SMED30006193

Overview
NameSMED30006193
Smed IDSMED30006193
Length (bp)917
Neoblast Clusters

Zeng et. al., 2018



▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006193 (SMED30006193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006193 (SMED30006193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top

 

Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30006193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 72

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006193h1SMcG0020223 SmedASXL_023006SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
head regionSMED30006193h1SMcG0020223 SmedASXL_003310SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016		whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig45334uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig45334newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig15727uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig15727newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig18341newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig18341uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig20965newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig20965uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig38190uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig38190newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig10023newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig10023uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig9118newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig9118uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig45585newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig45585uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig7809newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig7809uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig48632newmark_estsPMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006193h1SMcG0020223 Contig48632uc_Smed_v2PMID:29674431
Fincher et al., 2018		FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30006193h1SMcG0020223 dd_Smed_v4_3767_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30006193h1SMcG0020223 dd_Smed_v4_655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006193h1SMcG0020223 dd_Smed_v6_655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017		whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30006193h1SMcG0020223 dd_Smed_v6_655_0dd_Smed_v6PMID:29674432
Plass et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30006193h1SMcG0020223 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30006193h1SMcG0020223 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006193h1SMcG0020223 Contig20965newmark_estsPMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30006193h1SMcG0020223 Contig20965uc_Smed_v2PMID:28434803
Rouhana et al., 2017		whole organism adult hermaphrodite RNA-sequencing evidence
non-ciliated epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_19738_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017		whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017		whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017		whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30006193h1SMcG0020223 dd_Smed_v4_1205_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017		whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006193h1SMcG0020223 SMED_02081_V2_1rGPL14150PMID:22385657
Wagner et al., 2012		whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006193 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004116:40170..41086 -4558
Homology
[Close]
BLAST of SMED30006193 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.231e-153
Identity = 261/267 (97.75%), Postives = 264/267 (98.88%), Query Frame = 1 
Query:   55 QNHNQSLICLSIPFEKRLDXXXXXXXXXXXXXXXXXYFLSQSTFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIXXXXXXXXXXXXXFLHVETVWDEMIGESVLKVN 855
            +NHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQS FPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNN+ILKFSDAISLELINPSSVILSISNERNMV PVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLK +
Sbjct: 4307 ENHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQSAFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNSILKFSDAISLELINPSSVILSISNERNMVCPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLKAD 4573
[Close]
BLAST of SMED30006193 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.231e-153
Identity = 261/267 (97.75%), Postives = 264/267 (98.88%), Query Frame = 1 
Query:   55 QNHNQSLICLSIPFEKRLDXXXXXXXXXXXXXXXXXYFLSQSTFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIXXXXXXXXXXXXXFLHVETVWDEMIGESVLKVN 855
            +NHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQS FPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNN+ILKFSDAISLELINPSSVILSISNERNMV PVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLK +
Sbjct: 4310 ENHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQSAFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNSILKFSDAISLELINPSSVILSISNERNMVCPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLKAD 4576
[Close]
BLAST of SMED30006193 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.231e-153
Identity = 261/267 (97.75%), Postives = 264/267 (98.88%), Query Frame = 1 
Query:   55 QNHNQSLICLSIPFEKRLDXXXXXXXXXXXXXXXXXYFLSQSTFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIXXXXXXXXXXXXXFLHVETVWDEMIGESVLKVN 855
            +NHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQS FPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNN+ILKFSDAISLELINPSSVILSISNERNMV PVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLK +
Sbjct: 4318 ENHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQSAFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNSILKFSDAISLELINPSSVILSISNERNMVCPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLKAD 4584
[Close]
BLAST of SMED30006193 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 474.552 bits (1220), Expect = 4.232e-153
Identity = 261/267 (97.75%), Postives = 264/267 (98.88%), Query Frame = 1 
Query:   55 QNHNQSLICLSIPFEKRLDXXXXXXXXXXXXXXXXXYFLSQSTFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIXXXXXXXXXXXXXFLHVETVWDEMIGESVLKVN 855
            +NHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQS FPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNN+ILKFSDAISLELINPSSVILSISNERNMV PVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLK +
Sbjct: 4330 ENHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQSAFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNSILKFSDAISLELINPSSVILSISNERNMVCPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLKAD 4596
[Close]
BLAST of SMED30006193 vs. Planmine SMEST
Match: SMESG000043809.1 (SMESG000043809.1)

HSP 1 Score: 474.552 bits (1220), Expect = 5.036e-153
Identity = 261/267 (97.75%), Postives = 264/267 (98.88%), Query Frame = 1 
Query:   55 QNHNQSLICLSIPFEKRLDXXXXXXXXXXXXXXXXXYFLSQSTFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIXXXXXXXXXXXXXFLHVETVWDEMIGESVLKVN 855
            +NHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQS FPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNN+ILKFSDAISLELINPSSVILSISNERNMV PVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLK +
Sbjct: 4319 ENHNQSLICLSIPFEKRLDLSPFISSSFPLSKSKVSYFLSQSAFPSTFLPYLFDSSDIPTNISRSFSYEPPKTVLFPFLSFSNPSMEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSVNNSILKFSDAISLELINPSSVILSISNERNMVCPVNLSQALVDDIVDLNHGLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLISSVPKKTSISSSKFLHVETVWDEMIGESVLKAD 4585
The following BLAST results are available for this feature:
BLAST of SMED30006193 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006193 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043809.14.231e-15397.75SMESG000043809.1[more]
SMESG000043809.14.231e-15397.75SMESG000043809.1[more]
SMESG000043809.14.231e-15397.75SMESG000043809.1[more]
SMESG000043809.14.232e-15397.75SMESG000043809.1[more]
SMESG000043809.15.036e-15397.75SMESG000043809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006193 ID=SMED30006193|Name=SMED30006193|organism=Schmidtea mediterranea sexual|type=transcript|length=917bp
AGAAGTAAGTTATTTTATTTCGATTAGCTGTGCTGTTTGACCCTATGCTT
TACTCAGAATCATAATCAATCTCTTATTTGTCTTTCCATTCCCTTCGAGA
AACGCTTAGATCTGTCACCATTTATTTCTTCATCTTTTCCTCTCTCCAAA
TCTAAAGTCTCTTATTTTCTCTCTCAATCTACTTTTCCATCTACTTTTTT
GCCTTATTTATTTGACTCATCCGATATTCCCACAAATATTTCTCGTTCTT
TTTCCTACGAACCTCCTAAAACTGTCCTTTTCCCGTTTCTTTCATTTTCA
AATCCCTCTATGGAGTTTGATTTAATGTTCACTAGCCAATATGACGACCC
TGTAGAAGATTCTATCTGTCCTCCGCTTATTAATACTTTTTCCGTTGAAT
CATTCGGTAATGTTAACAATTCTTCCGATCCATTGTTTTTGTTTGTTTTT
TCTTCTGTCAATAATGCTATATTGAAATTTTCTGACGCCATTTCATTAGA
GCTTATTAACCCTTCGTCTGTGATACTCTCTATTTCGAATGAACGTAATA
TGGTTTACCCCGTCAATCTATCCCAAGCATTGGTTGACGACATCGTCGAT
CTTAATCACGGTTTGATATTTCTTCCAAACGGAGATGGTATAAGTCTGAT
GAATCTTTTTACGAATGGTTGCATTATCGGTCTTGATAAGTCTCTGGAAT
TGCGAATGCTTTCTTTGGCTGAAACAACTAATTATGTCAATATGTCTTCT
TTGATTTCTTCTGTTCCGAAAAAGACTTCCATTTCTTCTTCTAAATTTCT
ACACGTTGAAACGGTTTGGGATGAAATGATTGGTGAATCAGTGCTAAAGG
TAAATTTGAATGTTGTCCACGATATTTTGAATCGCATGTTTTGTGCTGTC
ACAGTTGTTGATTTTCC
back to top

protein sequence of SMED30006193-orf-1

>SMED30006193-orf-1 ID=SMED30006193-orf-1|Name=SMED30006193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=202bp
MEFDLMFTSQYDDPVEDSICPPLINTFSVESFGNVNNSSDPLFLFVFSSV
NNAILKFSDAISLELINPSSVILSISNERNMVYPVNLSQALVDDIVDLNH
GLIFLPNGDGISLMNLFTNGCIIGLDKSLELRMLSLAETTNYVNMSSLIS
SVPKKTSISSSKFLHVETVWDEMIGESVLKVNLNVVHDILNRMFCAVTVV
DF
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002063non-ciliated epidermis