Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30006196
Length (bp)979
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin alpha chain (SMED30006196) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30006196) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006196

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30006196SMESG000021744.1 PL08001A1A01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30006196SMESG000021744.1 PL08001A1A01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30006196SMESG000021744.1 PL08001A1A01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 234.572 bits (597), Expect = 1.895e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  246 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 423          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 234.572 bits (597), Expect = 2.554e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 438          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 233.417 bits (594), Expect = 2.659e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  226 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 403          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 234.187 bits (596), Expect = 4.571e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 233.032 bits (593), Expect = 1.033e-72
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 233.032 bits (593), Expect = 4.008e-73
Identity = 103/184 (55.98%), Postives = 136/184 (73.91%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEG 553
            PYPRIHFPLA F+P++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+  LLFRG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D   + G
Sbjct:  261 PYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSMEDNG 444          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-9 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q20221])

HSP 1 Score: 227.639 bits (579), Expect = 6.523e-71
Identity = 97/179 (54.19%), Postives = 135/179 (75.42%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDG 538
            PYPRIHFPL  +API+S EKA HE++++ E+T+  FE   QM+K D   G++M+C LL+RG+V P  V  A+  +K  +SI+FVDWCPTGFK+GIN  PPT +P + +++  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D 
Sbjct:  266 PYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQCFEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTKRSIQFVDWCPTGFKVGINYQPPTVVPGADLSKLQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGLDA 444          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-5 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q19490])

HSP 1 Score: 226.483 bits (576), Expect = 1.317e-70
Identity = 99/178 (55.62%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +API+S EKA HE+LS+ E+T   FE  +QM+K D   G++M+C LL+RG+V P  +  A++ IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLVTYAPIISAEKAYHEQLSVSEITNVCFEPGSQMVKCDPRNGKYMACCLLYRGDVVPKEINSAISTIKTKRAIQFVDWCPTGFKVGINYQPPTVVPGGDMAKLQRAVCMLSNTTAIQEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-4 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5EDD4])

HSP 1 Score: 224.942 bits (572), Expect = 5.206e-70
Identity = 99/178 (55.62%), Postives = 133/178 (74.72%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA++ P++S EKA HE LS+ ++T   FE  NQM+K D   G++M+  LL+RG+V P  V  A+T IK  +S++FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL +KF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL KDYEE   D
Sbjct:  259 PYPRIHFPLASYTPLISAEKAYHEALSVNDITNSCFEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGAD 436          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 222.631 bits (566), Expect = 3.497e-69
Identity = 98/178 (55.06%), Postives = 131/178 (73.60%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA + P++S EKA HE LS+ ++T   FE  NQM+K D   G++M+  LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL +KF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL KDYEE   D
Sbjct:  259 PYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGAD 436          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 234.958 bits (598), Expect = 9.444e-74
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+KVD   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  MD
Sbjct:  261 PYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 233.417 bits (594), Expect = 3.442e-73
Identity = 102/184 (55.43%), Postives = 136/184 (73.91%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEG 553
            PYPRIHFPLA +AP++S EKA HE+L++ E+T   FE  NQM+K D   G++M+C +L+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF E+  +++AL KDYEE  +D   E G
Sbjct:  261 PYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGIDSTTELG 444          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 232.646 bits (592), Expect = 7.168e-73
Identity = 100/178 (56.18%), Postives = 134/178 (75.28%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  MD
Sbjct:  261 PYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 208.764 bits (530), Expect = 1.816e-63
Identity = 93/184 (50.54%), Postives = 129/184 (70.11%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEG 553
            P+PRIHFPL  +AP++S E++ HE+ +I  LT   FE  N M+K D   G+FM+C +L+RG+V P  V  A++ IK  + I+FVDWCPTGFKIGIN   P  +P   +A+TS+   ML+NT+AI  A+  L++KF L++ KR+FVHW+VGEGMEE EFTE+  NI+ L +D+EE  +D   E G
Sbjct:  272 PFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLDNAEEGG 455          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 171.4 bits (433), Expect = 2.515e-49
Identity = 82/193 (42.49%), Postives = 121/193 (62.69%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVVDTSAPSA 580
            PYPRIH+PL N+AP++    +Q   +S  +LT   F+  NQM++ + S G++M+  LL+RG+++P  +  AL  IKR++S  FVDW PTGFKIG++  PP  +P   +A T++    ++N + I  AW RL +KF  LY +R+FV+ +VGEG+EE  F E+  NI  LV DY E           VD SAP++
Sbjct:  262 PYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLE-----------VDASAPTS 443          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 231.876 bits (590), Expect = 2.213e-74
Identity = 101/178 (56.74%), Postives = 134/178 (75.28%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ ++T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE   D
Sbjct:  108 PYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 285          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l2 (tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1646])

HSP 1 Score: 234.958 bits (598), Expect = 1.346e-73
Identity = 102/178 (57.30%), Postives = 136/178 (76.40%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V +A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 438          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba2 (tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1970])

HSP 1 Score: 234.572 bits (597), Expect = 1.545e-73
Identity = 102/178 (57.30%), Postives = 136/178 (76.40%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V +A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKACHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLARVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 234.187 bits (596), Expect = 2.111e-73
Identity = 104/187 (55.61%), Postives = 139/187 (74.33%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD--GKFEEGV 556
            PYPRIHFPLA +AP++S EKA HE+LS+ ++T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE   D  G  E+GV
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSIGDDEDGV 447          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 234.572 bits (597), Expect = 3.798e-73
Identity = 104/187 (55.61%), Postives = 139/187 (74.33%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD--GKFEEGV 556
            PYPRIHFPLA +AP++S EKA HE+LS+ ++T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE   D  G  E+GV
Sbjct:  289 PYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSIGDDEDGV 475          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 234.187 bits (596), Expect = 4.144e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 234.187 bits (596), Expect = 4.144e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 234.187 bits (596), Expect = 4.144e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 234.187 bits (596), Expect = 4.144e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:Xenbase;Acc:XB-GENE-950490])

HSP 1 Score: 233.417 bits (594), Expect = 8.179e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  264 PYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTAVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 441          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 234.572 bits (597), Expect = 1.753e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 438          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 234.958 bits (598), Expect = 2.227e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  290 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 467          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 234.187 bits (596), Expect = 3.138e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 233.032 bits (593), Expect = 7.089e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 232.646 bits (592), Expect = 9.947e-73
Identity = 100/178 (56.18%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q25008|TBA1_HOMAM (Tubulin alpha-1 chain OS=Homarus americanus OX=6706 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 5.029e-74
Identity = 103/178 (57.87%), Postives = 136/178 (76.40%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P + +A+ S+ V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL KDYEE  MD
Sbjct:  261 PYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIANIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGADLAKVSRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q94572|TBA3_HOMAM (Tubulin alpha-3 chain OS=Homarus americanus OX=6706 PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.623e-73
Identity = 103/178 (57.87%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+ S+ V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLVTYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTAVPGGDLAKVSRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q91060|TBA_NOTVI (Tubulin alpha chain OS=Notophthalmus viridescens OX=8316 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 9.069e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTAVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGLD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P06605|TBA3_DROME (Tubulin alpha-3 chain OS=Drosophila melanogaster OX=7227 GN=alphaTub84D PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 9.467e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+KVD   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  MD
Sbjct:  261 PYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMD 438          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P02552|TBA1_CHICK (Tubulin alpha-1 chain (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.644e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  222 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 399          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A448X0L1 (Tubulin alpha chain OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS18366 PE=3 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 1.127e-93
Identity = 131/178 (73.60%), Postives = 153/178 (85.96%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPL+NFAP +SPEKA+HE +S  ELTR VFERENQM+KVD S G+FMSCSLLFRGNVSP  VYL+L E+K +K I+FVDWCPTGFK+GI   PP T+  S++AQ SKNV ML N SA+GQAWQRLTHKFYLLYSKRSF+HWF+GEGMEE EFT++L N++ LVKDYEEA+MD
Sbjct:  169 PYPRIHFPLSNFAPCISPEKAEHESVSTRELTRAVFERENQMVKVDPSCGKFMSCSLLFRGNVSPSEVYLSLMELKTNKGIDFVDWCPTGFKVGITSEPPVTVTESRVAQCSKNVIMLANNSAVGQAWQRLTHKFYLLYSKRSFIHWFIGEGMEESEFTDALSNMTTLVKDYEEASMD 346          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A2H1C8T7 (Tubulin alpha chain OS=Fasciola hepatica OX=6192 GN=D915_09028 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 1.276e-89
Identity = 124/185 (67.03%), Postives = 156/185 (84.32%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGV 556
            PYPRIHFPL+NFAP +SPEKA+HE L+  ELTR VF++ENQM+KVD S+G+FMSC+LL+RG+VSP  VYL+L E+K  + IEFVDWCPTGFK+GI+  PP +I  S++AQ  KNV ML N SA+GQAWQRLTHKFYLL+SKRSF+HW+VGEGMEE EF ++L N+++LVKDYEEA+MD K +  +
Sbjct:  226 PYPRIHFPLSNFAPCISPEKAEHEALTTRELTRSVFDKENQMVKVDPSYGKFMSCTLLYRGDVSPSQVYLSLMELKSCRGIEFVDWCPTGFKVGISSSPPVSIVDSRVAQCDKNVVMLANNSAVGQAWQRLTHKFYLLFSKRSFIHWYVGEGMEESEFNDALINMTSLVKDYEEASMDSKTDHTI 410          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A4E0RB94 (Tubulin alpha chain OS=Fasciola hepatica OX=6192 GN=D915_006002 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 5.180e-89
Identity = 124/185 (67.03%), Postives = 156/185 (84.32%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGV 556
            PYPRIHFPL+NFAP +SPEKA+HE L+  ELTR VF++ENQM+KVD S+G+FMSC+LL+RG+VSP  VYL+L E+K  + IEFVDWCPTGFK+GI+  PP +I  S++AQ  KNV ML N SA+GQAWQRLTHKFYLL+SKRSF+HW+VGEGMEE EF ++L N+++LVKDYEEA+MD K +  +
Sbjct:  257 PYPRIHFPLSNFAPCISPEKAEHEALTTRELTRSVFDKENQMVKVDPSYGKFMSCTLLYRGDVSPSQVYLSLMELKSCRGIEFVDWCPTGFKVGISSSPPVSIVDSRVAQCDKNVVMLANNSAVGQAWQRLTHKFYLLFSKRSFIHWYVGEGMEESEFNDALINMTSLVKDYEEASMDSKTDHTI 441          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A183AE01 (Tubulin alpha chain OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5186 PE=3 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.031e-88
Identity = 124/186 (66.67%), Postives = 157/186 (84.41%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVV 559
            PYPRIHFPL+NFAP +SPEKA+HE L+  ELTR VF++ENQM+KVD ++G+FMSC+LL+RG+VSP  VYL+L E+K  + IEFVDWCPTGFK+GI+  PP +I  S++AQ  KNV ML N SA+GQAWQRLTHKFYLL+SKRSF+HW+VGEGMEE EF ++L N+++LVKDYEEA++D K E  +V
Sbjct:  273 PYPRIHFPLSNFAPCISPEKAEHEMLTTRELTRAVFDKENQMVKVDPTYGKFMSCTLLYRGDVSPSQVYLSLMELKSSRGIEFVDWCPTGFKVGISSSPPVSIVDSRVAQCDKNVVMLANNSAVGQAWQRLTHKFYLLFSKRSFIHWYVGEGMEESEFNDALINMTSLVKDYEEASLDSKPENMIV 458          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A504YKN0 (Tubulin alpha chain OS=Fasciola gigantica OX=46835 GN=FGIG_02201 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 4.919e-88
Identity = 124/185 (67.03%), Postives = 156/185 (84.32%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGV 556
            PYPRIHFPL+NFAP +SPEKA+HE L+  ELTR VF++ENQM+KVD S+G+FMSC+LL+RG+VSP  VYL+L E+K  + IEFVDWCPTGFK+GI+  PP +I  S++AQ  KNV ML N SA+GQAWQRLTHKFYLL+SKRSF+HW+VGEGMEE EF ++L N+++LVKDYEEA+MD K +  +
Sbjct:  344 PYPRIHFPLSNFAPCISPEKAEHEALTTRELTRSVFDKENQMVKVDPSYGKFMSCTLLYRGDVSPSQVYLSLMELKSCRGIEFVDWCPTGFKVGISSSPPVSIVDSRVAQCDKNVVMLANNSAVGQAWQRLTHKFYLLFSKRSFIHWYVGEGMEESEFNDALINMTSLVKDYEEASMDSKTDHTI 528          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 234.958 bits (598), Expect = 9.301e-74
Identity = 102/178 (57.30%), Postives = 136/178 (76.40%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V +A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNSCFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNVAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGID 438          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000049713.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:103046666])

HSP 1 Score: 234.187 bits (596), Expect = 2.286e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000005818.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14650102:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000005818.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.646 bits (592), Expect = 4.717e-73
Identity = 101/178 (56.74%), Postives = 134/178 (75.28%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+L++ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE   D
Sbjct:  246 PYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAD 423          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000030346.1 (tubulin alpha-1B chain [Source:NCBI gene;Acc:111195381])

HSP 1 Score: 233.032 bits (593), Expect = 5.874e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 232.646 bits (592), Expect = 7.124e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 122.479 bits (306), Expect = 1.692e-32
Identity = 51/91 (56.04%), Postives = 68/91 (74.73%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGF 274
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGF
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 1.026e-30
Identity = 49/91 (53.85%), Postives = 66/91 (72.53%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGF 274
            PYPRIHFPL  +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG++ P  V  A+  IK  +++ FVDWCPTGF
Sbjct:  266 PYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 8.299e-20
Identity = 46/175 (26.29%), Postives = 92/175 (52.57%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVG-EGMEECEFTESLYNISALVKDYEE 523
            P+PR+H+ +++  P+ +          + ++    F +ENQ+++VD     +++C+L+ RGNV    V   +  +K   S+ FVDW   G+K G+   PP   P S +A        L N + +   +  +  +F  LY +++ +H +   EGME   FTE+  ++++++++Y +
Sbjct:  292 PFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLK--PSLHFVDWNEEGWKTGLCSVPPVGYPHSLLA--------LANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQ 456          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 83.5741 bits (205), Expect = 1.991e-18
Identity = 40/142 (28.17%), Postives = 76/142 (53.52%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKR 427
            P+PR+HF +  FAP+ S    Q+  L++ ELT+ +F+ +N M   D   GR+++ + +FRG +S   V   +  ++   S  FV+W P   K  +   PP  +  S         T + N++AI + ++R++ +F  ++ ++
Sbjct:  242 PFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMS--------ATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 58.5362 bits (140), Expect = 7.114e-10
Identity = 39/186 (20.97%), Postives = 86/186 (46.24%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEK-AQHEELSIMELTRYVFERENQMMKVDHSFGR-------FMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGM---EECEFTESLYNISALVKDYEEA 526
            P PR+HF +  + P+ + +  A   + +++++ R + + +N M+    S GR       +++   + +G V P  V+ +L  I+  K   F+ W P   ++ ++   P      +++       M+ N ++I   + R   ++  L  + +F+  F  E M   +  EF +S   +  L+ +Y+ A
Sbjct:  257 PTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMV----STGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSG-----LMMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEYQAA 433          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 209.92 bits (533), Expect = 6.217e-65
Identity = 95/183 (51.91%), Postives = 131/183 (71.58%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEE 550
            PYPRIHFPL ++APILS ++A HE  S+ E+T   FE  NQM+K D + G++M+  LL+RG+V    V  A+ ++K  K+++ VDWCPTGFKIGI   PP+ IP S++A   + V ML+NT+AI  AW+R+  KF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL +DY E   D   EE
Sbjct:  262 PYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEE 444          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 206.068 bits (523), Expect = 1.719e-63
Identity = 94/183 (51.37%), Postives = 129/183 (70.49%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEE 550
            PYPRIHFPL +++P+LS  KA HE  S+ E+T   FE  NQM+K D   G++M+  LL+RG+V    V  A+ ++K  K+++ VDWCPTGFKIGI   PPT  P SQ+A   + V ML+NT++I +AW+R+  KF L+Y+KR+FVHW+VGEGMEE EFTE+  +++AL +DY E   D   EE
Sbjct:  262 PYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEE 444          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 108.612 bits (270), Expect = 5.323e-27
Identity = 48/174 (27.59%), Postives = 97/174 (55.75%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEE 523
            P+PR+HF +  +AP+ +        L++ ELT+ +F+ +N M   D   GR+++ +  FRG VS   V   + +++   S  FV+W P   +  +    P  +  +         T + N+++I + ++R+  +F  ++ +++F+HW+  EGM+E EF+E+  N++ LV +Y++
Sbjct:  259 PFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMA--------ATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQ 424          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T4])

HSP 1 Score: 232.646 bits (592), Expect = 3.972e-75
Identity = 100/178 (56.18%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C +L+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  108 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 285          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T3])

HSP 1 Score: 233.032 bits (593), Expect = 8.894e-75
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  141 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 318          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S699])

HSP 1 Score: 233.802 bits (595), Expect = 1.023e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+L++ E+T   FE  NQM+K D   G++M+C LLFRG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLTVAEITTSCFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGLD 438          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 233.417 bits (594), Expect = 1.522e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY0])

HSP 1 Score: 233.417 bits (594), Expect = 1.555e-73
Identity = 101/178 (56.74%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 233.802 bits (595), Expect = 8.498e-75
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LLFRG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  136 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 313          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020049.2 (tubulin alpha-1B chain [Source:NCBI gene;Acc:101159587])

HSP 1 Score: 234.572 bits (597), Expect = 5.837e-74
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  226 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVKRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 403          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020614.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 234.572 bits (597), Expect = 1.669e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LL+RG+V P  V  A+  IK  +SI+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  263 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 440          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 234.187 bits (596), Expect = 1.814e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LLFRG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  261 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 438          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba1c (tubulin alpha-1B chain-like [Source:NCBI gene;Acc:101167538])

HSP 1 Score: 234.187 bits (596), Expect = 2.141e-73
Identity = 102/178 (57.30%), Postives = 135/178 (75.84%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLA +AP++S EKA HE+LS+ E+T   FE  NQM+K D   G++M+C LLFRG+V P  V  A+  IK  ++I+FVDWCPTGFK+GIN  PPT +P   +A+  + V ML+NT+AI +AW RL HKF L+Y+KR+FVHW+VGEGMEE EF+E+  +++AL KDYEE  +D
Sbjct:  267 PYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLFRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVD 444          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000021744.1 (SMESG000021744.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVVDTSAPSAPATNGSLNHDNAGAQGQEYVEVTSSQRGSYEQKDVTKTEGSNEEEKEANKVDSEIETDSKNPVS 772
            PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVVDTSAPSAPATNGSLNHDNAGAQGQEYVEVTSSQRGSYEQKDVTKTEGSNEEEKEANKVDSEIETDSKNPVS
Sbjct:  257 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVVDTSAPSAPATNGSLNHDNAGAQGQEYVEVTSSQRGSYEQKDVTKTEGSNEEEKEANKVDSEIETDSKNPVS 513          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000031184.1 (SMESG000031184.1)

HSP 1 Score: 336.65 bits (862), Expect = 3.249e-111
Identity = 148/178 (83.15%), Postives = 165/178 (92.70%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLANFAP+LS  KA HEEL++ ++TR VFE+ENQMMK+DHSFGRFMSC LL+RG+VSPYHVY+AL EIKRDK+IEFVDWCPTGFK+GIN+CPPT+IP SQI QT+KNVTML NTSAIGQAWQR+THKFYLLYSKRSFVHWF+GEGMEECEFTESLYNISALVKDYEE   D
Sbjct:  242 PYPRIHFPLANFAPVLSAAKAIHEELTVNDITRAVFEKENQMMKIDHSFGRFMSCCLLYRGDVSPYHVYIALNEIKRDKNIEFVDWCPTGFKVGINICPPTSIPESQICQTTKNVTMLANTSAIGQAWQRITHKFYLLYSKRSFVHWFIGEGMEECEFTESLYNISALVKDYEEVIGD 419          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000031184.1 (SMESG000031184.1)

HSP 1 Score: 336.65 bits (862), Expect = 4.175e-111
Identity = 148/178 (83.15%), Postives = 165/178 (92.70%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLANFAP+LS  KA HEEL++ ++TR VFE+ENQMMK+DHSFGRFMSC LL+RG+VSPYHVY+AL EIKRDK+IEFVDWCPTGFK+GIN+CPPT+IP SQI QT+KNVTML NTSAIGQAWQR+THKFYLLYSKRSFVHWF+GEGMEECEFTESLYNISALVKDYEE   D
Sbjct:  242 PYPRIHFPLANFAPVLSAAKAIHEELTVNDITRAVFEKENQMMKIDHSFGRFMSCCLLYRGDVSPYHVYIALNEIKRDKNIEFVDWCPTGFKVGINICPPTSIPESQICQTTKNVTMLANTSAIGQAWQRITHKFYLLYSKRSFVHWFIGEGMEECEFTESLYNISALVKDYEEVIGD 419          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000044805.1 (SMESG000044805.1)

HSP 1 Score: 336.65 bits (862), Expect = 7.543e-111
Identity = 148/178 (83.15%), Postives = 165/178 (92.70%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEAAMD 535
            PYPRIHFPLANFAP+LS  KA HEEL++ ++TR VFE+ENQMMK+DHSFGRFMSC LL+RG+VSPYHVY+AL EIKRDK+IEFVDWCPTGFK+GIN+CPPT+IP SQI QT+KNVTML NTSAIGQAWQR+THKFYLLYSKRSFVHWF+GEGMEECEFTESLYNISALVKDYEE   D
Sbjct:  242 PYPRIHFPLANFAPVLSAAKAIHEELTVNDITRAVFEKENQMMKIDHSFGRFMSCCLLYRGDVSPYHVYIALNEIKRDKNIEFVDWCPTGFKVGINICPPTSIPESQICQTTKNVTMLANTSAIGQAWQRITHKFYLLYSKRSFVHWFIGEGMEECEFTESLYNISALVKDYEEVIGD 419          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000021515.1 (SMESG000021515.1)

HSP 1 Score: 311.997 bits (798), Expect = 8.062e-102
Identity = 142/197 (72.08%), Postives = 166/197 (84.26%), Query Frame = 2
Query:    2 PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFGRFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPPTTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVGEGMEECEFTESLYNISALVKDYEEA-----AMDGKFEEGVVDTSAPS 577
            PYPRIHFPL NFAPI+S  KA H+ELS+ ELT+ VF+R NQMMKVDH +G+FMSC+L FRGNV P+ VYLAL+EIKRD+SIEFVDWCPTGFK+GIN   PTTIP SQ+A+T  NV MLTNTSAIGQAWQRLTH+FYLLYSKRSFVHWF+GEGM+E EFTE+LYNISALVKDYEEA     ++D K E+ ++    P+
Sbjct:  257 PYPRIHFPLCNFAPIISQTKADHQELSVQELTQMVFDRGNQMMKVDHFYGKFMSCALFFRGNVCPHSVYLALSEIKRDQSIEFVDWCPTGFKVGINAISPTTIPESQLAETKTNVAMLTNTSAIGQAWQRLTHRFYLLYSKRSFVHWFIGEGMDETEFTEALYNISALVKDYEEAGENTISVDNKKEDLILKVGKPN 453          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA4A1.895e-7357.30tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA4A2.554e-7357.30tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA1A2.659e-7356.74tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1B4.571e-7357.30tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
TUBA1A1.033e-7256.74tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mec-124.008e-7355.98Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-96.523e-7154.19Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-51.317e-7055.62Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-45.206e-7055.62Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-23.497e-6955.06Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84D9.444e-7456.74gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub85E3.442e-7355.43gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84B7.168e-7356.18gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub67C1.816e-6350.54gene:FBgn0087040 transcript:FBtr0076393[more]
CG77942.515e-4942.49gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l42.213e-7456.74tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba8l21.346e-7357.30tubulin, alpha 8 like 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba21.545e-7357.30tubulin, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
si:ch73-199e17.12.111e-7355.61si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
si:ch73-199e17.13.798e-7355.61si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1b4.144e-7357.30tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b4.144e-7357.30tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b4.144e-7357.30tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b4.144e-7357.30tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
slc2a108.179e-7356.74solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba4a1.753e-7357.30tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba4a2.227e-7357.30tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b3.138e-7357.30tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba1a7.089e-7356.74tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
Tuba3a9.947e-7356.18tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25008|TBA1_HOMAM5.029e-7457.87Tubulin alpha-1 chain OS=Homarus americanus OX=670... [more]
sp|Q94572|TBA3_HOMAM5.623e-7357.87Tubulin alpha-3 chain OS=Homarus americanus OX=670... [more]
sp|Q91060|TBA_NOTVI9.069e-7357.30Tubulin alpha chain OS=Notophthalmus viridescens O... [more]
sp|P06605|TBA3_DROME9.467e-7356.74Tubulin alpha-3 chain OS=Drosophila melanogaster O... [more]
sp|P02552|TBA1_CHICK9.644e-7356.74Tubulin alpha-1 chain (Fragment) OS=Gallus gallus ... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448X0L11.127e-9373.60Tubulin alpha chain OS=Protopolystoma xenopodis OX... [more]
A0A2H1C8T71.276e-8967.03Tubulin alpha chain OS=Fasciola hepatica OX=6192 G... [more]
A0A4E0RB945.180e-8967.03Tubulin alpha chain OS=Fasciola hepatica OX=6192 G... [more]
A0A183AE011.031e-8866.67Tubulin alpha chain OS=Echinostoma caproni OX=2784... [more]
A0A504YKN04.919e-8867.03Tubulin alpha chain OS=Fasciola gigantica OX=46835... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l29.301e-7457.30tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000049713.12.286e-7357.30tubulin alpha-1A chain [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000005818.24.717e-7356.74pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
ENSAMXT00000030346.15.874e-7356.74tubulin alpha-1B chain [Source:NCBI gene;Acc:11119... [more]
tuba1a7.124e-7356.74tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C1.692e-3256.04tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.026e-3053.85pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
ENSPMAT00000001368.18.299e-2026.29pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubb21.991e-1828.17tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
tubg17.114e-1020.97tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TUB36.217e-6551.91Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB11.719e-6351.37Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB25.323e-2727.59Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO293793.972e-7556.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293788.894e-7556.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407801.023e-7356.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380671.522e-7356.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380911.555e-7356.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1c8.498e-7557.30tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000020049.25.837e-7457.30tubulin alpha-1B chain [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000020614.21.669e-7357.30tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
tuba1c1.814e-7357.30tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
tuba1c2.141e-7357.30tubulin alpha-1B chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021744.10.000e+0100.00SMESG000021744.1[more]
SMESG000031184.13.249e-11183.15SMESG000031184.1[more]
SMESG000031184.14.175e-11183.15SMESG000031184.1[more]
SMESG000044805.17.543e-11183.15SMESG000044805.1[more]
SMESG000021515.18.062e-10272.08SMESG000021515.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006196 ID=SMED30006196|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=979bp
TCCATATCCAAGAATTCATTTTCCATTAGCTAATTTTGCTCCAATTTTAT
CACCTGAAAAAGCTCAACACGAAGAATTATCTATTATGGAACTTACCAGA
TACGTTTTTGAAAGGGAAAATCAAATGATGAAAGTTGATCATTCTTTTGG
TCGATTTATGTCATGCAGTTTACTTTTTAGAGGAAATGTGAGTCCTTATC
ATGTTTACTTAGCGTTAACTGAAATTAAAAGAGATAAAAGCATAGAATTT
GTTGATTGGTGTCCCACGGGATTTAAAATTGGTATAAATGTTTGCCCACC
AACAACTATTCCATGCAGTCAAATAGCTCAAACGTCGAAAAATGTAACAA
TGTTGACAAATACTTCAGCTATTGGACAAGCGTGGCAAAGATTGACACAT
AAATTTTATCTATTATATTCTAAAAGATCTTTTGTGCATTGGTTTGTTGG
CGAAGGAATGGAGGAATGTGAATTTACAGAATCTCTTTATAACATAAGTG
CGTTAGTGAAAGATTACGAAGAAGCAGCAATGGATGGTAAATTTGAAGAA
GGAGTGGTTGATACCTCTGCTCCAAGTGCTCCAGCTACTAATGGAAGTCT
AAATCATGATAATGCTGGTGCACAAGGACAAGAATATGTCGAGGTTACTT
CAAGCCAGAGGGGCAGTTATGAGCAAAAAGACGTTACCAAAACCGAGGGT
TCAAATGAAGAAGAAAAAGAAGCAAATAAAGTTGATTCAGAAATAGAAAC
AGATAGCAAAAATCCTGTAAGCGAAACAAGAGCTGAAGAAATTGAAACAG
AAAAAGAACAAAATGAAGAAGAGGGAGAAAGTGAAAATAAAGAAGAAAAT
GCGGAAGAAAATGTAGAAGAAAATGTAGAGGAAAATGCAGAGGAAACTGC
AGATGAGAATGAAGATAATGCACAAGAAACTGAAGAAGGGGGAGGAGGAG
AAGAGGAAGCTGAAGAAGCTGAAGAAGCC
back to top

protein sequence of SMED30006196-orf-1

>SMED30006196-orf-1 ID=SMED30006196-orf-1|Name=SMED30006196-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
PYPRIHFPLANFAPILSPEKAQHEELSIMELTRYVFERENQMMKVDHSFG
RFMSCSLLFRGNVSPYHVYLALTEIKRDKSIEFVDWCPTGFKIGINVCPP
TTIPCSQIAQTSKNVTMLTNTSAIGQAWQRLTHKFYLLYSKRSFVHWFVG
EGMEECEFTESLYNISALVKDYEEAAMDGKFEEGVVDTSAPSAPATNGSL
NHDNAGAQGQEYVEVTSSQRGSYEQKDVTKTEGSNEEEKEANKVDSEIET
DSKNPVSETRAEEIETEKEQNEEEGESENKEENAEENVEENVEENAEETA
DENEDNAQETEEGGGGEEEAEEAEEA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR008280Tub_FtsZ_C
IPR002452Alpha_tubulin
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0000166nucleotide binding
GO:0003924GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 261..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 225..266
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 213..326
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..326
NoneNo IPR availablePANTHERPTHR11588:SF304AT04270P-RELATEDcoord: 1..182
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 14..29
score: 54.31
coord: 100..119
score: 31.34
coord: 125..141
score: 50.47
coord: 61..82
score: 35.6
coord: 87..100
score: 77.01
coord: 162..178
score: 43.45
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 1..133
e-value: 5.9E-9
score: 45.8
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 3..132
e-value: 9.3E-36
score: 122.8
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 9..123
e-value: 6.2E-41
score: 140.9
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 124..177
e-value: 3.0E-23
score: 83.1
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..182
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 1..176