IR LMK G+D V K+   SLKILGTVGEPIN   WLW+Y V+G  RCPIVDTFWQTETGGHV+TP+P  T LKPGSAT PFFGV   +++E+GKE+ G  EGYLVFK+PWP IMRTLY NHERYE+TYFKKF GYY  GDG  RD +GY  ITGRIDDMLNVSGHL+STA+VE+AL  HP + EAA V  PH+VKGEC +CF+ L D   + E +  E+   VR KIG  A PD+IQ+ P LPKTRSGKIMRR+LR+IA NE + GD STLADP++++ + +
Sbjct:   28 YNPPALLQRHAHVPDFSTYTEMYKRSVHNPQEFWLEVASEFYWKKTPSGK-VLDYNFDINKGKIFVEFMKGAKTNVCYNILDRNVMEKNLGDKTAFFWEGNSQANSSVITYWELLKHVCKFANVLIKLGVRKGDRVAIYLPMIPELVYAMLACARIGAVHSIVFAGFSSESLCERILDSQCVVLVTADGVFRGEKPINLKQIADEALQKCKEKMHHVKNCVVVKHLK----GSPIILLHLSLYVVLQTAWNSDVDRWLDELVEDAS--DECEPEWLDAEDPLFILYTSGSTGKPKGVVHTVAGYLLYTALTFKYVFDYHEDDVYWSTADIGWITGHSYIVYGPLANGATSVMFEGIPTYPHVGRFWEIVEKYKVTQFYTAPTAIRLLMKYGNDAVQKFDLNSLKILGTVGEPINSEAWLWFYNVIGNQRCPIVDTFWQTETGGHVVTPLPAATPLKPGSATFPFFGVVPAVLNEHGKELEGEAEGYLVFKQPWPSIMRTLYGNHERYENTYFKKFPGYYVAGDGCRRDKDGYIWITGRIDDMLNVSGHLLSTAEVEAALTEHPAVAEAAVVSRPHQVKGECLYCFIILKDGMKYTERIAEEVKKQVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKDLGDISTLADPSIVEVLFS 685          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Match: ENSXETT00000021237.1 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:NCBI gene;Acc:100492069])

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 374/665 (56.24%), Postives = 477/665 (71.73%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR-FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            Y P    ++ AH+     Y ++Y+ S+ +P +FW   A +F+WK+ P  + VL YNF   +G I+V   K   TN+CYN+LDR  +E+ LGDK AF+WEGN   + +  TY  L   VCKFA +L   G++KGDRVAIYLPMI EL  AMLACARIGAVH ++F GFS+ES+ ERI D  C +LVT DGV+RG K I+LK I+D+A++ C++N       I++ H++ Y +              L     +  D W  E + D++   +C  EW+++E PLFIL+TSGSTGKPKGVVHT  GY++Y ++T+K+VFD+ +DDVYW TADIGWITGHSY++YGP+  GAT ++FEGIPTYP  GR W+I+EKY VT+FYTAPT IR LMK G+D V K+   SLKILGTVGEPIN   WLW+Y V+G  RCPIVDTFWQTETGGHV+TP+P  T LKPGSAT PFFGV   +++E+GKE+ G  EGYLVFK+PWP IMRTLY NHERYE+TYFKKF GYY  GDG  RD +GY  ITGRIDDMLNVSGHL+STA+VE+AL  HP + EAA V  PH+VKGEC +CF+ L D   + E +  E+   VR KIG  A PD+IQ+ P LPKTRSGKIMRR+LR+IA NE + GD STLADP++++ + +
Sbjct:   28 YNPPALLQRHAHVPDFSTYTEMYKRSVHNPQEFWLEVASEFYWKKTPSGK-VLDYNFDINKGKIFVEFMKGAKTNVCYNILDRNVMEKNLGDKTAFFWEGNSQANSSVITYWELLKHVCKFANVLIKLGVRKGDRVAIYLPMIPELVYAMLACARIGAVHSIVFAGFSSESLCERILDSQCVVLVTADGVFRGEKPINLKQIADEALQKCKENP------IILLHLSLYVV--------------LQTAWNSDVDRWLDELVEDAS--DECEPEWLDAEDPLFILYTSGSTGKPKGVVHTVAGYLLYTALTFKYVFDYHEDDVYWSTADIGWITGHSYIVYGPLANGATSVMFEGIPTYPHVGRFWEIVEKYKVTQFYTAPTAIRLLMKYGNDAVQKFDLNSLKILGTVGEPINSEAWLWFYNVIGNQRCPIVDTFWQTETGGHVVTPLPAATPLKPGSATFPFFGVVPAVLNEHGKELEGEAEGYLVFKQPWPSIMRTLYGNHERYENTYFKKFPGYYVAGDGCRRDKDGYIWITGRIDDMLNVSGHLLSTAEVEAALTEHPAVAEAAVVSRPHQVKGECLYCFIILKDGMKYTERIAEEVKKQVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKDLGDISTLADPSIVEVLFS 669          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Match: ENSXETT00000021244.1 (acyl-CoA synthetase short-chain family member 2, gene 2 [Source:NCBI gene;Acc:100492069])

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 376/675 (55.70%), Postives = 479/675 (70.96%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR-FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKN-----GSPVECCIVVKHVTCYGIGKCTE-APGCRPARKLLVNM----TNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            Y P    ++ AH+     Y ++Y+ S+ +P +FW   A +F+WK+ P  + VL YNF   +G I+V   K   TN+CYN+LDR  +E+ LGDK AF+WEGN   + +  TY  L   VCKFA +L   G++KGDRVAIYLPMI EL  AMLACARIGAVH ++F GFS+ES+ ERI D  C +LVT DGV+RG K I+LK I+D+A++ C++         +   I +  +     GK  E +P       L V +     +  D W  E + D++   +C  EW+++E PLFIL+TSGSTGKPKGVVHT  GY++Y ++T+K+VFD+ +DDVYW TADIGWITGHSY++YGP+  GAT ++FEGIPTYP  GR W+I+EKY VT+FYTAPT IR LMK G+D V K+   SLKILGTVGEPIN   WLW+Y V+G  RCPIVDTFWQTETGGHV+TP+P  T LKPGSAT PFFGV   +++E+GKE+ G  EGYLVFK+PWP IMRTLY NHERYE+TYFKKF GYY  GDG  RD +GY  ITGRIDDMLNVSGHL+STA+VE+AL  HP + EAA V  PH+VKGEC +CF+ L D   + E +  E+   VR KIG  A PD+IQ+ P LPKTRSGKIMRR+LR+IA NE + GD STLADP++++ + +
Sbjct:   19 YNPPALLQRHAHVPDFSTYTEMYKRSVHNPQEFWLEVASEFYWKKTPSGK-VLDYNFDINKGKIFVEFMKGAKTNVCYNILDRNVMEKNLGDKTAFFWEGNSQANSSVITYWELLKHVCKFANVLIKLGVRKGDRVAIYLPMIPELVYAMLACARIGAVHSIVFAGFSSESLCERILDSQCVVLVTADGVFRGEKPINLKQIADEALQKCKEKYVFDLFENIWAPIFLGRLNNQNEGKFQEHSPIILLHLSLYVVLQTAWNSDVDRWLDELVEDAS--DECEPEWLDAEDPLFILYTSGSTGKPKGVVHTVAGYLLYTALTFKYVFDYHEDDVYWSTADIGWITGHSYIVYGPLANGATSVMFEGIPTYPHVGRFWEIVEKYKVTQFYTAPTAIRLLMKYGNDAVQKFDLNSLKILGTVGEPINSEAWLWFYNVIGNQRCPIVDTFWQTETGGHVVTPLPAATPLKPGSATFPFFGVVPAVLNEHGKELEGEAEGYLVFKQPWPSIMRTLYGNHERYENTYFKKFPGYYVAGDGCRRDKDGYIWITGRIDDMLNVSGHLLSTAEVEAALTEHPAVAEAAVVSRPHQVKGECLYCFIILKDGMKYTERIAEEVKKQVREKIGPIATPDFIQNAPGLPKTRSGKIMRRVLRQIARNEKDLGDISTLADPSIVEVLFS 690          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Match: ACSS2 (acyl-CoA synthetase short chain family member 2, gene 1 [Source:NCBI gene;Acc:100486264])

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 389/677 (57.46%), Postives = 481/677 (71.05%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIE-QGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGI---GKCTEAPGC-RPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGS-------ATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++ P       AH+ S   Y +LYE SI+ PD+FW   A +F W+  P  +  L+YNF   +G I++   K G TN+CYNVLDR ++ + LGDKIAFYWEGN+P D    TY  L  +VC+FA +LR +GIKKGDRV+IY+PM+IEL +AMLACARIGA+H ++F GFS+ES+ ERI D NC +L+T DG +RG+KLI+LK I+D+A+K C +   P+  CIV+KH+    I   G    +P C R    L +N     D WWHE + D+++  +C  EW +SE  LFIL+TSGSTGKPKGVVHT GGYMIY + T+K+VFD+  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+P YPD  R+WQII+KY V+KFYTAPT IR LMK G++ V +Y R+SLK+LGTVGEPINP  WLWYY VVG+ RCPIVDTFWQTET  ++   I    +  P S        T PFFGV   ++DE+G+E+ G  EGYLVFK+PWP +MRT+Y N ER+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  I EAA V  PH VKGEC +CFVTL D   F   L  +L   VR KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GD STLAD  VI  +  
Sbjct:    6 VFPPAPEVSAAAHIPSYARYQELYERSIRHPDEFWGEIANEFHWRVPP-AQPFLRYNFDVTKGKIFIEWMKGGVTNICYNVLDRNVQDKKLGDKIAFYWEGNEPGDSMSITYSELLRKVCQFANVLRGQGIKKGDRVSIYMPMVIELVVAMLACARIGAIHSIVFAGFSSESLCERILDSNCTLLITADGFFRGDKLINLKSIADEALKKCAEKNYPLSKCIVLKHLGRDEIVSDGPSKISPPCKRQCPDLQINWKPSVDMWWHELIKDASV--ECEPEWCDSEDELFILYTSGSTGKPKGVVHTVGGYMIYTATTFKYVFDYHPDDVYWCTADIGWITGHSYLTYGPLANGATSVLFEGLPIYPDISRMWQIIDKYNVSKFYTAPTAIRLLMKYGEEPVKRYSRKSLKVLGTVGEPINPEAWLWYYNVVGDKRCPIVDTFWQTETVIYLFFNITILYTNFPYSFIPYFLFKTFPFFGVVPAILDESGEELEGEAEGYLVFKQPWPALMRTVYGNQERFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHSSIAEAAVVSHPHPVKGECLYCFVTLRDGHEFTSTLVDQLKKLVREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAKNDRDLGDISTLADSTVIQQLFE 679          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 395/683 (57.83%), Postives = 499/683 (73.06%), Query Frame = 1
Query:   91 QSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIG----KCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++  +T     +  + P    R+ AH+ S+  Y +L+  S++ P +FW N A++F+WK        LQYNF   +G I+    K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  K TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI+EL +AMLACAR+GA+H ++F GFSAES+ ERI D +C +L+T D  +RG KL++LK ++D++++ C + G PV CCIVVKH+    +G         P  RP   + +      D WWHE M  +    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD GRLW I++KY VTKFYTAPT IR LMK GDD V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSA+ PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GDTST+ADP+VI+ + +
Sbjct:   15 RAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPREFWGNIAKEFYWKTACPG-PFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFS 694          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 797.349 bits (2058), Expect = 0.000e+0
Identity = 394/696 (56.61%), Postives = 501/696 (71.98%), Query Frame = 1
Query:   91 QSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMT----------NPR-------DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++  +T     +  + P    R+ AH+ S+  Y +L+  S++ P +FW N A++F+WK        LQYNF   +G I+    K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  K TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI+EL +AMLACAR+GA+H ++F GFSAES+ ERI D +C +L+T D  +RG KL++LK ++D++++ C + G PV CCIVVKH+    +G         P ++   ++            P+       D WWHE M  +    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD GRLW I++KY VTKFYTAPT IR LMK GDD V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSA+ PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GDTST+ADP+VI+ + +
Sbjct:   15 RAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPREFWGNIAKEFYWKTACPG-PFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQGKLREKSKCIRPQICWNEGVDLWWHELMQQAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFS 707          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 373/648 (57.56%), Postives = 469/648 (72.38%), Query Frame = 1
Query:   91 QSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIG----KCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRS 2019
            ++  +T     +  + P    R+ AH+ S+  Y +L+  S++ P +FW N A++F+WK        LQYNF   +G I+    K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  K TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI+EL +AMLACAR+GA+H ++F GFSAES+ ERI D +C +L+T D  +RG KL++LK ++D++++ C + G PV CCIVVKH+    +G         P  RP   + +      D WWHE M  +    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD GRLW I++KY VTKFYTAPT IR LMK GDD V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSA+ PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRS
Sbjct:   15 RAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPREFWGNIAKEFYWKTACPG-PFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRS 659          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Match: Acss1 (acyl-CoA synthetase short-chain family member 1 [Source:MGI Symbol;Acc:MGI:1915988])

HSP 1 Score: 528.48 bits (1360), Expect = 2.782e-178
Identity = 283/650 (43.54%), Postives = 397/650 (61.08%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPG--CTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE-SNFGDTSTLADPNVIDAILN 2124
            Y  L  ++ + P  FW   A        P +  V   +F   +    +  F  G  N+  N LD+ +++   + IA  WE ++P    + TY  L    C+ A  L+  G+ +GDRVAIY+P+      AMLACARIGA+H V+F GFSAES+A RI+D  CK ++T +   RG ++++LK I D+A+K C     P    ++V H T       T+ P        + ++  P ++   E   ++ +   C  E + SE  LF+L+TSGSTG PKG+VHT  GY++Y +MT+K VFD++  DV+ C ADIGWITGHSYV+YGP+  GAT ++FE  P YPDAGR W+ +++  + +FY APT +R L+K GD +V KY R SL+ LG+VGEPIN   W W ++VVG+ RC +VDT+WQTETGG  I P P      + PG A  PFFG+   L+DE G  + G    G L   + WPG+ RT+Y +H+R+ D YF+ + GYY TGDGA R   GYY ITGR+DD++N+SGH + TA++E A+  HP + E A +  PH++KGE  F F+ L D  + +  +  EL  +V TKI  +AVPD I  V  LPKTRSGK+MRR+LRKI  +   + GDT+TL DP+VI  IL+
Sbjct:   51 YPALSAQAAQEPAAFWGPLARDTLVWDTPYH-TVWDCDFRTGK----IGWFLGGQLNVSVNCLDQHVQKS-PETIALIWERDEPGTEVRITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVKSC-----PTVQHVLVAHRT------DTKVP--------MGSLDIPLEQ---EMAKEAPV---CTPESMSSEDMLFMLYTSGSTGTPKGLVHTQAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYPDAGRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIAPRPSEDGAEILPGMAMRPFFGIVPVLMDEKGNVLEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDNISDENMVVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLEDPSVITEILS 669          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 353.984 bits (907), Expect = 6.070e-111
Identity = 229/675 (33.93%), Postives = 344/675 (50.96%), Query Frame = 1
Query:  175 SMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLY--LHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCD-GVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLL--------VNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPT-YPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVL--KYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLK---PGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTL-ADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKINV 2142
            S  +Y   +  S+  P++FW   AEQ  W  KP  + +       +R P   + F +G  N+CYN +DR IE G GDKIA  +  + P+   K T  Y  +  +V K A +L  +G+KKGD V IY+PMI +    MLACARIGA+H +IFGGF+++ ++ RI     K++VT   G+  G K+  + ++ ++A++I +                             RP R L+        V + + RD  W E M+ +      PV    SEHPL+IL+TSG+TG PKGVV  TGGY +  + T   ++  K  +V+W  +D+GW+ GHSY+ YGP+  G T +++EG P   PDAG  ++++ ++ V   +TAPT IR++ +      L  +Y     K L   GE  +  T  W  +V    R P++D +WQTETG  +     G  + K   PG A     G    ++D+N +++     G +V K P  PG    L+ N E ++  YF+KF GYY T D    D  GY  +  R+DD++NV+GH IS   +E +++SH  + + A V     +KG        L  D    +E +  E+  +VR  IG  A       V  LPKTRSGKI R  L  + N +  +  T T+ DP++   I  + K  V
Sbjct:   53 SGGEYKTHFAASVADPERFWGKAAEQISW-YKPWTKTL------ESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIY--DSPVTDTKATISYKEVLEQVSKLAGVLVKQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLL-EEALRIGQH----------------------------RPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVL---SEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVF---RVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNVMILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKP-YKVTPTIEDPSIFGHIEEVLKQAV 682          
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Match: sp|Q9QXG4|ACSA_MOUSE (Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus musculus OX=10090 GN=Acss2 PE=1 SV=2)

HSP 1 Score: 805.053 bits (2078), Expect = 0.000e+0
Identity = 395/683 (57.83%), Postives = 499/683 (73.06%), Query Frame = 1
Query:   91 QSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIG----KCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++  +T     +  + P    R+ AH+ S+  Y +L+  S++ P +FW N A++F+WK        LQYNF   +G I+    K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  K TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI+EL +AMLACAR+GA+H ++F GFSAES+ ERI D +C +L+T D  +RG KL++LK ++D++++ C + G PV CCIVVKH+    +G         P  RP   + +      D WWHE M  +    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD GRLW I++KY VTKFYTAPT IR LMK GDD V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSA+ PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NH R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GDTST+ADP+VI+ + +
Sbjct:   15 RAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPREFWGNIAKEFYWKTACPG-PFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFS 694          
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Match: sp|Q9VP61|ACSA_DROME (Acetyl-coenzyme A synthetase OS=Drosophila melanogaster OX=7227 GN=AcCoAS PE=2 SV=1)

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 382/672 (56.85%), Postives = 493/672 (73.36%), Query Frame = 1
Query:  112 MSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNK-YTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPAR-KLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAIL 2121
            M     +Y+P     + A++ S ++Y K Y+ES+ +P +FWS  A+QF W+   D    L+YNF+ ++GPI +   +  +TNLCYN+LDR +  GLGD+IA+YWEGN P D+++  TY  L  EVC+FA +L+  GI+KGDRV+IY+PMI+ELPIAMLACARIGAVH ++F GFS +S+AER+ D   K+L+T DG WRG K + LK + D A++  E+ G  VE CIVV H+             C+P   +  +  T+ RD WWHE M D      C  EW+++E PLF+L+TSGSTGKPKGV+HTT GY++Y + T+K VFD+K  D+YWCTAD+GWITGH+YV+YGP+  GAT +IFEG P +P   R W +I+KY VT+FYTAPT IR+LMK G+  VLK+    LK+LG+VGEPINP  WLWYY+ +G+ +C IVDTFWQTETGGHVITP+PG T +KPGSA+ PFFGV+ TL+DE G EI G GEGYLVF +PWPG+MRTLYNNHER+EDTYF KF GYY TGDGA RDA+GY  ITGR+DDMLNVSGHL+STA+VES L  HP++ E+A V  PH VKGEC +CF+T  +   FD+ L ++L   VR +IG FA+PD IQ+ P LPKTRSGKIMRR+LRKIA N+ N GDTSTLAD  +++ + 
Sbjct:    1 MPAEKSIYDPNPAISQNAYISSFEEYQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISKGPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDHGIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLK--------RVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEPA--CYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTADVGWITGHTYVVYGPLANGATSVIFEGTPFFPGNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGEGYLVFSQPWPGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFITPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIAVNDRNVGDTSTLADEQIVEQLF 662          
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Match: sp|Q9NR19|ACSA_HUMAN (Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo sapiens OX=9606 GN=ACSS2 PE=1 SV=1)

HSP 1 Score: 800.045 bits (2065), Expect = 0.000e+0
Identity = 392/669 (58.59%), Postives = 496/669 (74.14%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHV--TCYGIGKCTEA--PGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            + P     + AH+ S+  Y +L+  S++ P +FW + A++F+WK  P     L+YNF   +G I++   K  TTN+CYNVLDR + E+ LGDK+AFYWEGN+P +  + TY  L  +VC+F+ +LR +GI+KGDRVAIY+PMI EL +AMLACARIGA+H ++F GFS+ES+ ERI D +C +L+T D  +RG KL++LK ++D+A++ C++ G PV CCIVVKH+     G+G  T    P  R    + ++     D WWHE M ++    +C  EW ++E PLFIL+TSGSTGKPKGVVHT GGYM+Y + T+K+VFD   +DV+WCTADIGWITGHSYV YGP+  GAT ++FEGIPTYPD  RLW I++KY VTKFYTAPT IR LMK GD+ V K+ R SL++LGTVGEPINP  WLWY+ VVG  RCPIVDTFWQTETGGH++TP+PG T +KPGSAT PFFGV   +++E+G+E+ G  EGYLVFK+PWPGIMRT+Y NHER+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGEC +CFVTL D  TF   L  EL   +R KIG  A PDYIQ+ P LPKTRSGKIMRR+LRKIA N+ + GD ST+ADP+VI  + +
Sbjct:   29 WSPPPEVSRSAHVPSLQRYRELHRRSVEEPREFWGDIAKEFYWK-TPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAG--DECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIPTYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSATFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLGDMSTVADPSVISHLFS 694          
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Match: sp|B9DGD6|ACS_ARATH (Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal OS=Arabidopsis thaliana OX=3702 GN=ACS PE=1 SV=1)

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 360/679 (53.02%), Postives = 461/679 (67.89%), Query Frame = 1
Query:  103 DTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE-SNFGDTSTLADPNVIDAILNITKI 2136
            +++ S   +L  P+  F   A + S   Y ++++ S+  P  FWS+ A +F+WKQK  ++ V   N    +GPI +  FK G TN+CYN LD+ +E GLGDK A +WEGN+       TY  L   VC+ A  L+  G+KKGD V IYLPM++ELPIAMLACARIGAVH V+F GFSA+S+A+RI D    +++TC+ V RG K I+LK I D A+    K+G  V  C+   +                   +      N RD WW + +S       C VEWV++E PLF+L+TSGSTGKPKGV+HTTGGYMIY + T+K+ FD+K  DVYWCTAD GWITGHSYV YGPM  GAT ++FEG P YPD GR W I++KY V+ FYTAPT++RSLM+  D +V ++ R+SL++LG+VGEPINP  W W++ VVG++RCPI DT+WQTETGG +ITP+PG    KPGSAT PFFGV+  +VDE G EI G   GYL  K  WPG  RTL+ +HERYE TYFK FAGYY +GDG SRD +GYY +TGR+DD++NVSGH I TA+VESALV HP+  EAA V + HEVKG+  + FVTL +   + E LR  L   VR +IGAFA PD I   P LPKTRSGKIMRRILRKIA+ +    GDTSTLADP+V+D ++ +  +
Sbjct:   82 ESLASEENDLVFPSKEFSGQALVSSPQQYMEMHKRSMDDPAAFWSDIASEFYWKQKWGDQ-VFSENLDVRKGPISIEWFKGGITNICYNCLDKNVEAGLGDKTAIHWEGNELGVDASLTYSELLQRVCQLANYLKDNGVKKGDAVVIYLPMLMELPIAMLACARIGAVHSVVFAGFSADSLAQRIVDCKPNVILTCNAVKRGPKTINLKAIVDAALDQSSKDGVSVGICLTYDNSLA--------------TTRENTKWQNGRDVWWQDVIS--QYPTSCEVEWVDAEDPLFLLYTSGSTGKPKGVLHTTGGYMIYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGPMLNGATVVVFEGAPNYPDPGRCWDIVDKYKVSIFYTAPTLVRSLMRDDDKFVTRHSRKSLRVLGSVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSATFPFFGVQPVIVDEKGNEIEGECSGYLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGDGCSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALVLHPQCAEAAVVGIEHEVKGQGIYAFVTLLEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIASRQLEELGDTSTLADPSVVDQLIALADV 743          
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Match: sp|B8FIN2|ACSA_DESAL (Acetyl-coenzyme A synthetase OS=Desulfatibacillum aliphaticivorans OX=218208 GN=acsA PE=3 SV=1)

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 342/647 (52.86%), Postives = 450/647 (69.55%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE-SNFGDTSTLADPNVIDAILN 2124
            Y K+Y+ES+  PD FWS  A++  W +         +N     G + +  F DG  N+ YN LDR +E+  GD+ A  +EGN+P    K TY  L+  VC+F+ +L++ G+KKGDRV+IYLPMI +L +AMLACARIGA+H ++F GFS +++A RI+D  C IL+T D   RG K I LK  +D+AM   +K G  V+ CIVVKH                      V M   RD WWHE  +  +   +CP E ++SE PLFIL+TSGSTG PKGV+HTTGGY++Y S+T+++VFD+ D D+YWCTADIGW+TGHSY++YGP+  GA  I+FEGIP YPD  R WQI +K+ V  FYTAPTV+R+LM+ GD+ V    R S+++LGTVGEPINP  WLWY+ VVGE RCPIVDT+WQTETGG +ITP+PG T+LKPGSAT PFFG++  L+D+ G ++ GPGEGYLV    WP + RT+Y +H R++ TYF +  G Y +GDGA RD +GYY ITGRIDD++NVSGH + TA++ES+LV+HP + EAA V  PH++KG+  + +VTL+  +   E LR ELS  VR  IG  A P+ +Q   +LPKTRSGKIMRRILRK+A NE  N GDTSTLADP V++A++ 
Sbjct:   23 YQKMYDESVNDPDAFWSREAQRIDWFEPFSKVKNSSFN-----GDVDIKWFLDGKLNVAYNCLDRHLEK-RGDQTAIIFEGNEPGVEEKITYRQLYERVCRFSNVLKSCGVKKGDRVSIYLPMIPQLAVAMLACARIGAIHSIVFAGFSPDALANRITDAECTILITADEGLRGPKAIGLKEAADEAM---DKAGM-VKKCIVVKHTGAD------------------VPMKAGRDLWWHELTAKEST--ECPPESMDSEDPLFILYTSGSTGTPKGVLHTTGGYIVYTSLTHQYVFDYHDGDIYWCTADIGWVTGHSYIIYGPLANGAVTIMFEGIPNYPDFSRFWQICDKHQVNIFYTAPTVVRALMQQGDEPVKATSRTSVRLLGTVGEPINPEAWLWYHRVVGEERCPIVDTWWQTETGGIMITPLPGATALKPGSATRPFFGIQPALIDKEGNQLEGPGEGYLVMLDSWPALARTVYGDHRRFKSTYFIQCPGTYFSGDGARRDEDGYYWITGRIDDVINVSGHRLGTAEIESSLVAHPAVSEAAVVGFPHDIKGQAIYAYVTLSSGYEPSEELRKELSLFVRKDIGPIATPEVLQFTDSLPKTRSGKIMRRILRKVACNELDNLGDTSTLADPAVVEALIK 639          
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Match: V4BDJ7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_128665 PE=3 SV=1)

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 408/685 (59.56%), Postives = 508/685 (74.16%), Query Frame = 1
Query:   88 VQSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTC------YGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +   +D +  +   ++ P    +  AH+ SM  Y K+Y  SI  P+ FW   A +F+WK  P  +    YNF   +GPI++   +   TN+CYN+LDR I  GLGDKIAFYWEGNDP D  K TY  L  +VC+F  +L+  GIK+GDRVAIY+PMI++L +AMLACARIGA+H ++F G+SAES+A+RI D +C  +VT DGVWRG+KL++LK I D A+KIC++ G  V+  IVV+H++        G G   E    RP+ KL +N T  RD WWH+ M   + +  C  EW+++E  LF+L+TSGSTGKPKGV+HT GGYM+Y + T+K+VFD++ DDVYWCTAD+GWITGHSYV YGP+  G+TG+IFEG P YPDAGRLW++I+KY VTKFYTAPT IR+LMK GDD V KY RESLKILGTVGEPINP  WLWYY VVG  +C IVDTFWQTETGGHV+TP+PG T  KPGSAT PFFGV   L+ E G+EI GPGEGYLVFKKPWP +MRT+Y N ER+E TYFKKF GYY TGDGA RD++GY  ITGRIDDM+NVSGHL+STA+VESAL++H  + EAA+V  PH++KGEC +CFVTL     + + L  EL + VRTKIG FA PD++Q+ PALPKTRSGKIMRRILRKIA  + N GDTSTLAD +VID + N
Sbjct:    1 MAEQNDHVAGSEELIFNPPASLQNEAHVNSMQQYQKMYRHSIDDPETFWREIAAEFYWKSPPTGK-FFDYNFDVTKGPIFIKWMEGAKTNICYNMLDRHISNGLGDKIAFYWEGNDPTDHGKITYSQLQQKVCRFGNVLKNLGIKRGDRVAIYMPMILDLSVAMLACARIGAIHSIVFAGYSAESLADRILDAHCCAIVTADGVWRGSKLLNLKKIVDDALKICDERGHHVDKSIVVRHLSVDEEIINNGDGD-DEREAARPSHKLKINWTAGRDIWWHDMMQSVSDV--CEPEWMDAEDSLFMLYTSGSTGKPKGVLHTVGGYMLYTATTFKYVFDYQPDDVYWCTADVGWITGHSYVTYGPLGNGSTGVIFEGTPFYPDAGRLWEVIDKYKVTKFYTAPTAIRALMKFGDDIVTKYSRESLKILGTVGEPINPEAWLWYYNVVGNGKCAIVDTFWQTETGGHVLTPLPGATPTKPGSATFPFFGVVPALLTEEGREIEGPGEGYLVFKKPWPSLMRTVYGNQERFETTYFKKFPGYYCTGDGARRDSDGYIWITGRIDDMVNVSGHLLSTAEVESALITHKNVAEAASVSHPHKIKGECIYCFVTLKQGCQYTDELVVELKNIVRTKIGPFAQPDFLQNAPALPKTRSGKIMRRILRKIAVGDRNLGDTSTLADESVIDLLFN 681          
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Match: A0A210PEM7 (Acetyl-coenzyme A synthetase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08688 PE=3 SV=1)

HSP 1 Score: 845.499 bits (2183), Expect = 0.000e+0
Identity = 393/676 (58.14%), Postives = 507/676 (75.00%), Query Frame = 1
Query:  115 STNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCY----GIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNI 2127
            + +++L++P +H R+ +H++SM+ Y ++Y+ SI+ P+ FW   A+QF+WK +P     L YNF    GPIY+   +   TN+CYN +DR ++ G G+KIAFYWEGNDP D  K T+  L  +VCKFA +L+  G+KKGDRVAIY+PMI+EL ++MLACARIG +H ++F GFS+ES+AERI D +C  ++T DGVWRG KL++LK I D A+ IC K+   V+ C+VVKH+T        G   E P  RP+RKL ++  N RD WWHE M+   +  +C  EW+++E PLF+L+TSGSTGKPKGV+HT GGYM+Y + T+K+ FD++D+D+YWCTAD+GWITGH+YV YGP+  GAT +IFEG P YPD GR W I+EKY VTKFYTAPT IR+LMK GD++V KY R SLK+L TVGEPINP  WLWYY V+GE RC IVDTFWQTETGGH +TP+PG T LKPGSAT PFFG+   ++DENG+EI   G EGYLVFK+PWPGIMRT+Y NHER+E  YFKKF GYY TGDGA  D +GY+ +TGRIDDM+NVSGHL+STA++ESAL+ H  + E+A V  PH++KGEC +CFVTL +   F E L  EL   VR KIG FA PD++Q+ P LPKTRSGKIMRRILRKIA  + N GD +T+AD +VI+ +  +
Sbjct:    6 NADVQLFQPLEHLRQESHVQSMEQYREMYKRSIEEPEDFWKEIAQQFYWKSQPTGM-FLDYNFDCREGPIYIKWMEGAQTNICYNAVDRHVKDGRGNKIAFYWEGNDPDDHGKITFQELQDKVCKFANVLKKLGLKKGDRVAIYMPMILELSVSMLACARIGIIHSIVFAGFSSESLAERILDAHCCAVLTTDGVWRGTKLMNLKQIVDDALVICGKSNHHVKKCVVVKHLTTTEEIEDCGDTEEPPAKRPSRKLKIHWNNERDVWWHEEMA--KVSSECEPEWMDAEDPLFMLYTSGSTGKPKGVLHTVGGYMLYAATTFKYDFDYQDNDIYWCTADVGWITGHTYVCYGPLANGATSVIFEGTPFYPDPGRFWAIVEKYKVTKFYTAPTAIRALMKFGDEFVTKYDRSSLKVLATVGEPINPEAWLWYYNVIGEKRCAIVDTFWQTETGGHTLTPLPGATPLKPGSATFPFFGIVPAILDENGQEITESGKEGYLVFKQPWPGIMRTVYGNHERFETVYFKKFPGYYCTGDGAKFDDDGYFWVTGRIDDMVNVSGHLLSTAEIESALIEHAHVSESAVVSHPHDIKGECTYCFVTLKEGCEFSEKLVVELKKKVREKIGPFASPDFVQNAPGLPKTRSGKIMRRILRKIAVGDRNVGDITTMADESVIEKLFQL 678          
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Match: A0A267H8Y4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020094g1 PE=4 SV=1)

HSP 1 Score: 840.106 bits (2169), Expect = 0.000e+0
Identity = 398/681 (58.44%), Postives = 499/681 (73.27%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRN---VLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGK-------CTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVD-ENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKI 2136
            +++EP    +  AH+ S++ Y  +Y  S+  P+KFW   A +F+W  KPD      +L YNF  ++G IYV  FK   TN+CYN LDR +  G GD++AFYWEGNDP D    TY  L  +VC+FA +L++ G+KKGDRVAIY+PM++EL +AMLACARIGAVH ++FGGFSA S+A+RI +  C IL+TCDG WRG KL+ LK I+D+AM IC + G+PV  C+VV HV     G         +  PG RPA+   V M   RD WWHEAM+  ++  DC  EW+E+E PLF+L+TSGSTGKPKGV+HT GGYM+Y + T+K+ FD+  +D+YWCTADIGWITGHSYV+YGPM   AT ++FEG+PT+PDAGR W +++KY VT FYTAPT IR+LMK GD +V +  R SL+I+ +VGEPINP  WLWY+ VVG +RC +VDTFWQTETGGHVITP+PG T  KPGSA  PFFGV+  L++ E G  I GPGEGYLVF  PWPGIMRT++ +H RYE TYF KF GYYTTGDGA RD +GY  +TGRIDDM+NVSGHL+STAQ+ESALV HPK+ EAA V   H+VKGE  + FVTL D  TFD++L  +L   VR +IGAFA PD IQ+ PALPKTRSGKIMRRILR+IA    N+GD STLADP VI+ ++    +
Sbjct:   34 QVFEPPAAIQSRAHVTSIEAYRDMYRLSVSDPNKFWRQIASEFYWHSKPDGAEEAPILDYNFDLSKGGIYVRWFKGWRTNICYNALDRHVLAGRGDRVAFYWEGNDPEDRTSITYAELLRQVCRFANVLKSNGVKKGDRVAIYMPMVLELVVAMLACARIGAVHSIVFGGFSAGSLADRIINAKCHILITCDGNWRGTKLLSLKSIADKAMSICIEEGNPVVTCLVVSHVKRPRFGSDEAGGDSHSSKPGFRPAKDCPVEMLAGRDVWWHEAMAKEDISDDCQPEWLEAEDPLFMLYTSGSTGKPKGVLHTVGGYMVYSATTFKYSFDYHMEDIYWCTADIGWITGHSYVVYGPMANCATSVMFEGLPTWPDAGRCWDVVDKYKVTTFYTAPTAIRTLMKSGDAFVERSSRASLRIIASVGEPINPEAWLWYHRVVGRSRCSVVDTFWQTETGGHVITPLPGATPTKPGSACFPFFGVQPVLLNPETGDVIEGPGEGYLVFAGPWPGIMRTVFGDHPRYEQTYFSKFNGYYTTGDGAQRDKDGYLWVTGRIDDMINVSGHLLSTAQIESALVEHPKVAEAAVVGRHHDVKGESAYAFVTLKDGATFDDSLVRQLLVIVRERIGAFAAPDTIQEAPALPKTRSGKIMRRILREIAAKSENYGDVSTLADPGVIETLVAFRTV 714          
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Match: A0A267GSC0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030207g1 PE=4 SV=1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 396/681 (58.15%), Postives = 499/681 (73.27%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRN---VLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGK-------CTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVD-ENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKI 2136
            +++EP    +  AH+ S++ Y  +Y  S+  P+KFW   A +F+W  KPD      +L YNF  ++G IYV  FK   TN+CYN LDR +  G GD++AFYWEGNDP D    TY  L  +VC+FA +L++ G+KKGDRVAIY+PM++EL +AMLACARIGAVH ++FGGFSA S+A+RI +  C IL+TCDG WRG KL+ LK I+D+AM IC + G+PV  C+VV HV     G         +  PG RPA+   V M   RD WWHEAM+  ++  DC  EW+++E PLF+L+TSGSTGKPKGV+HT GGYM+Y + T+KF FD+  +D+YWCTADIGWITGHSYV+YGPM   AT ++FEG+PT+PDAGR W +++KY VT FYTAPT IR+LMK  D +V +  R SL+I+ +VGEPINP  WLWY+ VVG ++C +VDTFWQTETGGHVITP+PG T  KPGSA  PFFGV+  L++ E G  I GPGEGYLVF  PWPGIMRT++ +H RYE TYF KF GYYTTGDGA RD +GY  +TGRIDDM+NVSGHL+STAQ+ESALV HPK+ EAA V   H+VKGE  + FVTL D  TFD++L  +L   VR +IGAFA PD IQ+ PALPKTRSGKIMRRILR+IA    N+GD STLADP VI+ ++ +  +
Sbjct:   18 QVFEPPAAIQTRAHVPSIEAYRDMYRLSVSDPNKFWRQIASEFYWHSKPDGAEEAPILDYNFDLSKGGIYVRWFKGWRTNICYNALDRHVLAGRGDRVAFYWEGNDPEDRTSITYAELLQQVCRFANVLKSNGVKKGDRVAIYMPMVLELVVAMLACARIGAVHSIVFGGFSAGSLADRIINAKCHILITCDGNWRGTKLLSLKSIADKAMSICIEEGNPVVTCLVVSHVKRPRFGSDEADGDSHSSKPGIRPAKDCPVEMLAGRDVWWHEAMAKEDISDDCQPEWLDAEDPLFMLYTSGSTGKPKGVLHTVGGYMVYSATTFKFSFDYHLEDIYWCTADIGWITGHSYVVYGPMANCATSVMFEGLPTWPDAGRCWDVVDKYKVTTFYTAPTAIRTLMKSSDAFVERSSRASLRIIASVGEPINPEAWLWYHRVVGRSQCSVVDTFWQTETGGHVITPLPGATPTKPGSACFPFFGVQPVLLNPETGDVIEGPGEGYLVFAGPWPGIMRTVFGDHPRYEQTYFSKFNGYYTTGDGAQRDKDGYLWVTGRIDDMINVSGHLLSTAQIESALVEHPKVAEAAVVGRHHDVKGESAYAFVTLKDGATFDDSLVRQLLVIVRERIGAFAAPDTIQEAPALPKTRSGKIMRRILREIAAKSENYGDVSTLADPGVIETLVALRTV 698          
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Match: A0A1I8JEN4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 397/683 (58.13%), Postives = 499/683 (73.06%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRN---VLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGK-------CTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVD-ENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKINV 2142
            +++EP    +  AH+ S++ Y  +Y  S+  P+KFW   A +F+W  KPD      +L YNF  ++G IYV  FK   TN+CYN LDR +  G GD++AFYWEGNDP D    TY  L  +VC+FA +L++ G+KKGDRVAIY+PM++EL +AMLACARIGAVH ++FGGFSA S+A+RI +  C IL+TCDG WRG KL+ LK I+D+AM IC + G+PV  C+VV HV     G         +  PG RPA+   V M   RD WWHEAM+  ++  DC  EW+++E PLF+L+TSGSTGKPKGV+HT GGYM+Y + T+KF FD+  +D+YWCTADIGWITGHSYV+YGPM   AT ++FEG+PT+PDAGR W +++KY VT FYTAPT IR+LMK  D +V +  R SL+I+ +VGEPINP  WLWY+ VVG ++C +VDTFWQTETGGHVITP+PG T  KPGSA  PFFGV+  L++ E G  I GPGEGYLVF  PWPGIMRT++ +H RYE TYF KF GYYTTGDGA RD +GY  +TGRIDDM+NVSGHL+STAQ+ESALV HPK+ EAA V   H+VKGE  + FVTL D  TFD++L  +L   VR +IGAFA PD IQ+ PALPKTRSGKIMRRILR+IA    N+GD STLADP VI+ ++ +    V
Sbjct:   18 QVFEPPAAIQTRAHVPSIEAYRDMYRLSVSDPNKFWRQIASEFYWHSKPDGAEEAPILDYNFDLSKGGIYVRWFKGWRTNICYNALDRHVLAGRGDRVAFYWEGNDPEDRTSITYAELLQQVCRFANVLKSNGVKKGDRVAIYMPMVLELVVAMLACARIGAVHSIVFGGFSAGSLADRIINAKCHILITCDGNWRGTKLLSLKSIADKAMSICIEEGNPVVTCLVVSHVKRPRFGSDEADGDSHSSKPGIRPAKDCPVEMLAGRDVWWHEAMAKEDISDDCQPEWLDAEDPLFMLYTSGSTGKPKGVLHTVGGYMVYSATTFKFSFDYHLEDIYWCTADIGWITGHSYVVYGPMANCATSVMFEGLPTWPDAGRCWDVVDKYKVTTFYTAPTAIRTLMKSSDAFVERSSRASLRIIASVGEPINPEAWLWYHRVVGRSQCSVVDTFWQTETGGHVITPLPGATPTKPGSACFPFFGVQPVLLNPETGDVIEGPGEGYLVFAGPWPGIMRTVFGDHPRYEQTYFSKFNGYYTTGDGAQRDKDGYLWVTGRIDDMINVSGHLLSTAQIESALVEHPKVAEAAVVGRHHDVKGESAYAFVTLKDGATFDDSLVRQLLVIVRERIGAFAAPDTIQEAPALPKTRSGKIMRRILREIAAKSENYGDVSTLADPGVIETLVALRTRQV 700          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 393/667 (58.92%), Postives = 498/667 (74.66%), Query Frame = 1
Query:  142 TDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVT-----CYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++  RK AH+ S +++ +LY +S++SP++FW + A++FFWK K   +  L YNF   +G I+V   +  TTN+CYNVLDR + E+ LGD++AFYWEGN+P D    TY  L  +VCKFA +L+++G+KKGDRV+IY+PM++EL +AMLACARIGAVH ++F GFSAES+ ERI D  C +L+T DG +RG+KLI+LK+I+D+A++ C     PVE CIV+KH++        +G  +  P  R    L V      D  WH  M  ++   +C   W ESE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DD+YWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G+D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T LKPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT++ NH+R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTLAD   +   L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA+N+ + GD STLAD +VI+ +  
Sbjct:   15 SEEMRKQAHVSSFENFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQ-FLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQGVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLS-PPAKRSCPDLQVPWKPEVDVCWHSLMEGAS--DECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVVPAILNESGEELEGPNEGYLVFKQPWPGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQRDLGDVSTLADTSVIEQLFE 677          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 391/682 (57.33%), Postives = 500/682 (73.31%), Query Frame = 1
Query:  142 TDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTN-------------PRDEW-------WHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            ++  RK AH+ S +++ +LY +S++SP++FW + A++FFWK K   +  L YNF   +G I+V   +  TTN+CYNVLDR + E+ LGD++AFYWEGN+P D    TY  L  +VCKFA +L+++G+KKGDRV+IY+PM++EL +AMLACARIGAVH ++F GFSAES+ ERI D  C +L+T DG +RG+KLI+LK+I+D+A++ C     PVE CIV+KH++       +      PA++   ++               P+  W       WH  M  ++   +C   W ESE PLFIL+TSGSTGKPKGV+HT  GYM+Y + T+K VFD+  DD+YWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W+I++KY V+KFYTAPT IR LMK G+D V KY+R SLKILGTVGEPINP  W WYY VVGE RCP+VDTFWQTETGGHV+TP+P  T LKPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT++ NH+R+E TYFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH VKGE  +CFVTLAD   +   L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA+N+ + GD STLAD +VI+ +  
Sbjct:   15 SEEMRKQAHVSSFENFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQ-FLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQGVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQQEKQKGNVRKVRSIPKVPWKPEVDVCWHSLMEGAS--DECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVVPAILNESGEELEGPNEGYLVFKQPWPGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQRDLGDVSTLADTSVIEQLFE 693          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic-like [Source:NCBI gene;Acc:107197877])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 386/674 (57.27%), Postives = 490/674 (72.70%), Query Frame = 1
Query:  115 STNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR-FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKIC-EKNGSPVECCIVVKH--VTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +T  +++ P +  R  AH+  ++ Y  LY++SI+ P++FW + A++F+WK+ P  + +LQYNF   +G +YV   +   TN+CYNVLDR  +++ LG ++AF+WEGN P      TY  L  +VC+ A  L+  G+KKGDRVAIYLPMI EL  +MLACARIGAVH ++F GFS+ES+AERI D  C +LVT DGV+RG+KLI LK ISD+A+  C EKN   V  C+VVKH     +G   C          KL        D WW EA+    +  +C  EW+E+E PLFIL+TSGSTGKPKGV+HT  GY++Y S+T+K+VFDH  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEGIP +P  GR W+IIEKY V+KFYTAPT IR LMK G + + KY   SL++LGTVGEPINP  WLWY++ VG+ RCP+VDTFWQTETGGHV+TP+P  T LKPGSATLPFFGV   +++E+G+E+ G  EGYLVF+KPWPGIMR +Y N ER+E+TYFKKF G+Y TGDG  RD +GYY ITGRIDDMLNVSGHL+ST++VE+AL  H  + EAA V  PH +KGEC +CFVTL D   F+  L  EL   VR KIG  A PD+IQ+ PALPKTRSGKIMRR+LR+IA NE + GD STLADP V++ +L+
Sbjct:    8 NTEEKIFHPPEDLRVDAHVPDLESYLALYKKSIEEPEEFWRDVAQEFYWKEPPSGQ-MLQYNFDATKGKVYVKFMEGAKTNMCYNVLDRNVLDRNLGSRVAFHWEGNSPDHHMTITYSQLLKQVCRCANALKQMGVKKGDRVAIYLPMIPELVYSMLACARIGAVHSIVFAGFSSESLAERIMDAQCTVLVTADGVYRGDKLIKLKQISDEALDHCREKNSLTVRKCLVVKHHAFRIHGNDTCN---------KLQTLWNAECDVWWDEAVE--GVSDECDPEWMEAEDPLFILYTSGSTGKPKGVLHTIAGYLLYTSLTFKYVFDHHRDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGIPVHPHVGRFWEIIEKYRVSKFYTAPTAIRLLMKYGREPLSKYDLSSLRVLGTVGEPINPEAWLWYHDAVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATLPFFGVLPIILNEHGEELEGEAEGYLVFQKPWPGIMRGVYGNQERFENTYFKKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTSEVEAALSEHSAVAEAAVVSRPHTIKGECLYCFVTLKDCREFNHTLLEELKRKVREKIGPIATPDFIQNAPALPKTRSGKIMRRVLRQIARNEKDLGDLSTLADPKVVEVLLS 669          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic-like [Source:NCBI gene;Acc:107197877])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 369/676 (54.59%), Postives = 475/676 (70.27%), Query Frame = 1
Query:  115 STNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR-FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKIC-EKNGSPVECCIVVKH--VTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSH--NVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +T  +++ P +  R  AH+  ++ Y  LY++SI+ P++FW + A++F+WK+ P  + +LQYNF   +G +YV   +   TN+CYNVLDR  +++ LG ++AF+WEGN P      TY  L  +VC+ A  L+  G+KKGDRVAIYLPMI EL  +MLACARIGAVH ++F GFS+ES+AERI D  C +LVT DGV+RG+KLI LK ISD+A+  C EKN   V  C+VVKH     +G   C          KL        D WW EA+    +  +C  EW+E+E PLFIL+TSGSTGKPKGV+HT  GY++Y S+T+K+VFDH  DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEGIP +P  GR W+IIEKY V+KFYTAPT IR LMK G + +      +L++LGTVGEPINP  WLWY++ VG+ RCP+VDTFWQTET   +   +   +       TLPFFGV   +++E+G+E+ G  EGYLVF+KPWPGIMR +Y N ER+E+TYFKKF G+Y TGDG  RD +GYY ITGRIDDMLNVSGHL+ST++VE+AL  H  + EAA V  PH +KGEC +CFVTL D   F+  L  EL     VR KIG  A PD+IQ+ PALPKTRSGKIMRR+LR+IA NE + GD STLADP V++ +L+
Sbjct:    8 NTEEKIFHPPEDLRVDAHVPDLESYLALYKKSIEEPEEFWRDVAQEFYWKEPPSGQ-MLQYNFDATKGKVYVKFMEGAKTNMCYNVLDRNVLDRNLGSRVAFHWEGNSPDHHMTITYSQLLKQVCRCANALKQMGVKKGDRVAIYLPMIPELVYSMLACARIGAVHSIVFAGFSSESLAERIMDAQCTVLVTADGVYRGDKLIKLKQISDEALDHCREKNSLTVRKCLVVKHHAFRIHGNDTCN---------KLQTLWNAECDVWWDEAVE--GVSDECDPEWMEAEDPLFILYTSGSTGKPKGVLHTIAGYLLYTSLTFKYVFDHHRDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGIPVHPHVGRFWEIIEKYRVSKFYTAPTAIRLLMKYGREPL-----SNLRVLGTVGEPINPEAWLWYHDAVGQGRCPVVDTFWQTETVSEIHIMV---SRHNFRIITLPFFGVLPIILNEHGEELEGEAEGYLVFQKPWPGIMRGVYGNQERFENTYFKKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTSEVEAALSEHSAVAEAAVVSRPHTIKGECLYCFVTLKDCREFNHTLLEELKRKGQVREKIGPIATPDFIQNAPALPKTRSGKIMRRVLRQIARNEKDLGDLSTLADPKVVEVLLS 663          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Match: acss1 (acyl-CoA synthetase short chain family member 1 [Source:ZFIN;Acc:ZDB-GENE-050320-139])

HSP 1 Score: 370.933 bits (951), Expect = 1.500e-118
Identity = 203/499 (40.68%), Postives = 288/499 (57.72%), Query Frame = 1
Query:  184 DYHKLYEESIKSPDKFWSNFA-EQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKF 1674
             Y +LY  S++ P+ FW + A ++  W    D + V   +    R    V+ F+ G  N+  N LD    +   D++A  WE ++P    + TY  L    C+ A  L++ G++KGDRVAIY+P+       ML CARIGAVH V+F GFS+E++A RI D  CK++VTC+   RG +LI+LK   D A+K C     P    ++V   T + +          P  KL        D    EAM+  +   +C  E ++SE  LF+L+TSGSTGKPKG+VHT  GY++Y S+T+++VFD+   DVY C ADIGWITGHSYV+YGP+  GAT ++FE  P YPD GR W+++E+  + +FY APT IR L+K  + +V KY R SLK LG+VGEPIN   W W++ VVG+ RCP+VDT+W       V   + GC S+                V E G+ + G    G L   KPWPG+ +T++ +H+R+ D YFK +
Sbjct:   55 SYPELYALSVEEPELFWGSVARDRLAWSS--DFQQVSDCDLTAGR----VSWFRGGKLNVSVNCLDVHAAKD-PDRVALIWEKDEPGTEERVTYRELLEMTCRIANTLKSLGVQKGDRVAIYMPVSPIAVATMLGCARIGAVHTVVFAGFSSEALAGRIQDAQCKVVVTCNQGVRGGRLINLKATVDSAVKNC-----PTVEHVLVAQRTNHSV----------PMGKL--------DTPLEEAMARES--SECAPEPMDSEEMLFMLYTSGSTGKPKGIVHTQAGYLLYASLTHQYVFDYSPGDVYGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYPDPGRYWEMVERLRINQFYGAPTAIRLLLKYEESWVKKYDRSSLKTLGSVGEPINHEAWEWFHNVVGDGRCPLVDTWW-------VSLFLHGCISMG--------------CVSECGQMLTGNDVTGALCISKPWPGMAKTIFGDHQRFVDAYFKPY 500          

HSP 2 Score: 79.7221 bits (195), Expect = 4.912e-15
Identity = 44/85 (51.76%), Postives = 56/85 (65.88%), Query Frame = 1
Query: 1876 FCFVTLADTFTFD-ENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNES-NFGDTSTLADPNVIDAILN 2124
            F FV L D  T + E +  +L H V TKI  +AVPD+   V  LPKTRSGKIMRRILRK+A  ++ + GD STL DP+V+  I+ 
Sbjct:  504 FAFVVLKDNTTENQETVIEDLRHLVATKIAKYAVPDHFLVVKRLPKTRSGKIMRRILRKVAMQQTESLGDISTLDDPSVVTEIIQ 588          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Sea Lamprey
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 267/423 (63.12%), Postives = 324/423 (76.60%), Query Frame = 1
Query:  871 VNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKIN 2139
            V  T+ RD WWHE M  ++    C   W ++E PLF+L+TSGSTGKPKGV+HTT GY+++ + T+K VFD +  DVYWCTADIGWITGHSY++YGP+  G T ++FEGIPT+PDAGR WQ +EKYAV+KFYTAPT +R LMK GD +VLK+ R SL++LGTVGEPIN   W W + VVG  RCPIVDTFWQTETGGHV+TP+PG T LKPGSATLPFFGVE  ++DE G+E+ G  EG+LVFK+PWPGI+RT++ +HER E TYF KF GYY TGDG  RD +GYY ITGR DDMLNVSGHL+STA+VESAL+SH  + EAA V  PH +KGE  +CFVTL      +  L  EL   VR KIG  A PD+IQ  P+LPKTRSGKIMRR+LRKIA ++S+FGD STLADP V+  + +   IN
Sbjct:    6 VPWTSGRDSWWHELMCGAST--TCEPAWCDAEDPLFVLYTSGSTGKPKGVLHTTAGYLLFVATTHKLVFDIRPQDVYWCTADIGWITGHSYIVYGPLANGVTSVLFEGIPTFPDAGRFWQTVEKYAVSKFYTAPTAVRLLMKHGDAFVLKHSRRSLRVLGTVGEPINREAWHWLHGVVGGGRCPIVDTFWQTETGGHVLTPLPGATPLKPGSATLPFFGVEPAILDERGEELRGEAEGFLVFKRPWPGILRTVFGDHERLEATYFGKFPGYYATGDGCRRDKDGYYWITGRTDDMLNVSGHLLSTAEVESALLSHGSVAEAAVVGRPHALKGESLYCFVTLNHGLELNPCLAAELKKRVREKIGPIATPDFIQSAPSLPKTRSGKIMRRLLRKIAQDDSDFGDLSTLADPGVVQLLYSSRCIN 426          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006895.1 (pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-1 gene:ENSPMAG00000006232.1 transcript:ENSPMAT00000006895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 233.032 bits (593), Expect = 1.621e-68
Identity = 157/510 (30.78%), Postives = 250/510 (49.02%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRL-WQIIEKYAVTK-FYTAPTVIRSLMKCGDDYVLKYQR------ESLKILGTVGEPINPRTWLWYYEVVGEA--RCPIVDTFWQTETGGHVITPIPGC-TSLKP--GSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKF 1674
            Y   ++ +   P++FW+  A+   W +  D           ++ P Y   F DG  N+CYN LDR +E G GD+ A   +          TY    +EV + A +L   G++KGDRV IY+PMI +   AMLACARIGA+H +IFGGF+++ +A RI+     ++++        + +  K + + A+ I      P +  +  +     G+ + +  PG              RD  W E +S +      P   V S+HPL+IL+TSG+TG PKGVV  TGG+ +  + +   ++  K  +V+W  +D+GW+ GHSY+ YGP+  G T +++E  P      ++ +++ EK+ +   F  +P      +   +  +L +           + +   GE  +  T  W     G+A    P++D +WQTETG  +     G   SL P  G       G +  +VD N +E      G +V K P  PG M TL+ N+++YEDTYFK F
Sbjct:    1 YDAAFKLAKSEPERFWAEAAKGVAWTKSWDRV------LDDSKSP-YTRWFVDGQLNMCYNALDRHVEAGRGDQAAIIHDSPVTGIIQTITYRQALSEVTRLASVLVKNGVQKGDRVVIYMPMIPQAMFAMLACARIGAIHSLIFGGFASKELAVRINHAKVSMVLSASFGIEPGRQVAYKPLLEAALDIATHK--PEKVLVYSRP----GMARASLIPG--------------RDMCWQEEVSAAKPHDCVP---VSSDHPLYILYTSGTTGAPKGVVRPTGGHAVMLNWSMSAIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEPAPPVSPPPKVFYEVDEKHGLNLCFIPSPRSHYISLPMSNPQLLYHLYIKTPCVPRFRSMFVAGEICDKETLNW-----GKATFNVPLLDHWWQTETGSAITATCTGLGGSLYPPAGQCGKSVPGYDVRVVDSNNQESKRGNLGNIVVKLPLAPGCMATLWENNQKYEDTYFKSF 475          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005866.1 (pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gene:ENSPMAG00000005307.1 transcript:ENSPMAT00000005866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 3.767e-20
Identity = 39/71 (54.93%), Postives = 52/71 (73.24%), Query Frame = 1
Query:  424 EGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSA 636
            EGN+P D N+ TY  L  +VCK + +L + G+ KGDRVAIY+PMI EL +AMLACAR+GAVH ++    +A
Sbjct:   28 EGNEPGDCNQITYKELLDQVCKCSNVLLSHGVGKGDRVAIYMPMITELVVAMLACARVGAVHSIVVSSRAA 98          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 294/687 (42.79%), Postives = 415/687 (60.41%), Query Frame = 1
Query:  121 NIELYEPTDHFRKL----AHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDE-NGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFD------------ENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNES-NFGDTSTLADPNVIDAILN 2124
            N++  +   HF        ++  M  Y ++Y++SI  P+KF+   A+++     P  + V   + ++      V  F +G  N  YN +DR       DK A  +E +D  D    T+  L  +V + A +L++ G+KKGD VAIYLPMI E  IAMLA ARIGA+H V+F GFSA S+ +R+ D N K+++TCD   RG K I+ K I D+ +     NG  +   I+V   T       TE           + M   RD WWHE  +        P    ++E PLF+L+TSGSTG PKGVVHTTGGY++  ++T ++VFD   +DV +   D+GWITGH+Y LYGP+T G   IIFE  P YPD GR W+II+++  T FY APT +R + + G+  + KY   SL++LG+VGEPI+P  W WY+E VG   C I DT WQTE+G H+I P+ G    KPGSAT+PFFG+   ++D   G E+ G   EG L  K PWP + R+++N+H+RY DTY K + G+Y TGDGA RD +GYY I GR+DD++NVSGH +ST+++E+++ +H  + EAA V +P E+ G+    +V+L D +  +            +NLR EL   VR +IG FA P  I  V  LP+TRSGKIMRR+LRK+A+NE+   GD +TLA+P V+ AI++
Sbjct:   14 NVKALKAPQHFYNSQPGKGYVTDMQHYQEMYQQSINEPEKFFDKMAKEYLHWDAPYTK-VQSGSLNNGD----VAWFLNGKLNASYNCVDRHAFAN-PDKPALIYEADDESDNKIITFGELLRKVSQIAGVLKSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEGL-----NGVDLVSRILVFQRTG------TEG----------IPMKAGRDYWWHEEAAKQRTY--LPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPDYGRYWRIIQRHKATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGINACIIDPVTGVELEGNDVEGVLAVKSPWPSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITPDNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLRKVASNEAEQLGDLTTLANPEVVPAIIS 671          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 517.309 bits (1331), Expect = 1.662e-174
Identity = 287/670 (42.84%), Postives = 408/670 (60.90%), Query Frame = 1
Query:  166 HLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTA-FKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLR-AKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIP-GCTSLKPGSATLPFFGVETTLVDEN-GKEI-IGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLAD-----TFTFDE--NLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESN-FGDTSTLADPNVIDAILNITKI 2136
            HL  + DY +L++ESI+ P KF+ + A QF    KP ++ V   +    R      A F +G  N CYN +DR   +   +K A  +EG++P      TY  L  EVC+ A++L  + G++KGD VA+Y+PM+ E  I +LA +RIGA+H V+F GFS+ S+ +RI+DG+ K+++T D   RG K+I+ K I D A++  E  G        V+HV  Y   + T  P         V    PRD  W  A          P   V+SE PLF+L+TSGSTG PKGV H+T GY++   +T ++ FD   +DV++   DIGWITGH+YV+YGP+  G   ++FEG P YP+  R W II+++ VT+FY APT +R L + GD Y+  +  +SL+ LG+VGEPI    W WY E +G+   PIVDT+WQTE+G H++TP+  G T +KPGSA+ PFFG++  ++D N G+E+     EG L  K  WP   RT++ NH+RY DTY   + GYY TGDGA++D +GY  I GR+DD++NVSGH +STA++E+A++  P + E A V    ++ G+    FV L +     T T DE  +++  L   VR  IG FA P  I  V  LPKTRSGKIMRRILRKI   ES+  GD STL++P ++  +++  K+
Sbjct:   69 HLDGLQDYQRLHKESIEDPAKFFGSKATQFLNWSKPFDK-VFIPDPKTGRPSFQNNAWFLNGQLNACYNCVDRHALK-TPNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVLTYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRGGKVIETKRIVDDALR--ETPG--------VRHVLVY---RKTNNPS--------VAFHAPRDLDW--ATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQFYVAPTALRLLKRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGESDQLGDVSTLSNPGIVRHLIDSVKL 713          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 87.8113 bits (216), Expect = 1.756e-18
Identity = 93/398 (23.37%), Postives = 176/398 (44.22%), Query Frame = 1
Query:  883 NPRDEW---WHEAMSDSNLLGDCPVEW---VESEHPLFILHTSGSTGKPKGV--VHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTL-YNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTL--ADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRIL 2043
            +P D +    + +++++  +   PV++     S     ILHTSG+T  PK V  +H     ++  ++     +     D  +    +  + G   VL        + ++ +G   +P     W    KY    F   PT+   ++         +    ++ + +    + P T   ++++  E   P+++ +  TE    + +        KPG+   P  GV   ++D+N   ++ PG+   V +    G   TL Y N+ +     F K   Y+ TGD    D  G+  +TGRI +++N  G  IS  +++  ++SHPKI EA A  VP ++ G+     + L   +  T++     EL + ++  + +F +P  +  V  LPKT +GKI RR++
Sbjct:  156 SPEDNYKRVIYRSLNNAKFVNTNPVKFPGFARSSDVALILHTSGTTSTPKTVPLLHLN---IVRSTLNIANTYKLTPLDRSYVVMPLFHVHGLIGVLLSTFRTQGSVVVPDGF--HPKL--FWDQFVKYNCNWFSCVPTISMIMLNMPKPNPFPH----IRFIRSCSSALAPAT---FHKLEKEFNAPVLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQ-GVTVVILDDND-NVLPPGK---VGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGVPDDMYGQVVQAAIVLKKGEKMTYE-----ELVNFLKKHLASFKIPTKVYFVDKLPKTATGKIQRRVI 529          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Match: EDO42084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2B4])

HSP 1 Score: 782.711 bits (2020), Expect = 0.000e+0
Identity = 380/673 (56.46%), Postives = 475/673 (70.58%), Query Frame = 1
Query:  133 YEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAP--------GCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            Y P    +  AH+ SMD Y   Y++SI+ P  FW   A  FFWK  P + + L+YNF    G + +   +   TN+CYNVLDR + ++GLGD +AFYWEGN P D  + TY  L  +VCKFA +L +KG+KKGDRVAIY+PMI+EL IAMLACAR+GAVH ++FGGFSAES+AERI D  CKIL+T D  +RG K+I+LK I+D A+  C +    VE CIVV+H     +G     P          RP  +L  +  +  D WWHE M++++   D    WV++E PLF+L+TSGSTGKPKGV+HT GGYM+Y ++T+++ FD+   +VYWCTADIGWITGHSY+ YGPM  GA  ++FEG P YPD GR W I++KY V+KFYTAPT IRSLMK G + V  +  ESLK+LGTVGEPINP  WLWYY VVG  +C IVDT+WQTETGGHVITP+PG T  +PG+AT PFFGVE  +VDE G E+ GP EG+LV K+PWPG+ RT+Y NH+R+E+ YF KF GYYTTGDG  RD NGYY +TGR DD +NVSGHL+STAQ+ESALV H  + EAA V  PH+ KGE  +CF TL +    DE L  EL   VR KIG FA PD IQ  PALPKTRSGKIMRR+LR++A N+   GD ST+ DP V+D++  
Sbjct:   15 YNPPKEIQDEAHIASMDAYKARYKQSIEDPAGFWGEVASDFFWKVPPKSDHFLKYNFDLDNGSVDIKWMQGAKTNICYNVLDRNVHDKGLGDTVAFYWEGNVPGDTKQITYGELLKQVCKFANVLESKGVKKGDRVAIYMPMIMELVIAMLACARLGAVHSIVFGGFSAESLAERILDSTCKILITADASYRGLKMINLKEIADHAIIKCRERSFNVEACIVVRH-----LGPDKRVPTDPSSSPPPKRPCHQLQTSFDSSIDCWWHEVMAEASDEHD--TVWVDAEDPLFMLYTSGSTGKPKGVLHTHGGYMLYTALTFRYSFDYHPGEVYWCTADIGWITGHSYITYGPMANGAISVLFEGTPFYPDCGRFWDIVDKYKVSKFYTAPTAIRSLMKFGKEIVTSHNLESLKVLGTVGEPINPEAWLWYYHVVGHNKCAIVDTYWQTETGGHVITPLPGATRTRPGAATFPFFGVEPAIVDEKGNELEGPCEGFLVIKRPWPGMARTIYGNHKRFENVYFDKFRGYYTTGDGCKRDENGYYWVTGRTDDCMNVSGHLLSTAQIESALVEHDAVSEAAVVSCPHKEKGEGIYCFATLMENVELDEKLIRELKQKVRLKIGPFASPDVIQSAPALPKTRSGKIMRRVLRQVAKNDRQTGDLSTIYDPAVVDSLFE 680          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Match: EDO39135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ3])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 284/602 (47.18%), Postives = 391/602 (64.95%), Query Frame = 1
Query:  337 FKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSP-VECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVIT--PIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFD-ENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESN-FGDTSTLADPNVIDAILN 2124
            F  G  N+  N +D  + +   ++ A  WE ++P D    +Y+ L+  V + A +L+  G+KKGD V +Y+P+      AMLACARIGA H V+F GFSA+++A RI+D   + ++T +   RG + IDLK + D A+     + SP V+   V+K                 P  KL + +         EAM++     +CP E ++SE PLF+L+TSGSTG+PKG+VHT  GY++Y  +T+K+ FD+K  DV+ C ADIGWITGHSYV+YGP+  GAT ++FE  PTYPD GR W+++E+  + +FY APT IR L+K G+ +V KY R SLK+LGTVGEPIN   W WY +VVGE RC +VDT+WQTETGG +I+  P P  + +KP     PFFGV+  LVDE GKE+ G    G L F+   PG+ RT+Y +HER+ +TY++ + GYY TGDGA RD +G+Y ITGR+DD++NVSG  + TA+VE A+ +H  + E A V  PH +KGE  + + TL D    + E  R E+   VR KIGAFAVP+ IQ VP LPKTRSGKIMRRILRK+A ++ +  GD STLADP+V++ I+ 
Sbjct:   13 FVGGEINVSENCVDHHM-RSHPNRTALIWEKDEPGDVEHVSYIQLYGMVNRMANMLKCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRINDAQAETVITANQAVRGGRAIDLKRVVDDAV-----SKSPGVKRVFVMKRTGAQ-----------VPMGKLDIPL--------EEAMAEQP--DECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDVFGCVADIGWITGHSYVVYGPLANGATTVLFESTPTYPDPGRYWEMVERLRINQFYGAPTAIRLLLKSGNSWVEKYDRSSLKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGGILISPRPAPDNSPVKPEFPMRPFFGVDPVLVDEKGKELTGNNVTGALCFRSSVPGMCRTIYGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMDNHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEIIQVVPGLPKTRSGKIMRRILRKVAQDKPDELGDVSTLADPSVVEVIVR 587          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Match: EDO49293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH51])

HSP 1 Score: 340.502 bits (872), Expect = 2.897e-106
Identity = 215/658 (32.67%), Postives = 340/658 (51.67%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPT-YPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGD---DYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGC-----TSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTF-DENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNI 2127
            Y + +++S++ P+ FW + A+   W  KP  + V          P +   F  G  N C+N LDR IE G+G +IA  ++         Y+Y  L   V KFA  L +  + KGDRV IY+PM+ +  IAMLACARIGA+H V+FGGF+A  +A RI     +++VT       ++++  K + D+A+KI     S          V  Y   +CT             ++   RD  W + M  +      P   V +  PL+IL+TSG+TG PKG+V   GG+ +  + + K ++     +V+W  +D+GW+ GHSY++Y P+  G T ++FEG P   PDAG  +++IE++ V   +TAPT IR +++  D   + + +Y     + +   GE ++  T  W    +     P+ D +WQTE+G  +     G        L+     +P + V+  ++ E+  E      G +  K P  PG M TL+   ER++ TYF+K+ GYY + D    D +GY +I  R DD++NV+GH IST  +E  ++    +V+AA + +   +KG     FV +  T +   E++  E+  +VR  +G  A       VPALPKTRSGK +R IL KI + E  +  T T+ +P  +D I ++
Sbjct:   57 YDEAFKQSVEDPEGFWDDVAQGIDW-YKPYTKVVDNAT------PPFTKWFPGGELNTCFNCLDRHIENGIGGRIALIYDSPVSGKIEMYSYQNLQRLVAKFAGALNSLNVGKGDRVVIYMPMVPQAVIAMLACARIGAIHSVVFGGFAAAELARRIEHAEPRVIVTASCGIEPSRIVTYKPLVDEAIKISSFKPS---------TVVLYQRDQCTG------------DIIPGRDITWDQVMERAEPHDCVP---VLATDPLYILYTSGTTGDPKGIVRRNGGHAVALNWSMKNIYGVNPGEVWWAASDLGWVVGHSYIVYAPLFNGCTTVLFEGKPVGTPDAGAFFRVIEQHKVISMFTAPTAIR-IIRTEDPKAELIRQYDLSHFRDMFLAGEHLDKDTMQWARRAIS---APVYDNWWQTESGWAITAHTVGLGRPMDEKLETTGKAVPGYNVK--ILREDMTEADRGELGQICVKLPMPPGTMGTLWRADERFKKTYFEKYPGYYDSSDAGVMDEDGYVSIMARTDDVINVAGHRISTKSLEEGMMKPSFVVDAACIGLKDGIKGHVPLGFVIVDKTVSMKKEDMIKEVKKSVREFVGPVAAFKTAVIVPALPKTRSGKTVRGILAKIVHGEP-YKVTPTMDNPQCLDQIKDV 676          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Match: EDO37374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG02])

HSP 1 Score: 139.813 bits (351), Expect = 1.941e-34
Identity = 147/613 (23.98%), Postives = 253/613 (41.27%), Query Frame = 1
Query:  337 FKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSP-VECCIVVKHVTCYGIGKCTEAPGCRPARKL--LVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTV---GEPINPRTWLWYYEVVGEARCPIVDTFWQTETGG-HVITPIPGCTSLKP---GSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYN--NHERYEDTYFKKFAGYYTTGDGAS-RDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKI 2136
            F     N   N+L     QG  + IA Y  G +  +    T+  L  +V   A  L   GIK GDRV  Y+P       AMLA + IGA+       F    V +R S    K++ + + V    K+ D     D  ++     G P +E  +++  V   G  +  E    + +  L  L+ + + R E                 + +   HPLFI+++SG+TG PK +VH+ GG ++     +K   +    D+       GW+  +   L   +  GA  ++++G P  P    +W ++++  +T   T     R L    D +V       L  L T+   G P+ P ++ + Y+ +        D    + TGG  +I+   G  +  P   G       G+     +E G  +     G L+  KP+P +    +N  N  +Y   YF KF G +  GD        G   + GR D  LN +G    +A++ + +   P++ E +         GE    F+ +A+   F+E +       +R K+ A  +P  I +   +P T SGK +   +++I   E    +   LA+P+ +D   ++ ++
Sbjct:   83 FHGARMNYAENLL-----QGKDEDIALYTAGEN-QEVRTVTFQQLREKVAVLASALGKLGIKMGDRVVGYIPNCALAVEAMLAASSIGAIWSSTSPDFGVSGVLDRFSQIQPKVMFSVNAVRYNGKIHDHMAKLDGVVQ-----GLPELEKVVIIPFV---GTEEKIEISQIKNSIFLSDLLKLADDRPE--------------LEFKQLPFNHPLFIMYSSGTTGPPKCMVHSAGGTLLQHLKEHKLHGNMGKTDIIMYYTTTGWMMWN--WLVSALAVGAALVLYDGSPFIPSPYVIWDLVDEIGITILGTGA---RWLQALEDKHVYPKDSNRLTSLHTILSTGSPLKPASFDYVYKHIKS------DLLLGSITGGTDIISLFAGHNTGLPVYRGEIQARSLGMAVESWNEEGVSVYD-SSGELICTKPFPCMPTHFWNDPNGSKYRKAYFTKFKGVWAHGDFCKITSRTGGIVMLGRSDGTLNPNGVRFGSAEIYNIVEKFPEV-EDSLCVGQQTDDGERVVLFIKMANGCKFNEEIVERARKQIRIKLSARHIPAVILETREIPYTASGKKVEVAVKRILAGEI-ITNRGALANPDSLDLYQDLPQL 653          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Match: EDO44212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW67])

HSP 1 Score: 130.568 bits (327), Expect = 1.316e-32
Identity = 105/319 (32.92%), Postives = 153/319 (47.96%), Query Frame = 1
Query:  961 SEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEG----YLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTF 1905
            S+    I  TSG+TG PK   HT     I  S+T K+  D   DDV+W  +D GW       LYGP  QGA+  I      + +A  +   ++KY ++     PT  R ++    + + +YQ  +L+   + GEP+NP   + + E  G     I + + QTET   ++     C   +PGS   P  G +  ++DE   E     EG    YL  ++P  G+      ++ER    Y      YY TGD A RD +GY    GR DD++  +G+ I   +VESAL+ HP + EAA V  P  V+GE    FV L  +F
Sbjct:  102 SDETSIIFFTSGTTGLPKMTQHTHASQGIGHSITGKYWLDLCPDDVHWTVSDPGWAKTAYGCLYGPWIQGASVFIHHTTEKF-EAKVILDHLQKYPISTMCLPPTAYRMMIH---EDLSRYQFPALRHCLSAGEPLNPEVMVDWKEKTG---LDIREGYGQTETT--LLCGTFRCIETRPGSMGKPAPGYDVRVIDEKCNETPAGIEGDIAVYLKPRRP-VGLFSEYIEDYERNVSAYR---GDYYLTGDRAVRDEDGYLWFIGRSDDVIISAGYRIGPFEVESALIEHPAVAEAAVVSSPDPVRGEVVKAFVILTPSF 407          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Match: acss2 (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101157758])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 391/684 (57.16%), Postives = 496/684 (72.51%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVT-----------------CYGIGKCTEAPGCRPARKLLVNMTNPR-DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +Y  +   +K +H+ S D Y +LY +SI +PD+FW   A+ FFWK KP     L YNF   +G I++   +  +TN+CYN+LDR + E+ LGD+IAF+WEGN+P D +  TY  L   VC+FA +LR++G+KKGDRV+IY+PM+IEL +AMLAC RIGAVH ++F GFSAES+ ERI D  C +L+T DG +RG+KLI+LK ++D+A++ C   G PV+ CIV+KH++                 C  + +  +    +  R +     NP  D  WH  +S+++   +C  EW  SE PLFIL+TSGSTGKPKGVVHT  GYM+Y + T+K VFDH+ DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W I++KY VTKFYTAPT IR LMK G + V K++RESLK+LGTVGEPINP  W WYY VVGE RCPIVDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH+R+E  YFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH +KGE  +CFVTL D   + + L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +V++ +  
Sbjct:   11 VYYGSGDLKKESHVPSFDKYKELYMKSIDNPDEFWGVIAKDFFWKSKPTG-PFLSYNFDVTKGEIFIKCMEGASTNICYNLLDRNVHERKLGDRIAFFWEGNEPGDESVVTYRELLQRVCRFANVLRSQGVKKGDRVSIYMPMVIELVVAMLACVRIGAVHSIVFAGFSAESLCERIMDSQCLLLITADGFYRGDKLINLKHLADEALQKCRDKGFPVKRCIVLKHLSKEPEESVGSHSPPAKRSCPDLQQDKQKGKVKKVRPVPQVPWNPEVDLCWHALISEAS--DECEPEWCNSEDPLFILYTSGSTGKPKGVVHTVSGYMLYTATTFKLVFDHQPDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWGIVDKYQVTKFYTAPTAIRLLMKFGSEPVQKFKRESLKVLGTVGEPINPEAWHWYYNVVGEKRCPIVDTFWQTETGGHVLTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHQRFESIYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHRAVAEAAVVGRPHPIKGESLYCFVTLKDGVAYSQMLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNEKDLGDISTLADSSVVEELFQ 691          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Match: acss2 (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101157758])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 391/684 (57.16%), Postives = 496/684 (72.51%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVT-----------------CYGIGKCTEAPGCRPARKLLVNMTNPR-DEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +Y  +   +K +H+ S D Y +LY +SI +PD+FW   A+ FFWK KP     L YNF   +G I++   +  +TN+CYN+LDR + E+ LGD+IAF+WEGN+P D +  TY  L   VC+FA +LR++G+KKGDRV+IY+PM+IEL +AMLAC RIGAVH ++F GFSAES+ ERI D  C +L+T DG +RG+KLI+LK ++D+A++ C   G PV+ CIV+KH++                 C  + +  +    +  R +     NP  D  WH  +S+++   +C  EW  SE PLFIL+TSGSTGKPKGVVHT  GYM+Y + T+K VFDH+ DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W I++KY VTKFYTAPT IR LMK G + V K++RESLK+LGTVGEPINP  W WYY VVGE RCPIVDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH+R+E  YFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH +KGE  +CFVTL D   + + L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +V++ +  
Sbjct:   11 VYYGSGDLKKESHVPSFDKYKELYMKSIDNPDEFWGVIAKDFFWKSKPTG-PFLSYNFDVTKGEIFIKCMEGASTNICYNLLDRNVHERKLGDRIAFFWEGNEPGDESVVTYRELLQRVCRFANVLRSQGVKKGDRVSIYMPMVIELVVAMLACVRIGAVHSIVFAGFSAESLCERIMDSQCLLLITADGFYRGDKLINLKHLADEALQKCRDKGFPVKRCIVLKHLSKEPEESVGSHSPPAKRSCPDLQQDKQKGKVKKVRPVPQVPWNPEVDLCWHALISEAS--DECEPEWCNSEDPLFILYTSGSTGKPKGVVHTVSGYMLYTATTFKLVFDHQPDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWGIVDKYQVTKFYTAPTAIRLLMKFGSEPVQKFKRESLKVLGTVGEPINPEAWHWYYNVVGEKRCPIVDTFWQTETGGHVLTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHQRFESIYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHRAVAEAAVVGRPHPIKGESLYCFVTLKDGVAYSQMLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNEKDLGDISTLADSSVVEELFQ 691          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Match: acss2 (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101157758])

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 391/669 (58.45%), Postives = 491/669 (73.39%), Query Frame = 1
Query:  130 LYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCY---GIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +Y  +   +K +H+ S D Y +LY +SI +PD+FW   A+ FFWK KP     L YNF   +G I++   +  +TN+CYN+LDR + E+ LGD+IAF+W GN+P D +  TY  L   VC+FA +LR++G+KKGDRV+IY+PM+IEL +AMLAC RIGAVH ++F GFSAES+ ERI D  C +L+T DG +RG+KLI+LK ++D+A++ C   G PV+ CIV+KH++      +G  +  P  R    L V      D  WH  +S+++   +C  EW  SE PLFIL+TSGSTGKPKGVVHT  GYM+Y + T+K VFDH+ DDVYWCTADIGWITGHSY+ YGP+  GAT ++FEG+PTYPD  R+W I++KY VTKFYTAPT IR LMK G + V K  RESLK+LGTVGEPINP  W WYY VVGE RCPIVDTFWQTETGGHV+TP+P  T +KPGSAT PFFGV   +++E+G+E+ GP EGYLVFK+PWPG+MRT+Y NH+R+E  YFKKF GYY TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VESALV H  + EAA V  PH +KGE  +CFVTL D   + + L  EL   VR KIGA A PDYIQ+ P LPKTRSGKIMRR+LRKIA NE + GD STLAD +V++ +  
Sbjct:   11 VYYGSGDLKKESHVPSFDKYKELYMKSIDNPDEFWGVIAKDFFWKSKPTG-PFLSYNFDVTKGEIFIKCMEGASTNICYNLLDRNVHERKLGDRIAFFWLGNEPGDESVVTYRELLQRVCRFANVLRSQGVKKGDRVSIYMPMVIELVVAMLACVRIGAVHSIVFAGFSAESLCERIMDSQCLLLITADGFYRGDKLINLKHLADEALQKCRDKGFPVKRCIVLKHLSKEPEESVGSHS-PPAKRSCPDLQVPWNPEVDLCWHALISEAS--DECEPEWCNSEDPLFILYTSGSTGKPKGVVHTVSGYMLYTATTFKLVFDHQPDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLPTYPDVSRMWGIVDKYQVTKFYTAPTAIRLLMKFGSEPVFK--RESLKVLGTVGEPINPEAWHWYYNVVGEKRCPIVDTFWQTETGGHVLTPLPAATPMKPGSATFPFFGVVPAILNESGEELEGPSEGYLVFKQPWPGVMRTVYGNHQRFESIYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHRAVAEAAVVGRPHPIKGESLYCFVTLKDGVAYSQMLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIACNEKDLGDISTLADSSVVEELFQ 673          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101172107])

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 393/671 (58.57%), Postives = 492/671 (73.32%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKIC-EKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPA---RKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +L+ P D  +K AH+   + Y ++Y +S++ P+ FW   A++FFWK KP    +LQYNF   +G +Y+   +   TN+CYNVLDR + E+ LG+K+AF+WEGN P      TY  L + VC+ A +L+  G+KKGDRV+IYLPMI EL   MLACARIGAVH ++F GFS+ES+ ERI D    +LVT DGV+RG KLI+LK ISD+A++ C EK    V  C+VV H          +AP         KLL      RD WW EAM+DS    +C  EW+++E PLFIL+TSGSTGKPKGV+HTT GY++Y S+T+K+VFDH  DDVYWCTAD+GWITGHSY+ YGP+  GAT ++FEG+P YP  GR W+IIEKY V KFYTAPT IR LMK G + + KY   +L+ILGTVGEPINP  W WYYEVVG+ RCP+VDTFWQTETGGHV+TP+P  T LKPGSAT PFFGVE T+++E+G+E+ G  EGYLVF++PWPGIMRT+Y NHER+E TYF+KF G+Y TGDG  RD +GYY ITGRIDDMLNVSGHL+STA+VE+AL  HP + EAA V  PH+VKGEC  CFVTL D   F++ L  EL   VR +IG  A PD+IQ+ PALPKTRSGKIMRRILR+IA NE++FGD STLADP V++ + +
Sbjct:    9 KLFHPPDDLQKDAHVPDFNSYLEIYRKSLEDPEAFWKEVADEFFWK-KPATGPMLQYNFDVTKGSVYIKCMEGAKTNMCYNVLDRHVKERNLGEKVAFHWEGNSPEHHLTITYQQLLSRVCRCANVLKKMGVKKGDRVSIYLPMIPELIYTMLACARIGAVHSIVFAGFSSESLCERIMDAQSSVLVTADGVYRGEKLINLKQISDEALEKCGEKAPCSVTKCLVVNH----------QAPRTNSGTLCNKLLTPWDTKRDLWWDEAMADSP--EECEPEWLDAEDPLFILYTSGSTGKPKGVLHTTAGYLLYTSLTFKYVFDHHHDDVYWCTADVGWITGHSYITYGPLANGATSVLFEGVPVYPHVGRFWEIIEKYRVNKFYTAPTAIRMLMKYGQEPLQKYDLSTLRILGTVGEPINPEAWQWYYEVVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVEPTILNEHGEELEGEAEGYLVFRRPWPGIMRTVYKNHERFESTYFRKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLMSTAEVEAALAQHPAVSEAAVVGRPHKVKGECLHCFVTLKDCKEFNQKLVEELKKQVRDRIGPIATPDFIQNAPALPKTRSGKIMRRILRQIARNETDFGDLSTLADPKVVEVLFS 666          
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic [Source:NCBI gene;Acc:101172107])

HSP 1 Score: 754.592 bits (1947), Expect = 0.000e+0
Identity = 378/671 (56.33%), Postives = 478/671 (71.24%), Query Frame = 1
Query:  127 ELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFI-EQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKIC-EKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPA---RKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILN 2124
            +L+ P D  +K AH+   + Y ++Y +S++ P+ FW   A++FFWK KP    +LQYNF   +G +Y+   +   TN+CYNVLDR + E+ LG+K+AF+WEGN P      TY  L + VC+ A +L+  G+KKGDRV+IYLPMI EL   MLACARIGAVH ++F GFS+ES+ ERI D    +LVT DGV+RG KLI+LK ISD+A++ C EK    V  C+VV H          +AP         KLL      RD WW EAM+DS    +C  EW+++E PLFIL+TSGSTGKPKGV+HTT GY++Y S+T+K+VFDH  DDVYWCTAD+GWITGHSY+ YGP+  GAT ++FEG+P YP  GR W+IIEKY V KFYTAPT IR LMK G + + KY   +L+ILGTVGEPINP  W WYYEVVG+ RCP+VDTFWQTETGGHV+TP+P  T LKPGSAT PFFGVE T+++E+G+E+ G  EGYLVF++PWPGIMRT+Y NHER+E TYF+KF G+Y TGDG     +    +T         SGHL+STA+VE+AL  HP + EAA V  PH+VKGEC  CFVTL D   F++ L  EL   VR +IG  A PD+IQ+ PALPKTRSGKIMRRILR+IA NE++FGD STLADP V++ + +
Sbjct:    9 KLFHPPDDLQKDAHVPDFNSYLEIYRKSLEDPEAFWKEVADEFFWK-KPATGPMLQYNFDVTKGSVYIKCMEGAKTNMCYNVLDRHVKERNLGEKVAFHWEGNSPEHHLTITYQQLLSRVCRCANVLKKMGVKKGDRVSIYLPMIPELIYTMLACARIGAVHSIVFAGFSSESLCERIMDAQSSVLVTADGVYRGEKLINLKQISDEALEKCGEKAPCSVTKCLVVNH----------QAPRTNSGTLCNKLLTPWDTKRDLWWDEAMADSP--EECEPEWLDAEDPLFILYTSGSTGKPKGVLHTTAGYLLYTSLTFKYVFDHHHDDVYWCTADVGWITGHSYITYGPLANGATSVLFEGVPVYPHVGRFWEIIEKYRVNKFYTAPTAIRMLMKYGQEPLQKYDLSTLRILGTVGEPINPEAWQWYYEVVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPGSATFPFFGVEPTILNEHGEELEGEAEGYLVFRRPWPGIMRTVYKNHERFESTYFRKFPGFYVTGDGEHHVLDQTLCVT---------SGHLMSTAEVEAALAQHPAVSEAAVVGRPHKVKGECLHCFVTLKDCKEFNQKLVEELKKQVRDRIGPIATPDFIQNAPALPKTRSGKIMRRILRQIARNETDFGDLSTLADPKVVEVLFS 657          
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Match: SMESG000022079.1 (SMESG000022079.1)

HSP 1 Score: 1404.81 bits (3635), Expect = 0.000e+0
Identity = 687/687 (100.00%), Postives = 687/687 (100.00%), Query Frame = 1
Query:   82 MPVQSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKINV 2142
            MPVQSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIVEAAAVPVPHEVKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKINV
Sbjct:    1 MPVQSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIVEAAAVPVPHEVKGECCFCFVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITKINV 687          
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Match: SMESG000023067.1 (SMESG000023067.1)

HSP 1 Score: 466.077 bits (1198), Expect = 2.865e-154
Identity = 270/704 (38.35%), Postives = 400/704 (56.82%), Query Frame = 1
Query:  142 TDHFRKLAHL----------------KSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNR--------NVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKH-----VTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHK-DDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCT--SLKPGSATLPFFGVETTLVDENGKEIIGPGEGY--LVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTF-----DENLRTELSHNV----RTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKI-ANNESNFGDTSTLADPNVIDAIL 2121
            TDHFRK  +                 ++++ +   YE+ I+  +   S+   Q FW +   NR         V + +F       ++    +G  N   N LDR       +++A  WE ++P +    TY  L    C+ + LL+ + +KK D V +Y+P    L  +MLAC RIGA H VIF GFS  ++A RI +   K+++T D   RG K+I+LK   D A+KIC  N   ++  +V +      V+   +  C E        K L  M N                  C  E ++SE  L+IL+TSGS+G PKG+VH T GY+++   T++ VF+ K   D++ C ADIGW+TGHSY++YGP+  G T   FE  PTYP+ GR W+++E+  ++  Y APT +R L++ G+++V KY R SL++LG VGEP+N   W WY EVVGE RC I+DT+WQTETGG +I+P P      ++PG    P  G++  L+D    ++I   EGY  LV K+ WPGI +T++ +H R+  +YFK++ GYY TGDG+ R  +  Y ITGRIDD++N SGH I TA++E  L  H  + E+A V  PH VKGE  + F+TL ++  +     +E L  +L+  +    R K+  +A PD+I   P LPKTRSGKIMRRILRKI ++N  + GD STL++P++++ ++
Sbjct:   11 TDHFRKSLNSFQLKFRFKSNLITPISEALELHGNSYEKLIEVCN---SDEGNQIFWAELAKNRIDWYEKFTKVSEIDFQKGINRWFI----NGKLNASVNCLDRH-AIAYPERLAVIWEKDEPGNHEFVTYKELLELTCRISNLLKEQNVKKHDVVILYMPTSPMLIASMLACVRIGAAHSVIFSGFSPNAIASRIMNTKAKVIITTDESVRGGKVINLKKNIDDAIKICPPNS--IDSVLVQRRTNNPSVSMGNVDICME--------KNLPLMPNV-----------------CKPEIMDSEDMLYILYTSGSSGPPKGIVHNTAGYLLFAGFTFEQVFNFKPGKDLFGCVADIGWVTGHSYIVYGPLFNGGTTFTFESTPTYPNPGRYWEMVERLKMSHIYLAPTALRLLIQHGEEWVRKYDRSSLRVLGCVGEPLNTEAWKWYNEVVGENRCDIIDTWWQTETGGIIISPRPSGKGDQIRPGMPMRPLPGIDPALIDLETNKLITEKEGYGALVLKRSWPGIAKTIFGDHSRFVSSYFKRYPGYYFTGDGSHRYLDNSYQITGRIDDVINTSGHRIGTAELEDILDMHECVSESAVVGFPHSVKGEGIYAFITLKNSALYYLEKGNEKLLRKLTQQLKQLTREKLAHYAAPDFILITPGLPKTRSGKIMRRILRKISSDNIQDLGDISTLSNPDIVEFLI 679          
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Match: SMESG000043630.1 (SMESG000043630.1)

HSP 1 Score: 325.094 bits (832), Expect = 2.087e-100
Identity = 220/669 (32.88%), Postives = 341/669 (50.97%), Query Frame = 1
Query:  148 HFRKLAHLKSMDDYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRD-EWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPT-YPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYV--LKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLK-----PGSATLPFFGVETTLVDENGKEIIGPGE-GYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFC-FVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAI 2118
            +F K   L+++  Y   +++S++  ++FW   A    W ++     VL  +  H+  P +   F+    N+ YN +DR +++G GD++A  ++        K TY  L   V K A ++   G+ KGDRV IYLPM+ +  I MLACAR+GAVH ++FGGF+A+ +A RI     K +VT +     N+LI+     ++A+ +      P  C I  +             PG + A     ++   RD +W HE  S +      PV  V+  HPL+IL+TSG+TG PKGVV  T GY +    + K ++D    + +W  +D GW+ GHSY+ Y P+    T II+EG P   PD  + ++++  +     + APT +R++ +     +   +Y+    + L   GE  +  T  W  E     + P++D +WQTETG  +  P  G  + +     PGSA  P  G +  ++D N    +GP   G +V K P  PG+  TLYNN E +   +F KF GYY T D  +    G+  +  R DD+LNV+GH +S+  +E A + +P +VE A V +   +KG+      V  ++T    E++ ++    VR +IGA A       V  LPKTRSGKI R  +  +AN +  F    TL DP V D I
Sbjct:   20 NFTKSRFLQTLTKYQLEFKQSLEQKEEFWGKAANDIVWGKQ--CSRVLDASELHS--PKW---FEGSEMNMSYNCVDRHVDEGFGDQLAVIYDSPITGAIQKITYRQLLENVSKLAGVMAKYGVTKGDRVLIYLPMVPQTLITMLACARLGAVHSLVFGGFAAKELAVRIRHCEPKFIVTTNVGVEPNRLINYTNYVNEAISL--SGFQPKHCLIYNR-------------PGHKRA-----DLKPERDLDWDHELYSAAP---HDPV-IVDGNHPLYILYTSGTTGLPKGVVRPTAGYAVALKWSMKNLYDVNSGETWWAASDFGWVVGHSYICYAPLLHRCTTIIYEGKPVGTPDTSQYFRVLNWHNPVALFVAPTALRAIRREDPQAIHGARYRHPRFRSLFLAGEHCDVDTLNWAKETF---KVPVLDHWWQTETGWAITCPAAGLETREDLVPPPGSAGRPVPGYDVKILDTNTGAELGPNRLGRIVVKLPMPPGMASTLYNNDEMFSKIFFSKFPGYYDTMDAGTSTEFGHIMVLARDDDVLNVAGHRLSSGALEEACLENPCVVECAVVGLDDPLKGQVPLALLVPDSNTEKSSEDIVSDTIKIVRDRIGAVAGMRTAIVVHRLPKTRSGKISRSAIAAMANGKP-FKAPVTLEDPTVFDPI 653          
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Match: SMESG000043652.1 (SMESG000043652.1)

HSP 1 Score: 276.944 bits (707), Expect = 1.213e-82
Identity = 198/633 (31.28%), Postives = 310/633 (48.97%), Query Frame = 1
Query:  187 YHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAK-GIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWV--ESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIP-TYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKP-GSATLPFFGVETTLVDENGKEIIGPGEGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCF-VTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNE 2064
            + KLY+ S+K P+K W + A +  W +K           +H   P+    F +G  N+ +N LDR I  G GD +A  +E        K TY  L   V K + +L  +   K GDRV +Y P+I +  IAMLAC+RIG ++ VI+GGF AE VA+RI     KI++T +  + G   +D K I D+A++I + +   VE C+V                G  P    + +M + RD  W     ++ ++   P  W+  ES+HPLFI+++SG+TG+PKG V TTG  ++    T K++ + K  + +W  +D GWITG + + YGP+  G T I++EG P T P+   + +II ++ V  F  +PT+ R L         K     L+ +   GE  +     W  +      CP+ D + QTE  G V +  P     KP  S  +P FG++  L+  N  EI+G   G ++      P    TL+ + +RY +TYF  + G+Y T D       G   I  R DD++ V+        +E   + + ++V AA V V +E  G+  F F V   D+   ++++  +    V+      A  + +  V  LPKT + KI R  L  + N +
Sbjct:    6 FEKLYDLSLKEPEKLWDSLASEVVWDKK------YSAVINHRSSPL-PKWFFEGKINMSFNCLDRHINDGRGDDLAVIFESPVTRTVQKITYQSLLESVEKLSGVLADRCNTKAGDRVLLYFPVIPQCLIAMLACSRIGVIYTVIYGGFPAEEVADRIRHIEPKIILTSNVGFDGYNTVDYKQIVDEAIEISQFD---VEYCVVYNR-------------GNYP----MASMIDIRDLDW-----ETEMMYAVPQRWIPMESDHPLFIIYSSGTTGEPKGFVMTTGAAIVTDKYTIKYLLNIKSKETFWMFSDFGWITGQTVMSYGPLLMGCTTILYEGKPATTPNPQEMARIINEHNVASFMASPTIFRILKNYESIPTFKITINYLRAIYIAGEKSDSNLIRWISDAFN---CPVYDIWGQTELNGVVTS--PALYFGKPVNSVPVPMFGIKPKLIYPN-PEILGDAFGEILLTAGLSPVFAETLFKDDKRYIETYFTTYQGFYDTKDCGRMTEEGGLEILSRSDDIIKVNSMRFCGGAIEEICLKNHELVSAAVVGVDNEENGQVPFGFLVKRKDSNVNEKDIMNKTKELVKHHYNGLARLENLIFVADLPKTNTHKISRCSLSAMLNRK 600          
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Match: SMESG000043650.1 (SMESG000043650.1)

HSP 1 Score: 276.559 bits (706), Expect = 1.607e-82
Identity = 199/657 (30.29%), Postives = 318/657 (48.40%), Query Frame = 1
Query:  184 DYHKLYEESIKSPDKFWSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDRFIEQGLGDKIAFYWEGNDPMDFN-KYTYLYLHAEVCKFAKLLRAK-GIKKGDRVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKILVTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKCTEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFILHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWITGHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVIRSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVDTFWQTETGGHVITPIPGCTSLKPGS--ATLPFFGVETTLVDENGKEIIGPG-EGYLVFKKPW-PGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYTITGRIDDMLNVSGHLISTAQVESALVSHPKIXXXXXXXXXXXXKGECCFCFVTLADTFTF-DENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIMRRILRKIANNESNFGDTSTLADPNVIDAILNITK 2133
            DY KLYE SI+ P+K W    ++  W  KP      +        PI    F  G  N+ YN LD  ++ G GD IA  +E N  MD + K ++  L   V   A ++  K GI K DRV +Y P+I +  I MLAC RIGA++ VIFGG   +++A RI     K+L+TC+     ++  + K   D A++I E      + C+V               P  +PA      M    D  W   M  S  +G  PV  +ES +P+++++TSG+TG+PKG+V  TG  ++ C    K++ +      +W  +D G++TG  ++ +GP+ Q  + +++EG    PD  +L++ + K+ V  FY+A T +R L     D + + +   L  +   G+  + +   W   +    +CPI   + QTE GGH ++   GC   +      ++P   +   +V+ +  EI+  G +G L+ K P  P    T Y N ER+ +TYFK + G+Y T D   +  NG + +  R DD++ ++   IS   +E   +    I  A  VP+    +G+    FVT  +     +E +R +L   V   IG FA   ++  VP  P+T +GKI R  L  + N    +    T+ +P +   I  I K
Sbjct:    5 DYEKLYELSIEHPEKVWDELGKEVVW-DKP-----YESVIEDVTSPI-SNWFVGGKINMSYNCLDIHVKNGFGDDIAVIYE-NPSMDISEKISFKELLNSVELLAGVMANKCGIGKDDRVVLYFPVIPQCLIGMLACTRIGALYSVIFGGIPPQTIANRIEHLEPKLLITCNVGAERDQTRNYKERMDIAIEISEFKP---DLCLVYNR------------PKTKPAL-----MKEFVDLDWETEMETSIPVG--PVS-LESNYPMYVIYTSGTTGQPKGLVMATGNSVVICKYMMKYIKNIGPQKCWWMLSDFGYLTGQLFMAFGPLIQRNSTLLYEGT---PDLHQLFEFMNKHKVVSFYSAITFMRQLHYESSDSIFQPEYGGLHSINAGGDKSDKKLEKW---ITKTFKCPIYIQWGQTELGGHGMS---GCLGFQRNDDPHSIPLLSINPFIVNNDSGEILPLGSQGRLLLKTPLPPSAALTYYKNKERFFETYFKSYPGFYDTMDYGIKFKNGAFKVISRADDVMKINSMRISGGAIEEVCLKCQSITNAIIVPIECLNEGQNPVAFVTKRNGQELSNEEIRKDLISLVNNHIGEFARLRHVFIVPDFPRTINGKISRSSLAAMTNENRVYTMPPTIENPEIYREIFYILK 621          
The following BLAST results are available for this feature:
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS20.000e+058.59acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS20.000e+057.62acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS12.083e-17743.32acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS15.923e-17047.10acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS11.210e-13942.45acyl-CoA synthetase short chain family member 1 [S... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-190.000e+050.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-190.000e+050.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-190.000e+050.07Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
sur-52.397e-2823.20Acetoacetyl-CoA synthetase [Source:UniProtKB/Swis... [more]
sur-52.397e-2823.20Acetoacetyl-CoA synthetase [Source:UniProtKB/Swis... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AcCoAS0.000e+056.70gene:FBgn0012034 transcript:FBtr0333126[more]
AcCoAS0.000e+056.70gene:FBgn0012034 transcript:FBtr0078413[more]
AcCoAS0.000e+059.89gene:FBgn0012034 transcript:FBtr0078414[more]
CG64322.388e-9732.29gene:FBgn0039184 transcript:FBtr0346110[more]
CG64322.388e-9732.29gene:FBgn0039184 transcript:FBtr0084606[more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss20.000e+058.98acyl-CoA synthetase short chain family member 2 [S... [more]
acss20.000e+057.75acyl-CoA synthetase short chain family member 2 [S... [more]
acss20.000e+054.97acyl-CoA synthetase short chain family member 2 [S... [more]
acss2l0.000e+052.24acyl-CoA synthetase short chain family member 2 li... [more]
acss20.000e+065.93acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS20.000e+058.57acyl-CoA synthetase short chain family member 2, g... [more]
ENSXETT00000021220.10.000e+056.69acyl-CoA synthetase short-chain family member 2, g... [more]
ENSXETT00000021237.10.000e+056.24acyl-CoA synthetase short-chain family member 2, g... [more]
ENSXETT00000021244.10.000e+055.70acyl-CoA synthetase short-chain family member 2, g... [more]
ACSS20.000e+057.46acyl-CoA synthetase short chain family member 2, g... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acss20.000e+057.83acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss20.000e+056.61acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss20.000e+057.56acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss12.782e-17843.54acyl-CoA synthetase short-chain family member 1 [S... [more]
Acss36.070e-11133.93acyl-CoA synthetase short-chain family member 3 [S... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9QXG4|ACSA_MOUSE0.000e+057.83Acetyl-coenzyme A synthetase, cytoplasmic OS=Mus m... [more]
sp|Q9VP61|ACSA_DROME0.000e+056.85Acetyl-coenzyme A synthetase OS=Drosophila melanog... [more]
sp|Q9NR19|ACSA_HUMAN0.000e+058.59Acetyl-coenzyme A synthetase, cytoplasmic OS=Homo ... [more]
sp|B9DGD6|ACS_ARATH0.000e+053.02Acetyl-coenzyme A synthetase, chloroplastic/glyoxy... [more]
sp|B8FIN2|ACSA_DESAL0.000e+052.86Acetyl-coenzyme A synthetase OS=Desulfatibacillum ... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4BDJ70.000e+059.56Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210PEM70.000e+058.14Acetyl-coenzyme A synthetase OS=Mizuhopecten yesso... [more]
A0A267H8Y40.000e+058.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GSC00.000e+058.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JEN40.000e+058.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss20.000e+058.92acyl-CoA synthetase short chain family member 2 [S... [more]
acss20.000e+057.33acyl-CoA synthetase short chain family member 2 [S... [more]
acss2l0.000e+057.27acetyl-coenzyme A synthetase, cytoplasmic-like [So... [more]
acss2l0.000e+054.59acetyl-coenzyme A synthetase, cytoplasmic-like [So... [more]
acss11.500e-11840.68acyl-CoA synthetase short chain family member 1 [S... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acss20.000e+063.12acyl-CoA synthetase short chain family member 2 [S... [more]
ENSPMAT00000006895.11.621e-6830.78pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-... [more]
ENSPMAT00000005866.13.767e-2054.93pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gen... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ACS20.000e+042.79Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
ACS11.662e-17442.84Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
PCS601.756e-1823.37Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420840.000e+056.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391350.000e+047.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492932.897e-10632.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373741.941e-3423.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442121.316e-3232.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss20.000e+057.16acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
acss20.000e+057.16acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
acss20.000e+058.45acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
acss2l0.000e+058.57acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
acss2l0.000e+056.33acetyl-coenzyme A synthetase, cytoplasmic [Source:... [more]
back to top
BLAST of Acetyl-coenzyme A synthetase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022079.10.000e+0100.00SMESG000022079.1[more]
SMESG000023067.12.865e-15438.35SMESG000023067.1[more]
SMESG000043630.12.087e-10032.88SMESG000043630.1[more]
SMESG000043652.11.213e-8231.28SMESG000043652.1[more]
SMESG000043650.11.607e-8230.29SMESG000043650.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006199 ID=SMED30006199|Name=Acetyl-coenzyme A synthetase|organism=Schmidtea mediterranea sexual|type=transcript|length=2357bp
ATATTTTCGTTTAAGTTATTTAAATTTAAGGTCAATAAATTTACAGGATT
GGAAACACTATACACCGATAGTTGTTAATCGATGCCTGTCCAATCAGATT
CTGATACTATAATGTCTACCAATATAGAACTTTATGAACCGACTGACCAT
TTTAGGAAATTGGCTCATTTAAAAAGTATGGATGATTACCACAAATTATA
TGAAGAGTCAATAAAAAGTCCTGATAAATTTTGGTCGAATTTCGCCGAAC
AATTTTTTTGGAAACAAAAACCAGATAATCGAAATGTTTTGCAATATAAC
TTTCATCATGCTCGTGGACCAATTTATGTAACTGCATTTAAAGATGGAAC
AACCAATCTATGTTATAACGTTCTTGATCGGTTTATTGAACAAGGATTGG
GGGATAAAATAGCATTTTACTGGGAAGGAAACGATCCTATGGATTTCAAT
AAATACACATACCTTTATTTGCATGCTGAGGTATGTAAATTTGCTAAGTT
ATTGCGAGCGAAAGGGATTAAAAAAGGGGATCGCGTAGCAATATACTTGC
CAATGATAATAGAATTGCCTATTGCCATGTTAGCCTGTGCTAGAATCGGA
GCAGTGCATTTAGTCATATTTGGTGGGTTTTCAGCGGAATCTGTAGCAGA
GCGAATTTCTGATGGAAATTGTAAAATACTTGTTACTTGCGATGGAGTGT
GGCGAGGCAATAAATTGATCGATTTAAAAGTTATATCCGATCAAGCTATG
AAAATTTGTGAGAAAAATGGATCACCTGTTGAATGTTGTATTGTGGTTAA
ACATGTAACATGTTACGGTATTGGAAAATGTACGGAAGCACCAGGATGTC
GACCTGCAAGGAAACTTCTTGTGAATATGACAAACCCTCGAGACGAATGG
TGGCATGAAGCTATGAGTGACTCCAATCTGCTTGGCGACTGTCCTGTTGA
ATGGGTGGAATCTGAGCACCCGTTGTTCATTCTGCATACAAGTGGCAGTA
CTGGTAAACCAAAAGGCGTAGTGCATACTACTGGTGGTTACATGATTTAT
TGTTCAATGACGTATAAGTTTGTGTTTGACCACAAAGACGATGACGTCTA
TTGGTGCACAGCCGACATTGGCTGGATAACCGGACACAGCTATGTCCTAT
ATGGTCCAATGACACAAGGTGCTACAGGAATAATATTTGAAGGAATTCCA
ACTTATCCTGACGCGGGACGTCTGTGGCAAATTATAGAAAAATATGCAGT
AACAAAATTCTATACAGCACCAACTGTTATTCGATCTCTTATGAAATGTG
GTGATGATTATGTATTGAAGTATCAACGAGAATCTCTCAAGATATTGGGT
ACTGTTGGTGAACCTATTAATCCTCGCACGTGGCTTTGGTATTATGAGGT
AGTTGGTGAGGCTCGTTGTCCAATAGTCGATACGTTTTGGCAAACTGAAA
CTGGGGGACATGTAATTACTCCTATTCCCGGTTGTACATCTTTAAAGCCA
GGATCAGCTACTCTTCCATTTTTTGGAGTAGAAACTACTCTTGTTGATGA
AAATGGAAAAGAAATTATTGGACCTGGTGAAGGTTATCTTGTATTTAAAA
AACCCTGGCCTGGAATTATGCGTACTCTTTACAATAATCACGAAAGATAT
GAAGATACATATTTCAAAAAGTTCGCTGGATATTATACAACTGGTGATGG
AGCTTCCAGGGATGCCAATGGATATTATACAATTACTGGCCGCATAGATG
ATATGTTGAATGTTTCCGGTCATTTAATAAGTACGGCGCAAGTGGAGTCG
GCACTCGTAAGTCATCCGAAAATTGTTGAAGCAGCTGCTGTGCCAGTACC
ACATGAAGTCAAGGGGGAATGTTGCTTTTGCTTTGTTACCCTTGCCGACA
CTTTTACTTTCGATGAAAATCTTAGAACTGAATTGTCGCACAATGTAAGA
ACGAAAATCGGTGCATTTGCAGTTCCGGATTACATTCAAGATGTTCCGGC
TCTACCGAAAACTCGAAGCGGAAAAATCATGAGACGAATTTTACGAAAAA
TAGCAAATAATGAATCGAATTTCGGCGATACATCGACTCTGGCTGATCCA
AATGTAATAGATGCGATTCTTAATATCACAAAAATAAATGTGTGAAAATT
TTTTCTCAAATCAAATTAAAATTTAGGTTGTGTCATAAAATGGTTGTGTT
AGAATTAGTTTTTTAACTTTTTTTCGGTACCTTAGTTAAACAATTTTAAA
TTTATTTTTAGAAATTTTATTTTATTTGACATTATTTTGTGTAGTAGAGT
GGAGTAAACTTAAATTTCTATTTGATATTTAGTATAAGTTAATAAATGTT
TTTTACG
back to top

protein sequence of SMED30006199-orf-1

>SMED30006199-orf-1 ID=SMED30006199-orf-1|Name=SMED30006199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=688bp
MPVQSDSDTIMSTNIELYEPTDHFRKLAHLKSMDDYHKLYEESIKSPDKF
WSNFAEQFFWKQKPDNRNVLQYNFHHARGPIYVTAFKDGTTNLCYNVLDR
FIEQGLGDKIAFYWEGNDPMDFNKYTYLYLHAEVCKFAKLLRAKGIKKGD
RVAIYLPMIIELPIAMLACARIGAVHLVIFGGFSAESVAERISDGNCKIL
VTCDGVWRGNKLIDLKVISDQAMKICEKNGSPVECCIVVKHVTCYGIGKC
TEAPGCRPARKLLVNMTNPRDEWWHEAMSDSNLLGDCPVEWVESEHPLFI
LHTSGSTGKPKGVVHTTGGYMIYCSMTYKFVFDHKDDDVYWCTADIGWIT
GHSYVLYGPMTQGATGIIFEGIPTYPDAGRLWQIIEKYAVTKFYTAPTVI
RSLMKCGDDYVLKYQRESLKILGTVGEPINPRTWLWYYEVVGEARCPIVD
TFWQTETGGHVITPIPGCTSLKPGSATLPFFGVETTLVDENGKEIIGPGE
GYLVFKKPWPGIMRTLYNNHERYEDTYFKKFAGYYTTGDGASRDANGYYT
ITGRIDDMLNVSGHLISTAQVESALVSHPKIVEAAAVPVPHEVKGECCFC
FVTLADTFTFDENLRTELSHNVRTKIGAFAVPDYIQDVPALPKTRSGKIM
RRILRKIANNESNFGDTSTLADPNVIDAILNITKINV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR011904Ac_CoA_lig
IPR025110AMP-bd_C
IPR032387ACAS_N
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0019427acetyl-CoA biosynthetic process from acetate
GO:0048149behavioral response to ethanol
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0003987acetate-CoA ligase activity
GO:0005524ATP binding
GO:0016208AMP binding
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032387Acetyl-coenzyme A synthetase, N-terminal domainPFAMPF16177ACAS_Ncoord: 36..97
e-value: 1.4E-14
score: 53.7
IPR025110AMP-binding enzyme, C-terminal domainPFAMPF13193AMP-binding_Ccoord: 571..648
e-value: 2.8E-21
score: 76.3
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 76..554
e-value: 4.0E-93
score: 314.5
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 557..686
e-value: 9.1E-26
score: 92.4
NoneNo IPR availablePANTHERPTHR24095:SF126ACETYL-COENZYME A SYNTHETASE, CYTOPLASMICcoord: 8..680
NoneNo IPR availablePANTHERPTHR24095FAMILY NOT NAMEDcoord: 8..680
NoneNo IPR availableCDDcd05966ACScoord: 34..672
e-value: 0.0
score: 1059.09
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 35..679
NoneNo IPR availableTMHMMTMhelixcoord: 152..174
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 107..561
e-value: 7.8E-90
score: 301.5
IPR011904Acetate-CoA ligaseTIGRFAMTIGR02188TIGR02188coord: 31..680
e-value: 4.8E-266
score: 881.9
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 300..311