Fibrillar collagen NC1 domain-containing protein

Overview
NameFibrillar collagen NC1 domain-containing protein
Smed IDSMED30006180
Length (bp)4084
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibrillar collagen NC1 domain-containing protein (SMED30006180) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30006180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibrillar collagen NC1 domain-containing protein (SMED30006180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibrillar collagen NC1 domain-containing protein (SMED30006180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006180SMESG000031448.1 Contig39853uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006180SMESG000031448.1 Contig39853newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006180SMESG000031448.1 Contig35278uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006180SMESG000031448.1 Contig35278newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30006180SMESG000031448.1 dd_Smed_v6_702_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30006180SMESG000031448.1 dd_Smed_v6_702_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30006180SMESG000031448.1 dd_Smed_v4_702_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL5A3 (collagen type V alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:14864])

HSP 1 Score: 129.413 bits (324), Expect = 2.994e-29
Identity = 64/227 (28.19%), Postives = 101/227 (44.49%), Query Frame = 2
Query: 3320 LAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISE-QKTCIKPINNE--ISLRSWKSHSANGHTWLKSILNKEEIQYSIPNG------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTH-SHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            L +  L    ++ P GT E P + C +L   HP+LPDGEYWIDPN G   D+ +V+C  +   +TC+ P      + L SW      G  W  +    ++  Y   +G      Q+ FLK+ S +A Q  T++C+N     +E   +   + R L  +   +     +    +V +D C+  K           + A  LP+ D+  +       KFG  +  VCFS
Sbjct: 1520 LTSLSLELEQLRRPPGTAERPGLVCHELHRNHPHLPDGEYWIDPNQGCARDSFRVFCNFTAGGETCLYPDKKFEIVKLASWSKEKPGG--WYSTFRRGKKFSYVDADGSPVNVVQLNFLKLLSATARQNFTYSCQNAAAWLDEATGDYSHSARFLGTNGEELSFNQTTAATVSVPQDGCRLRKGQTKTLFEFSSSRAGFLPLWDVAATDFGQTNQKFGFELGPVCFS 1744          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 124.79 bits (312), Expect = 5.497e-28
Identity = 74/223 (33.18%), Postives = 112/223 (50.22%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW-KSHSANGHTWLKSILNK-EEIQYSIPN-------GQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDT-IIKMTHSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+    PEG+++ PA TC+ L + HP    G YWIDPN G   DA+KVYC  S  +TCI+     I  ++W +S     H WL   +N   + +Y++          Q+AF+++ ++ A Q +T+ C+N     +EE  N   A  L   +D  ++   +S   YTV+ D C    +   ++IIE + N  + LP  DI    I     +F V I  VCF
Sbjct: 1141 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1363          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL1A2 (collagen type I alpha 2 chain [Source:HGNC Symbol;Acc:HGNC:2198])

HSP 1 Score: 124.79 bits (312), Expect = 6.303e-28
Identity = 74/223 (33.18%), Postives = 112/223 (50.22%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW-KSHSANGHTWLKSILNK-EEIQYSIPN-------GQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDT-IIKMTHSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+    PEG+++ PA TC+ L + HP    G YWIDPN G   DA+KVYC  S  +TCI+     I  ++W +S     H WL   +N   + +Y++          Q+AF+++ ++ A Q +T+ C+N     +EE  N   A  L   +D  ++   +S   YTV+ D C    +   ++IIE + N  + LP  DI    I     +F V I  VCF
Sbjct: 1143 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCF 1365          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 120.168 bits (300), Expect = 1.544e-26
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA--NGHTWLKSILN--------KEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++PEG+++ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P    +  ++W S  +    H W    +N         + +  +  N Q+ FL++ S    Q +T+ C+N     +E   N   A  +   +D  I+   +S   YT +KD C        +++IE R+   + LPI DI    I   + +FGV I  VCF
Sbjct: 1268 SIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1486          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Match: COL2A1 (collagen type II alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2200])

HSP 1 Score: 119.783 bits (299), Expect = 2.335e-26
Identity = 68/219 (31.05%), Postives = 109/219 (49.77%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA--NGHTWLKSILN--------KEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++PEG+++ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P    +  ++W S  +    H W    +N         + +  +  N Q+ FL++ S    Q +T+ C+N     +E   N   A  +   +D  I+   +S   YT +KD C        +++IE R+   + LPI DI    I   + +FGV I  VCF
Sbjct: 1199 SIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKKNWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCF 1417          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col5a3a (collagen, type V, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-030131-968])

HSP 1 Score: 131.724 bits (330), Expect = 3.453e-30
Identity = 67/216 (31.02%), Postives = 103/216 (47.69%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRIS-EQKTCIKPIN--NEISLRSWKSHSANGHTWLKSILNKEEIQY------SIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            ++ P GT E PA TCK+L + HP+  DGEYWIDPN G   D+++V+C  + E +TC+ P      + L +W        +W       ++  Y       +P  Q+ FLK+ S +A+Q  TF+C+N     +    N   A R    +D  +    S    T + D CQ  K  +   +      + LLP+ D+ +S   +   KFG  +  VCFS
Sbjct: 1674 MRKPLGTFESPARTCKELMLCHPDYKDGEYWIDPNQGCHRDSIRVFCNFTAEGETCLHPDKRFETVKLAAWNKEKPG--SWYSQYRKGKQFSYIDTEGNPVPVVQMTFLKLLSATAMQTFTFSCQNSIGWYDMSNHNHQHALRFRGSNDEEMTQDKSPF-ITALYDGCQTRKGLDTTVLQINSPRSELLPLIDVAISDFGSNNQKFGFHVGTVCFS 1886          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 128.257 bits (321), Expect = 3.452e-29
Identity = 74/224 (33.04%), Postives = 113/224 (50.45%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW-KSHSANGHTWLKSILNK-EEIQY--------SIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            N  I+N   PEG+K+ PA TC+ + + HP    G YWIDPN G   DA+K +C  S  +TCI P    I  ++W +S     HTW    +N   E  Y        S+   Q+AF+++ ++ AVQ +T+ C+N     + E  N   A  L   +D  ++   +S   ++V++D C       ++++IE R N  + LPI DI    I     +FG+ I  VCF
Sbjct: 1129 NTQIENLLSPEGSKKNPARTCRDIRLSHPEWSSGFYWIDPNQGCTMDAIKAFCDFSTGQTCIHPHPESIPRKNWYRSSQEKKHTWFGETINSGTEFAYNDETLSPQSMAT-QLAFMRLLANQAVQNITYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCSRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1351          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col5a2b (collagen, type V, alpha 2b [Source:ZFIN;Acc:ZDB-GENE-110406-2])

HSP 1 Score: 127.102 bits (318), Expect = 7.665e-29
Identity = 75/222 (33.78%), Postives = 113/222 (50.90%), Query Frame = 2
Query: 3344 NAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRS--WKSHSANGH-TWLKSILNK--------EEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSH-LKYTVIKDECQYSKSSEAESIIEVRNYA-NLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            +++++P+GT++ PA TC+ L   +P    G+YWIDPN G   DA++VYC +   +TCI P N     R   W S S+N    W  + +N+        +E   +  + Q+ FL++ S  A Q VT+ C+N     +E+  N   A  L A D   IK  +S+ LKYTV  D C         ++ E R    + LPI D+    +  R  +FG+ I  VCFS
Sbjct: 1279 DSMRSPDGTRQYPARTCQDLKQCYPLKKSGDYWIDPNEGSTRDAIQVYCNMEMGETCI-PANPASVPRKNWWTSQSSNQKPVWFGATMNRGTKFTYGNKEASANAVSVQLRFLRLLSKEASQSVTYHCKNTVAYKDEKNSNLKKALILKASDGQDIKAYNSNRLKYTVTADGCSKPNGEWGRTVFEYRTQTLSRLPIVDLAAVDVGGRDQEFGIDIGHVCFS 1499          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 126.331 bits (316), Expect = 1.332e-28
Identity = 68/219 (31.05%), Postives = 110/219 (50.23%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW--KSHSANGHTWLKSILNKEEIQYSIPNG---------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I++P+G+++ PA +C+ L + HP    G+YW+DPN G   DA+KV+C +   +TC+KP   +I  ++W      A  H W    +N     +S  +G         Q+ FL++ S  A Q +T+ C+N     ++   N   A  L   +D  I+   +S   Y V++D C+      A+++IE +    + LPI DI    I     +FGV I  VCF
Sbjct: 1135 IRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNG-GFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGADQEFGVDIGAVCF 1352          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 126.331 bits (316), Expect = 1.439e-28
Identity = 68/219 (31.05%), Postives = 110/219 (50.23%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW--KSHSANGHTWLKSILNKEEIQYSIPNG---------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I++P+G+++ PA +C+ L + HP    G+YW+DPN G   DA+KV+C +   +TC+KP   +I  ++W      A  H W    +N     +S  +G         Q+ FL++ S  A Q +T+ C+N     ++   N   A  L   +D  I+   +S   Y V++D C+      A+++IE +    + LPI DI    I     +FGV I  VCF
Sbjct: 1207 IRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNMETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNG-GFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGADQEFGVDIGAVCF 1424          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col3a1 (collagen, type III, alpha 1 (Ehlers-Danlos syndrome type IV, autosomal dominant) [Source:NCBI gene;Acc:100124865])

HSP 1 Score: 139.813 bits (351), Expect = 1.492e-32
Identity = 77/254 (30.31%), Postives = 121/254 (47.64%), Query Frame = 2
Query: 3281 RSPTKGVTYGDDPL-----AAELLG-----NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSAN--GHTWLKSILN--------KEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            + P     YGD  L     A+E++      NN I+N   P+G+++ PA  C+ L   HP L  GEYWIDPN G   DA+KV+C +   +TC+      +  ++W + S N   H W    +N          E+   +   Q+AFL++ S  A Q +T+ C+N     + E  N   + + ++  ++ +K   +S   YTV++D C        +++ E R   A  LPI DI    I     +FGV +  VCF
Sbjct: 1214 KGPAGSPYYGDQALDGSISASEIMSSLKTINNQIENIISPDGSRKNPARNCRDLKFCHPELKSGEYWIDPNQGCKMDAIKVFCNMETGETCVNANPIGVPRKNWYTASGNVKKHIWFGESMNGGFQFGYGDAELPEDVSEVQMAFLRILSSRASQNITYHCKNSIAYMDGENGNVKKSLKFMSSTESELKAEGNSKFTYTVLEDGCTKHTGEWGKTVFEYRTRKAMRLPIVDIAPMDIGGPDQEFGVDVGPVCF 1467          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 126.331 bits (316), Expect = 1.637e-28
Identity = 75/221 (33.94%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct:  816 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1034          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 125.946 bits (315), Expect = 1.816e-28
Identity = 75/221 (33.94%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct:  849 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1067          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 126.331 bits (316), Expect = 1.842e-28
Identity = 75/221 (33.94%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct: 1273 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Match: col2a1 (collagen, type II, alpha 1 [Source:NCBI gene;Acc:394828])

HSP 1 Score: 126.331 bits (316), Expect = 2.101e-28
Identity = 75/221 (33.94%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct: 1203 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1421          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col3a1 (collagen, type III, alpha 1 [Source:MGI Symbol;Acc:MGI:88453])

HSP 1 Score: 132.494 bits (332), Expect = 2.159e-30
Identity = 72/246 (29.27%), Postives = 117/246 (47.56%), Query Frame = 2
Query: 3305 YGDDPL-----AAELLGN--------NAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA--NGHTWLKSILN-KEEIQYSIP-------NGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            YGDDP+       E++ +         ++ +P+G+++ PA  C+ L   HP L  GEYW+DPN G   DA+KV+C +   +TCI      +  + W + S     H W    +N   +  Y  P       + Q+AFL++ S  A Q +T+ C+N     ++   N   + +L+  ++   K   +S   YTV++D C       ++++ E +   A  LPI DI    I     +FGV I  VCF
Sbjct: 1218 YGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAEKKHVWFGESMNGGFQFSYGPPDLPEDVVDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPIIDIAPYDIGGPDQEFGVDIGPVCF 1463          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col5a2 (collagen, type V, alpha 2 [Source:MGI Symbol;Acc:MGI:88458])

HSP 1 Score: 120.939 bits (302), Expect = 6.562e-27
Identity = 73/218 (33.49%), Postives = 109/218 (50.00%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA--NGHTWLKSILNKEEI----QYSIPN---GQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHS-HLKYTVIKDECQYSKSSEAESIIEVR--NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +++P+G+K+ PA TC  L + HP    GEYWIDPN G   DA+KVYC +   +TCI      +  ++W +  +  N   W    +N+        Y  PN    Q+ FL++ S  A Q +T+ C N     +++  N   A  L   +D  IK   +   +YTV++D C     +  ++I E R  N A  LPI D+G   I N   +FG+ I  VCF
Sbjct: 1280 MRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWYGLDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVAR-LPIIDVGPVDIGNADQEFGLDIGPVCF 1496          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col1a2 (collagen, type I, alpha 2 [Source:MGI Symbol;Acc:MGI:88468])

HSP 1 Score: 119.398 bits (298), Expect = 1.846e-26
Identity = 75/227 (33.04%), Postives = 116/227 (51.10%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCI--KPINNEISLRSWKSHSANGHTWLKSILN-KEEIQYSIPN-------GQIAFLKVNSDSAVQRVTFTCENHPIIGNEE--KLNKVTAPRLL--ADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+    PEG+++ PA TC+ L + HP      YWIDPN G   DA+KVYC  S  +TCI  +P+N   +  S+    AN H WL   +N   + +Y++          Q+AF+++ ++ A Q +T+ C+N     +EE   LNK     LL  ++D  ++   +S   Y+V+ D C    +   ++IIE + N  + LP  DI    I     +F V +  VCF
Sbjct: 1149 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVYCDFSTGETCIQAQPVNTP-AKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQLAFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAV---LLQGSNDVELVAEGNSRFTYSVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCF 1371          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 119.013 bits (297), Expect = 2.537e-26
Identity = 67/220 (30.45%), Postives = 109/220 (49.55%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA--NGHTWLKSILNKEEIQYSIPNG---------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+G+++ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P    +  ++W S  +    H W    +N     +S  +G         Q+ FL++ S    Q +T+ C+N     +E   N   A  +   +D  ++   +S   YT +KD C        +++IE R+   + LPI DI    I   + +FGV I  VCF
Sbjct: 1268 SIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNG-GFHFSYGDGNLAPNTANVQMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCF 1486          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Match: Col5a3 (collagen, type V, alpha 3 [Source:MGI Symbol;Acc:MGI:1858212])

HSP 1 Score: 118.627 bits (296), Expect = 3.528e-26
Identity = 67/219 (30.59%), Postives = 106/219 (48.40%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISE-QKTCIKPIN--NEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNG------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLA---DDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            ++ P GT E P + C++L   HP+LPDGEYWIDPN G   DA KV+C  +   +TC+ P      + L SW      G  W  +    ++  Y   +G      Q+ FLK+ S +A QR T+ C+N     +E   +   + R      ++ +  + T + +K  V  D C+  K  +A+++ E  +    LP+ D+  S       KFG  +  +CFS
Sbjct: 1525 LQRPLGTAESPGLMCRELHRDHPHLPDGEYWIDPNQGCARDAFKVFCNFTAGGETCLYPDKKFETVKLASWSREKPGG--WYSTFRRGKKFSYVDADGSPVNVVQLTFLKLLSAAAHQRFTYICQNSVAWLDEAAGDHRHSIRFQGTNWEELSFNQTTAATIK--VSHDGCRVRK-GQAKTLFEFSSSVGFLPLWDVAASDFGQTNQKFGFELGSICFS 1738          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|P02465|CO1A2_BOVIN (Collagen alpha-2(I) chain OS=Bos taurus OX=9913 GN=COL1A2 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 1.785e-33
Identity = 82/249 (32.93%), Postives = 125/249 (50.20%), Query Frame = 2
Query: 3269 AMQMRSPT--KGVTYGDDPLAAELLGNNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHS-ANGHTWLKSILN-KEEIQYSIPN-------GQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDT-IIKMTHSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            A Q RSPT  +   Y  D     L  NN I+    PEG+++ PA TC+ L + HP    G YWIDPN G   DA+KVYC  S  +TCI+    +I +++W  +S A  H W+   +N   + +Y++          Q+AF+++ ++ A Q +T+ C+N     +EE  N   A  L   +D  ++   +S   YTV+ D C    +   ++IIE + N  + LPI DI    I     +  + I  VCF
Sbjct: 1117 ADQPRSPTSLRPKDYEVDATLKSL--NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNIGPVCF 1363          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28668|CO1A2_RABIT (Collagen alpha-2(I) chain (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=COL1A2 PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 8.657e-30
Identity = 76/223 (34.08%), Postives = 115/223 (51.57%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW-KSHSANGHTWLKSILN-KEEIQYSIPN-------GQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDT-IIKMTHSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+    PEG+++ PA TC+ L + HP    G YWIDPN G   DA+KVYC  S  +TCI+     IS+++W KS  A  H WL   +N   + +Y++          Q+AF+++ ++ A Q +T+ C+N     +EE  N   A  L   +D  ++   +S   YTV+ D C    +   ++IIE + N  + LP  DI    I     +F V +  VCF
Sbjct:  303 NNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENISVKNWYKSSKAKKHVWLGETINGGTQFEYNVEGVTSKEMATQLAFMRLLANHASQNITYHCKNSIAYMDEETGNLNKAVILQGSNDVELVAEGNSRFTYTVLVDGCTKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFYVDVGPVCF 525          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|O93484|CO1A2_ONCMY (Collagen alpha-2(I) chain OS=Oncorhynchus mykiss OX=8022 GN=col1a2 PE=2 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 4.937e-28
Identity = 74/224 (33.04%), Postives = 113/224 (50.45%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSAN-GHTWLKSILN-KEEIQY--------SIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            N+ I+N   PEG+K+ PA TC+ + + HP+   G YWIDPN G + DA+K YC  S   TCI P    I+ ++W   S N  H W    +N   E  Y        S+   Q+AF+++ ++ A Q +T+ C+N     + E  N   A  L   +D  ++   +S   + V++D C       ++++IE R N  + LPI DI    I     +FG+ I  VCF
Sbjct: 1133 NSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDFSTGHTCIHPHPESIARKNWYRSSENKKHVWFGETINGGTEFAYNDETLSPQSMAT-QLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAVLLQGSNDVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEFGLDIGPVCF 1355          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P4Z2|CO2A1_XENTR (Collagen alpha-1(II) chain OS=Xenopus tropicalis OX=8364 GN=col2a1 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 9.761e-28
Identity = 75/221 (33.94%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct: 1273 SIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCNMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDATQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1491          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91717|CO2A1_XENLA (Collagen alpha-1(II) chain OS=Xenopus laevis OX=8355 GN=col2a1 PE=2 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 1.579e-27
Identity = 78/226 (34.51%), Postives = 114/226 (50.44%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG----HTWLKSILNKE-EIQY----SIPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+N   P+GTK+ PA TC+ L + HP    G+YWIDPN G   DA+KV+C +   +TC+ P  ++I  ++W   SA G    H W    +N   +  Y    S PN    Q+ FL++ S  A Q +T+ C+N     +E   N   A  L   +D  I+   +S   Y  ++D C+      ++++IE R    + LPI DI    I     +FGV I  VCF
Sbjct: 1262 NNQIENIRSPDGTKKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTVDAIKVFCDMETGETCVYPNPSKIPKKNW--WSAKGKEKKHIWFGETINGGFQFSYGDDSSAPNTANIQMTFLRLLSTDASQNITYHCKNSIAFMDEASGNLKKAVLLQGSNDVEIRAEGNSRFTYNALEDGCKKHTGKWSKTVIEYRTQKTSRLPIVDIAPMDIGGADQEFGVDIGPVCF 1485          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A4D6FZG2 (Collagen F-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=colF-2 PE=2 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 3.063e-149
Identity = 266/267 (99.63%), Postives = 266/267 (99.63%), Query Frame = 2
Query: 3107 LQGPVGIIGPRGDPGISGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIG 3907
            LQGPVGIIGPRGDPGI GPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIG
Sbjct:   14 LQGPVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIG 280          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A0R3SQ85 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7214 PE=4 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 4.568e-57
Identity = 101/230 (43.91%), Postives = 138/230 (60.00%), Query Frame = 2
Query: 3281 RSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            RSPTKG+ YGDDP AA + G N++K P GT+EVPA TC QL+   PNLPDG+YW+DPNGGR +DAV+VYCRI   ++CI P      + SW+    N   W +SI    E  Y+I   Q+AFLKV S  A Q +  +C+            K   P LLADDD ++ MTH   ++T+ +++C   + SE  +++E++   + LP+RDI         S FGV + EVCFS
Sbjct: 1018 RSPTKGLLYGDDPKAARIFGMNSVKFPRGTQEVPARTCAQLATNFPNLPDGKYWLDPNGGRTHDAVQVYCRIKTGESCI-PAKKSFPVSSWRVPDKNSSVWFQSINQFGEFDYAIDPDQLAFLKVFSSRASQTLQLSCQGL--------SEKTIVPELLADDDIVLSMTHPKRRFTIKENQC--GRVSEGSTVVEIKTRPSRLPLRDI---KFTPSVSAFGVQVGEVCFS 1233          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A564YI94 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6644 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 8.142e-57
Identity = 101/230 (43.91%), Postives = 138/230 (60.00%), Query Frame = 2
Query: 3281 RSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            RSPTKG+ YGDDP AA + G N++K P GT+EVPA TC QL+   PNLPDG+YW+DPNGGR +DAV+VYCRI   ++CI P      + SW+    N   W +SI    E  Y+I   Q+AFLKV S  A Q +  +C+            K   P LLADDD ++ MTH   ++T+ +++C   + SE  +++E++   + LP+RDI         S FGV + EVCFS
Sbjct: 1069 RSPTKGLLYGDDPKAARIFGMNSVKFPRGTQEVPARTCAQLATNFPNLPDGKYWLDPNGGRTHDAVQVYCRIKTGESCI-PAKKSFPVSSWRVPDKNSSVWFQSINQFGEFDYAIDPDQLAFLKVFSSRASQTLQLSCQGL--------SEKTIVPELLADDDIVLSMTHPKRRFTIKENQC--GRVSEGSTVVEIKTRPSRLPLRDI---KFTPSVSAFGVQVGEVCFS 1284          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A0R3TLX7 (Fibrillar collagen NC1 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8277 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.040e-55
Identity = 132/288 (45.83%), Postives = 176/288 (61.11%), Query Frame = 2
Query: 3110 QGPVGIIGPRGDPGISGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAMQ-MRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            +GP G  G RG+PG  G  GP G  G  G  G  G  GP GPPGPPGPPG I+++Q  RSPTKG+ YGDDP AA + G N++K P GT+EVPA TC QL+   PNLPDG+YW+DPNGGR +DAV+VYC+I   ++CI P      L SW+  + NG  W +SI    E  Y+I   Q+AFLKV S  A Q +  +C+            +   P LLADDDTI+ MTH   ++T+++ +C    ++E  +++E++   + LP+RDI         S FGV + EVCFS
Sbjct: 1011 RGPQGPPGLRGEPGDMGEQGPIGPSGNDGDPGPAGVQGPPGPPGPPGPPGSIVSVQSRRSPTKGLLYGDDPKAARIFGMNSVKFPRGTQEVPARTCAQLAANFPNLPDGKYWLDPNGGRTHDAVQVYCKIKTGESCI-PAKKSFPLSSWRVPAKNGSVWFQSINQFGEFDYAIDADQLAFLKVFSSRASQILQLSCQGL--------SERSIVPDLLADDDTILSMTHPKRRFTILEQQC--GMTTEGSTVVEIQTRPSRLPLRDI---KFTPSVSAFGVQVGEVCFS 1284          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Match: A0A0R3W1P3 (Fibrillar collagen NC1 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3669 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 3.116e-53
Identity = 99/236 (41.95%), Postives = 137/236 (58.05%), Query Frame = 2
Query: 3266 MAMQMR-SPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            M++Q R +PTKG+ YGDDP AA L G N+IK P GT+EVPA TC QL+   PN PDG YW+DPNGGR NDAV+VYC+I   ++CI+       +R W   S N   W ++     E  Y+I   Q+AFLKV S  A Q +  +C+                P LLADDDTI+ M H   ++ + ++ C   + SE  +++++++  + LP+RDI         S FGV + EVCFS
Sbjct: 1061 MSIQARRAPTKGLLYGDDPRAARLFGMNSIKFPRGTQEVPARTCAQLAAHFPNYPDGSYWLDPNGGRTNDAVEVYCKIKTGESCIR-AKQSFPVRKWGLPSTNSSVWFQTYNQFGEFDYAIDADQLAFLKVFSSRATQTLQLSCQGL--------SESAIMPELLADDDTILTMMHPKRRFELKENLC--GQISEGSTVVQIQSKPSRLPLRDI---KFTPSVSAFGVQVGEVCFS 1282          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043273.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:4246717:4253158:1 gene:ENSAMXG00000033238.1 transcript:ENSAMXT00000043273.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 7.038e-27
Identity = 71/229 (31.00%), Postives = 117/229 (51.09%), Query Frame = 2
Query: 3320 LAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKS--HSANGHTWLKSILNK--------EEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNYA-NLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            L +EL   +++++P+G+++ PA TC+ L   +P    G YW+DPN G   DA++VYC +   +TCI    + +  + W S   S     W  + +N+        +E   SI   Q+ FL+++S  A Q +T+ C+N     + +  N   A  L + D   IK   ++ LKYTV +D C  S S   +++ E R+   + LPI D+    +     +FG+ I  VCFS
Sbjct:  108 LGSEL---DSMRSPDGSRQHPARTCQDLKQCYPLKKSGNYWVDPNEGSSKDAIQVYCNMETGETCISANPSSVPRKHWWSSRSSTPKPVWYGATMNRGAKFTYGNQEDSLSIVTIQMRFLRLHSKEAAQTLTYHCKNSIAYKDGKNSNYKKAALLKSADGLEIKAHGNNRLKYTVTEDSCMKSSSEWGKTVFEYRSQKPSRLPIVDMAPVDVGGADQEFGIDIGPVCFS 333          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 118.627 bits (296), Expect = 2.584e-26
Identity = 66/220 (30.00%), Postives = 111/220 (50.45%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW---KSHSANGHTWLKSIL--------NKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I++P+GTK+ PA TC+ L + HP+   GEYWIDP+ G   DA+KVYC +   +TC+ P  ++I  ++W   K+     H W    +          EE +    N Q+ FL++ S  A Q +T+ C+N     ++   N   A  L   ++  I+   +S   Y+V +D C     +  +++I+ +    + LPI DI    +     +FG+ +  VCF
Sbjct: 1215 SIRSPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNMETGETCVYPSQSDIPQKNWYTSKNIKEKKHVWFGEAMTDGFQFEYGGEESKPEDVNIQLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSNEIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEFGIEVGPVCF 1434          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 112.849 bits (281), Expect = 1.345e-24
Identity = 69/218 (31.65%), Postives = 110/218 (50.46%), Query Frame = 2
Query: 3356 NPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW-KSHSANGHTWLKSILN-KEEIQY--------SIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSE--AESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +PEG+K+ PA TC+ + + HP+     YWIDPN G   DA+K +C  S  +TCI      I  ++W +S     H W    +N   E  Y        S+   Q+AF+++ ++ AVQ VT+ C+N     + E  N   A  L   +D  ++   +S   ++V++D C   + +   ++++IE R N  + LPI DI    I     +FG+ I  VCF
Sbjct: 1139 SPEGSKKNPARTCRDIRLSHPDWTS-FYWIDPNQGCTMDAIKAFCDFSTGQTCIHAHPESIPRKNWYRSSQEKKHIWFGETINGGTEFGYNDETLSPQSMAT-QLAFMRLLANQAVQNVTYHCKNSIAYMDAENGNLKKAVLLQGSNDVELRAEGNSRFTFSVLEDGCTLQRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEFGLDIGPVCF 1354          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col1a1b (collagen, type I, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4400])

HSP 1 Score: 111.694 bits (278), Expect = 3.732e-24
Identity = 68/219 (31.05%), Postives = 110/219 (50.23%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW---KSHSANGHTWL-KSILNKEEIQY----SIP---NGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNYANL-LPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I++PEGT++ PA  C+ L + HP      Y++DPN G   DA+KV+C +   +TC++P    + L++W   K+     H W  +S+    + QY    S P   N Q+ F+++ S+ A Q +T+ C+N     ++   N   A  L   +D  I+   +S   YTV +D C     +  +++IE +      LPI DI    I     +FGV +  VCF
Sbjct: 1105 IRSPEGTQKNPARMCRDLRMCHPEWKS-SYFVDPNQGSPLDAIKVFCNMETGETCVQPTRGSVPLKNWYLSKNFREKKHIWFGESMPEGFQFQYGSEGSDPEDVNIQMTFMRLMSNKASQNITYHCKNSIAYMDQASGNLKKALLLQGSNDVEIRAEGNSRSTYTVSEDGCTSHTGTWGKTVIEYQTAKTTRLPIIDIAPMDIGAPDQEFGVEVGAVCF 1322          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Match: col11a2 (collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-000208-23])

HSP 1 Score: 105.916 bits (263), Expect = 5.850e-23
Identity = 65/217 (29.95%), Postives = 104/217 (47.93%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISE-QKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNG------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLN--KVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRN-YANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            A++ P GTK+ PA TC+ L +  P   DGEYWIDPN G   D+ KVYC  +   +TC+ P + E+ + SW        TW        ++ Y   NG      QI FL++ S  A Q +T+ C +     +    N  +     L ++++ I   T+ ++K   + D C Y K  +  +++E+       LP+ D+ ++       KFG  +  VCF
Sbjct:  361 AMRFPLGTKDSPARTCQDLLLSQPEYTDGEYWIDPNQGCTRDSFKVYCNFTAGGETCLYP-SKEVKMNSWPKEKPG--TWYSRFAKGSKMSYVDSNGEPVGVVQIGFLRLLSLQARQNLTYHCHHSVAWADSTSGNGYQRALHFLGSNEEEISYETNPYIK--ALSDGCSYRKGYD-RTVLEINTPQVEQLPLLDMKITDFGENNQKFGFEVGPVCF 571          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003197.1 (pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 gene:ENSPMAG00000002618.1 transcript:ENSPMAT00000003197.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 5.203e-26
Identity = 63/214 (29.44%), Postives = 111/214 (51.87%), Query Frame = 2
Query: 3356 NPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW--KSHSANGHTWLKSILNKEEIQYSIPNG------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRN-YANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +P+G+++ PA TC+ L + +P+LP G YWIDPN G  +DA++V+C +   ++C+   N  I+ ++W  K   +  H W    ++  + Q++          Q+ FL++ S  A Q++T+ C+N     +    N   A  L   ++  I+   +S L Y+V++D C        +++IE R    + LPI DI    +     +FGV +  VCF
Sbjct:  974 SPDGSQKNPARTCRNLKLCYPDLPSGLYWIDPNEGSKSDAIQVWCNMETGESCMNADNPSIARKNWWLKPSGSKKHVWFGVTMSP-DAQFTYGEDSHSTEIQLTFLRLFSTEASQKITYHCKNSVAYQDGAVGNLQQALLLQGSNEMEIRAEGNSKLAYSVLEDGCTMHTGQWGKTVIEYRTPKTSRLPIVDIAPKDVGGPDQEFGVDVGPVCF 1186          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.849 bits (281), Expect = 2.541e-25
Identity = 65/219 (29.68%), Postives = 111/219 (50.68%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPD--GEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRS-WKSHSAN-GHTWLKSILNKEEIQYSIPNG------QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +I +P+G+++ PA +C+ L + HP      GEYWIDPN G   DA+KV+C +   ++C+ P    +  ++ W+S +A+  H WL   ++    Q++  +G      Q+ FL++ S  A Q++T+ C+N     +    N   A  L    D  I+   +S   Y+V++D C        +++IE R    + LP  DI    +     +FGV +  VCF
Sbjct: 1057 SITSPDGSRKHPARSCRDLMLCHPEYKSDTGEYWIDPNEGCRADAIKVWCNMETGESCVNPGMPSLPRKNWWRSQAADKKHVWLGETMSPGS-QFTYGDGSPNMEVQLTFLRLLSTDASQKITYHCKNSVAYLDSRAGNLKKALMLQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGSDQEFGVDVGPVCF 1274          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001576.1 (pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1 gene:ENSPMAG00000001417.1 transcript:ENSPMAT00000001576.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 3.886e-25
Identity = 65/215 (30.23%), Postives = 108/215 (50.23%), Query Frame = 2
Query: 3344 NAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANG--HTWLKSILNK-EEIQY---SIPNG----QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTI 3952
            ++I++PEG+++ PA TC+ L + HP    G+Y+IDPN G   DA+KV+C +   +TC+      +  +SW ++ +    H W    +N   +  Y   S+P      Q+ FL++ S  A Q +T+ C+N     +E+  N   A  L   +D  I+   +S   Y V++D C        ++++E R    + LPI DI    I     +FGV I
Sbjct:  524 DSIRSPEGSRKNPARTCRDLKLCHPEWKSGDYFIDPNQGCTLDAIKVFCNMESGETCVYASPQNVPRKSWWTNKSKDRKHIWFGETMNSGSQFNYGDDSLPPNTAAIQMTFLRLLSTEASQNITYHCKNSIAYMDEQAGNLKKALLLQGSNDIEIRAEGNSRFTYNVLEDGCTKHTGDWGQTVLEYRTQKTSRLPIVDIAPLDIGGVDQEFGVDI 738          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 5.169e-25
Identity = 63/220 (28.64%), Postives = 107/220 (48.64%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSA---NGHTWLKSIL--------NKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEE-KLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I +PEGTK  PA +C+ L + H +   GEYWIDPN G V DA+KV+C +   +TC+ P    +  ++W S+     + H W    +          + +  +I   Q+ FL++ +  A Q +T+ C N     +    L K    RL+   +  ++    +   Y++++D C        +++++ + N  + LPI DI    I   + +FGV I  VCF
Sbjct:  393 IMSPEGTKTDPARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWCNMETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEVQLNFLRLVAAEASQNITYLCRNSVAYADAAGSLRKAV--RLMGSGELELRADGKNRFTYSMLEDGCAKHTGEWGKTVLQYKTNKPSRLPIVDIAPLDIGGPEQEFGVEIGPVCF 610          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.014e-21
Identity = 62/219 (28.31%), Postives = 103/219 (47.03%), Query Frame = 2
Query: 3347 AIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRS-WKSHSAN-GHTWLKSILN--------KEEIQYSIPNGQIAFLKVNSDS-----AVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTI 3952
             +++PEGT++ PA TC+ L + HP    G YWIDPN G   DA+KV+C +   +TC+      IS ++ W+S SA+  H W    ++         + +  +    Q+ FL++ S       A   +T+ C+N     +EE  N   A  L   +D  I+   +S   Y V++D C         +++E R    + LP  D+    +     +FG+ I
Sbjct:  668 GLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFCNMETGETCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTFLRLLSMEAYDLPAAANITYHCKNSIAYMDEETGNLKKALLLQGSNDMEIRAEGNSRFTYNVLEDSCTKHTGEWGRTVVEYRTQKTSRLPFVDVAPMDVGGPDQEFGLDI 886          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO49401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGC7])

HSP 1 Score: 113.235 bits (282), Expect = 5.013e-28
Identity = 71/211 (33.65%), Postives = 106/211 (50.24%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILN-KEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKY--TVIKDECQYSKSSEAESIIEVRNYA-NLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
             KNP GT   PA TC+ L +  P    G+YWIDPNGG   D++ VYC  +   +CI P  N+     W S   +G+ W    L+  ++  Y+    Q+ FL++ SD A Q++T+ C N  +   + +         L   + I     S  KY  T+IKD+C        ++++EV   + + LPI DI V  I +R  +FG+ I  VCFS
Sbjct:   22 FKNPLGTHRHPARTCRDLKLCRPEAESGQYWIDPNGGITEDSILVYCDFALNASCITP--NQ--FMKWYS-GRDGYKWFAQDLHGSQQFHYTSDPSQLLFLRLLSDRASQKITYHCRN-SVAWYDSRSRDFDKSIKLKSGNGIELYAASSNKYKPTIIKDDCGVKDGKWRKTVLEVNTESTHRLPIVDIAVFDIGDRDEEFGLQIGSVCFS 226          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 118.242 bits (295), Expect = 1.209e-26
Identity = 69/212 (32.55%), Postives = 103/212 (48.58%), Query Frame = 2
Query: 3344 NAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKE-EIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEV-RNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            N I+ P G K  PA TCK L + HP+   G YWIDPN G   DA++VYC  S   +CI P   ++     +++      WL     +E +I YS    QIAFL+V S  A Q VT+ C+N+     +   N+  + +L  D+D I    +    + TVI +EC        ++I+ +     + LPI D+ +        K  V +  VCF+
Sbjct: 1194 NTIRKPTGMKNNPAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDFSCISPTKAKLLNLRVQANVNKKDKWLSEAFEEESQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQNY-----KAWTNRKHSIKLRGDNDLIFHAKSPKKFQPTVILNECTTKDDQWHKTILAIDTKQKHRLPIVDMALFDFGKPHQKVTVEVGSVCFA 1400          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO49368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG67])

HSP 1 Score: 104.375 bits (259), Expect = 7.930e-23
Identity = 61/216 (28.24%), Postives = 109/216 (50.46%), Query Frame = 2
Query: 3332 LLGNNAI--KNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRN-YANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            LL N  +  K  EGTK  PA +C+ L + +P+   G Y+IDPN G  +DA +V+C  +   TC+ P N EI  RS   +S    TW+ +  +  +I Y +   Q+ FL++   +A Q +T+ C N     +   +      +LL D++  I    + L+     +ECQ   +   ++++++     + LPI D+    + +  ++F + +  VCF+
Sbjct:  431 LLINKIVTYKEQEGTKGKPARSCRNLKIDNPDKKSGYYYIDPNEGSPSDAEEVWCDFTTNATCVFPKNTEIITRSLVVNSNGEDTWI-TENDDVKIDYKLDVVQMKFLRLMHKTAKQNMTYHCYNSRAWEDSRTI------KLLGDNEEEIT---AKLRL----NECQNKDNQWHKTVLDISTKQKDKLPIIDVAPYDLQD-GAQFKIELGPVCFA 631          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO48996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHK9])

HSP 1 Score: 97.0561 bits (240), Expect = 1.328e-22
Identity = 65/208 (31.25%), Postives = 101/208 (48.56%), Query Frame = 2
Query: 3380 PAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILN--------KEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGN-EEKLNKVTAPRLLADDDTIIKMTHSH-LKYTVIKDECQYSKSSEAESIIEV-RNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            PA TC+ L + HP L  G YWIDPN G  +D+++VYC      TCI P N   S R       +G+ W    L         ++  +      Q+AFL++ SD A Q VT+ C N     + +  LN   + ++  D+   +  + S+  K  +I+D+C        ++II V  +  + LP+ D+ V  I  +  +FG+ I  VCFS
Sbjct:    3 PARTCRDLHMCHPKLKSGNYWIDPNEGIPDDSIQVYCDFENNSTCIFPNNQTRSHRRKWFSGPDGYKWFGKELRGFGTVRRGRDGPKEGTCPSQLAFLRLLSDRARQNVTYHCLNSAAWSSGKGDLNH--SIKIKGDNGVELHASSSNKFKPQIIRDDCHIKDGKWRQTIITVDTSKPHRLPVLDVAVFDIGGQGEEFGLDIGPVCFS 208          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1U4])

HSP 1 Score: 83.5741 bits (205), Expect = 3.008e-18
Identity = 60/185 (32.43%), Postives = 84/185 (45.41%), Query Frame = 2
Query: 3428 DGEYWIDPNGGRVNDAVKVYCRI-SEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQY-SIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVT--APRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            DG YWIDPN G   DA++V+C   S  +TCI P     +          G  W     N  EI Y S+   Q+ FL++ S+ AVQ  T+ C     I   +KL K    A RL  D+D I     +     V+ D CQ  +  +A   +E  +  N +PI D     +    S+FG  +  +CFS
Sbjct:    8 DGRYWIDPNHGCSEDAIEVFCNFTSGGETCIHPDKRTRTGERKHWSKVKGAEWFSEYKNGYEISYKSVGKTQLNFLRLLSERAVQNFTYYCSGS--IAWYDKLTKSYGRAIRLQGDNDEIFGYERNRFNIKVLHDGCQNKQDGKAVFQVETED-LNQMPIVDFSPGEM-EESSEFGFEVGPICFS 188          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000110.2 (collagen alpha-2(V) chain [Source:NCBI gene;Acc:101172057])

HSP 1 Score: 125.946 bits (315), Expect = 1.359e-28
Identity = 74/220 (33.64%), Postives = 113/220 (51.36%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW---KSHSANGHTWLKSIL---------NKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNYANL-LPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            +++P+G+KE PA TC+ +   +P    GEYW+DPN G   DA+KV+C +   +TCI      I  ++W    S S N   W  + +         NKEE Q ++   Q+  L++ S  + Q VT+ C+N   + +E+  N   A  L   +   IK   +S L+YTVI+D C  S    A+++IE R   +  LPI D+    I     +FG+ I  VCF
Sbjct: 1110 MRSPDGSKENPAKTCRDIKQCYPEKKSGEYWLDPNQGSTKDAIKVFCNMESDETCISASQAVIPGKAWWTKSSPSPNKPVWFGADINGGTKFLYGNKEERQNAV-TVQLKLLQLLSRESHQNVTYRCKNSVAVKDEKSSNFKKALVLKGYNGQEIKAHGNSRLRYTVIEDGCSKSNGQWAKTVIEYRTQTSTRLPIVDLAPMDIGQADQEFGLDIGPVCF 1328          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 125.176 bits (313), Expect = 2.563e-28
Identity = 74/223 (33.18%), Postives = 112/223 (50.22%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRS-WKSHSANGHTWLKSILNKE-EIQYS----IPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+N   PEG+K+ PA TC+ L + HP+   G+YWIDPN G   DA+KV+C +   ++C+ P  + I  ++ W S S N H W    +N      Y      PN    Q+ FL++ S  A Q +T+ C+N     +    N   A  L   +D  I+   +S   Y+V++D C        ++++E R+   + LPI DI    I     +FGV +  VCF
Sbjct: 1268 NNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDIAPMDIGGADQEFGVDVGPVCF 1490          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col2a1a (collagen type II A [Source:NCBI gene;Acc:100682394])

HSP 1 Score: 124.79 bits (312), Expect = 2.924e-28
Identity = 74/223 (33.18%), Postives = 112/223 (50.22%), Query Frame = 2
Query: 3341 NNAIKN---PEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRS-WKSHSANGHTWLKSILNKE-EIQYS----IPNG---QIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVRNY-ANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            NN I+N   PEG+K+ PA TC+ L + HP+   G+YWIDPN G   DA+KV+C +   ++C+ P  + I  ++ W S S N H W    +N      Y      PN    Q+ FL++ S  A Q +T+ C+N     +    N   A  L   +D  I+   +S   Y+V++D C        ++++E R+   + LPI DI    I     +FGV +  VCF
Sbjct: 1198 NNQIENIRSPEGSKKNPARTCRDLKLCHPDWKSGDYWIDPNQGCTVDAIKVFCNMETGESCVYPNPSSIPRKNWWSSKSRNKHVWFGETMNGGFHFNYGDDSLAPNTAAIQMNFLRLLSTEASQNLTYHCKNSVAYMDASTGNLKKALLLQGSNDVEIRAEGNSRFTYSVMEDSCTEHTGKWGKTVMEYRSQKTSRLPIVDIAPMDIGGADQEFGVDVGPVCF 1420          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1 (collagen type I alpha 1 [Source:NCBI gene;Acc:100144368])

HSP 1 Score: 124.405 bits (311), Expect = 3.810e-28
Identity = 68/219 (31.05%), Postives = 115/219 (52.51%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW---KSHSANGHTWLKSILNKE-EIQY----SIP---NGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMT-HSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I++P+GT++ PA TC+ L + HP+   GEYWIDP+ G   DA+KVYC +   +TC+ P   E++ ++W   K+     H W    +N   + +Y    S+P   N Q+ FL++ S  A Q +T+ C+N     +    N   A  L   ++  I+   +S   Y+V++D C     +  +++I+ + +  + LPI DI    I     +FG+ +  VCF
Sbjct: 1117 IRSPDGTRKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVSPTQREVAQKNWYISKNIKEKKHVWFGETMNDGFQFEYGSEGSLPEDVNIQLTFLRLMSTEASQNLTYHCKNSVAYMDAAAGNLKKALLLQGSNEIEIRAEGNSRFTYSVLEDGCTSHTGTWGKTVIDYKTSKTSRLPIIDIAPMDIGAPDQEFGLEVGPVCF 1335          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Match: col1 (collagen type I alpha 1 [Source:NCBI gene;Acc:100144368])

HSP 1 Score: 124.02 bits (310), Expect = 6.236e-28
Identity = 68/219 (31.05%), Postives = 115/219 (52.51%), Query Frame = 2
Query: 3350 IKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSW---KSHSANGHTWLKSILNKE-EIQY----SIP---NGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKM-THSHLKYTVIKDECQYSKSSEAESIIEVR-NYANLLPIRDIGVSIINNRKSKFGVTIEEVCF 3967
            I++P+GT++ PA TC+ L + HP+   GEYWIDP+ G   DA+KVYC +   +TC+ P   E++ ++W   K+     H W    +N   + +Y    S+P   N Q+ FL++ S  A Q +T+ C+N     +    N   A  L   ++  I+   +S   Y+V++D C     +  +++I+ + +  + LPI DI    I     +FG+ +  VCF
Sbjct: 1227 IRSPDGTRKNPARTCRDLKMCHPDWKSGEYWIDPDQGCTQDAIKVYCNMETGETCVSPTQREVAQKNWYISKNIKEKKHVWFGETMNDGFQFEYGSEGSLPEDVNIQLTFLRLMSTEASQNLTYHCKNSVAYMDAAAGNLKKALLLQGSNEIEIRAEGNSRFTYSVLEDGCTSHTGTWGKTVIDYKTSKTSRLPIIDIAPMDIGAPDQEFGLEVGPVCF 1445          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000031448.1 (SMESG000031448.1)

HSP 1 Score: 567.385 bits (1461), Expect = 1.626e-179
Identity = 444/510 (87.06%), Postives = 446/510 (87.45%), Query Frame = 2
Query: 2504 APGVDGKVGTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGDHGEMGNPGPQXXXXXXXXXXXXXXXXDAGEPGRKGPIGPQGKNGTSGGKGYDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDV---------------------GLRGAKGKKGKDGVPGREGRPGARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQGPVGIIGPRGDPGISGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            APGVDGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMGNPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQSGTSGKSGKVGTPGDKGGDGKPGPSGVLGDV                     G RG+KG KG  GVPG  GRPG  G  G  G  G  G  G  G +G                     LQGPVGIIGPRGDPGI GPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS
Sbjct:  782 APGVDGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMGNPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQSGTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGRPGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDG---------------------LQGPVGIIGPRGDPGIPGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGIMAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 1270          

HSP 2 Score: 300.056 bits (767), Expect = 2.054e-83
Identity = 482/482 (100.00%), Postives = 482/482 (100.00%), Query Frame = 2
Query:  836 KQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEXXXXXXXXXXXXXDRGRXXXXXXXXXXXXXXXXXXXXXXXSRGEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIGPNGPDGKSGRKXXXXXXXXXXXXXXXXNXXXXXXXXXXXXXXXXXXXXSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPGNQGLAGKNGNPGVEGKPGKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAXXXXXXXXXXXXXXXXXXXXXXXXXVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGLPGSEGASGPPGDVGD 2281
            KQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPGKQGPEGLPGSEGASGPPGDVGD
Sbjct:  241 KQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKGQKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKPGATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGRKGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIGPPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPPGSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGDVGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPGLAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGMDGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPGKQGPEGLPGSEGASGPPGDVGD 722          

HSP 3 Score: 176.792 bits (447), Expect = 2.443e-44
Identity = 130/130 (100.00%), Postives = 130/130 (100.00%), Query Frame = 2
Query:  116 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIXXXXXXXXXXXXXXXXKDGLRXXXXXXXXXXXXXXXXKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYPGPSGEKGDSGS 505
            MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYPGPSGEKGDSGS
Sbjct:    1 MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPDGDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGEQGPPGPVGKEGLTGPNGYPGPSGEKGDSGS 130          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000045473.1 (SMESG000045473.1)

HSP 1 Score: 255.758 bits (652), Expect = 4.079e-69
Identity = 110/224 (49.11%), Postives = 146/224 (65.18%), Query Frame = 2
Query: 3299 VTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS 3970
            +T+ DDP  A   GNNAI  P GTKEVPA +CK LS  +P+L DGEYWIDPNGGRV+DAV VYCRI+ Q+TCIKPI+      SW       H W ++I    E +Y I N Q+ +LK  S++A Q+++  C N  II + +         LL DDDTI+ + H   ++ VIKDECQY K SEAE+I+EVR  A+ LPI+D+G+ I ++R  K G+ + EVC+S
Sbjct: 1034 LTFSDDPSVAHSFGNNAIITPRGTKEVPARSCKHLSEHNPDLSDGEYWIDPNGGRVSDAVPVYCRIATQQTCIKPISKIYKTASWFKKYQKDHVWFQTINGIGEFEYDIENYQLNYLKALSETATQQISLNCINQAIILDRQGKMSTVWTSLLGDDDTILSLQHPKRRFKVIKDECQYEKFSEAETILEVRGKASRLPIKDVGLIIDSDRSRKVGIELGEVCYS 1257          

HSP 2 Score: 50.8322 bits (120), Expect = 8.734e-6
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = 2
Query:  836 KQGRKGELGDIGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEXXXXXXXXXXXXXDRGR 1036
            + G +GE G +G  GP G +G RG RG  GNPG +GPKGSQG++GPIG+EGK G  GPKGQKGD GR
Sbjct:  248 RPGVRGEAGIVGPQGPVGKVGQRGQRGPSGNPGLSGPKGSQGEEGPIGIEGKQGSAGPKGQKGDPGR 314          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000038928.1 (SMESG000038928.1)

HSP 1 Score: 179.489 bits (454), Expect = 3.163e-45
Identity = 89/221 (40.27%), Postives = 129/221 (58.37%), Query Frame = 2
Query: 3311 DDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNR--KSKFGVTIEEVCF 3967
            DDPL A+ LGN+AI  P GT   PA +C  L+  +P+ PDG YWIDPNGG+++DAV+VYC+I E+KTCIKP+  +I L+  K        W     + + I YS+   Q+ FLK+ S+ A Q +T  C N P+I      N V   R+  D+D I+  +     Y V++D CQ++    + + +E+ +    LPI+DI V  +N R  +S+    IEEVCF
Sbjct: 1082 DDPLIAKYLGNDAISKPLGTSNSPARSCLHLAEMNPSFPDGIYWIDPNGGKIDDAVQVYCKIKEKKTCIKPLVFKIQLQKPK------FNWFSQSNDNKFISYSLDQQQMTFLKMISNKASQFITINCRNMPVI-----KNSVKPLRIFTDNDIILDSSDQIFSYKVLEDNCQHNSQDLSSTRLEITSRPTRLPIKDIEVDTVNVRSERSQIEYNIEEVCF 1291          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 160.999 bits (406), Expect = 1.898e-39
Identity = 83/222 (37.39%), Postives = 128/222 (57.66%), Query Frame = 2
Query: 3311 DDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGH-TWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNR-KSKFGVTIEEVCFS 3970
            DD LA + LG++ +K P GTK++PA TCKQL   +PNL DG Y+IDPNGG+ +DA +V CR   +++CI+P +    L+ W +     + +W   I    +  Y I   Q+ FLK+ S +A QR+T  C    ++GN E  + V    L +D D  +       KY+VI+D C+ S      + +E+   A  LPIRDI ++  +++ + +FG+ I +VCFS
Sbjct: 1097 DDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSE--HPVI---LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1313          
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Match: SMESG000026651.1 (SMESG000026651.1)

HSP 1 Score: 160.614 bits (405), Expect = 2.076e-39
Identity = 83/222 (37.39%), Postives = 128/222 (57.66%), Query Frame = 2
Query: 3311 DDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKHPNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHSANGH-TWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIGNEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIEVRNYANLLPIRDIGVSIINNR-KSKFGVTIEEVCFS 3970
            DD LA + LG++ +K P GTK++PA TCKQL   +PNL DG Y+IDPNGG+ +DA +V CR   +++CI+P +    L+ W +     + +W   I    +  Y I   Q+ FLK+ S +A QR+T  C    ++GN E  + V    L +D D  +       KY+VI+D C+ S      + +E+   A  LPIRDI ++  +++ + +FG+ I +VCFS
Sbjct: 1102 DDALAVKYLGSDVVKKPLGTKDIPARTCKQLLDANPNLQDGFYYIDPNGGKADDAFRVLCRSQRKESCIEPKSPSYKLKHWDASDVTEYRSWFGEITGTFKFDYQIEASQLMFLKLFSTNARQRITINCSRLSVVGNSE--HPVI---LYSDHDEEVLRNGDLFKYSVIRDGCKNSAEIIDSTELEMDTEAIRLPIRDIALNTGSSKEQQQFGLDIGQVCFS 1318          
The following BLAST results are available for this feature:
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL5A32.994e-2928.19collagen type V alpha 3 chain [Source:HGNC Symbol;... [more]
COL1A25.497e-2833.18collagen type I alpha 2 chain [Source:HGNC Symbol;... [more]
COL1A26.303e-2833.18collagen type I alpha 2 chain [Source:HGNC Symbol;... [more]
COL2A11.544e-2631.05collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
COL2A12.335e-2631.05collagen type II alpha 1 chain [Source:HGNC Symbol... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col5a3a3.453e-3031.02collagen, type V, alpha 3a [Source:ZFIN;Acc:ZDB-GE... [more]
col1a23.452e-2933.04collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
col5a2b7.665e-2933.78collagen, type V, alpha 2b [Source:ZFIN;Acc:ZDB-GE... [more]
col2a1a1.332e-2831.05collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a1.439e-2831.05collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col3a11.492e-3230.31collagen, type III, alpha 1 (Ehlers-Danlos syndrom... [more]
col2a11.637e-2833.94collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
col2a11.816e-2833.94collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
col2a11.842e-2833.94collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
col2a12.101e-2833.94collagen, type II, alpha 1 [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col3a12.159e-3029.27collagen, type III, alpha 1 [Source:MGI Symbol;Acc... [more]
Col5a26.562e-2733.49collagen, type V, alpha 2 [Source:MGI Symbol;Acc:M... [more]
Col1a21.846e-2633.04collagen, type I, alpha 2 [Source:MGI Symbol;Acc:M... [more]
Col2a12.537e-2630.45collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col5a33.528e-2630.59collagen, type V, alpha 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02465|CO1A2_BOVIN1.785e-3332.93Collagen alpha-2(I) chain OS=Bos taurus OX=9913 GN... [more]
sp|Q28668|CO1A2_RABIT8.657e-3034.08Collagen alpha-2(I) chain (Fragment) OS=Oryctolagu... [more]
sp|O93484|CO1A2_ONCMY4.937e-2833.04Collagen alpha-2(I) chain OS=Oncorhynchus mykiss O... [more]
sp|Q6P4Z2|CO2A1_XENTR9.761e-2833.94Collagen alpha-1(II) chain OS=Xenopus tropicalis O... [more]
sp|Q91717|CO2A1_XENLA1.579e-2734.51Collagen alpha-1(II) chain OS=Xenopus laevis OX=83... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZG23.063e-14999.63Collagen F-2 (Fragment) OS=Schmidtea mediterranea ... [more]
A0A0R3SQ854.568e-5743.91Fibrillar collagen NC1 domain-containing protein O... [more]
A0A564YI948.142e-5743.91Fibrillar collagen NC1 domain-containing protein O... [more]
A0A0R3TLX72.040e-5545.83Fibrillar collagen NC1 domain-containing protein O... [more]
A0A0R3W1P33.116e-5341.95Fibrillar collagen NC1 domain-containing protein O... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043273.17.038e-2731.00pep primary_assembly:Astyanax_mexicanus-2.0:13:424... [more]
col1a1a2.584e-2630.00collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GE... [more]
col1a21.345e-2431.65collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
col1a1b3.732e-2431.05collagen, type I, alpha 1b [Source:ZFIN;Acc:ZDB-GE... [more]
col11a25.850e-2329.95collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003197.15.203e-2629.44pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 g... [more]
ENSPMAT00000001071.12.541e-2529.68pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gen... [more]
ENSPMAT00000001576.13.886e-2530.23pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1... [more]
ENSPMAT00000005318.15.169e-2528.64pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 ... [more]
ENSPMAT00000009617.11.014e-2128.31pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494015.013e-2833.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429531.209e-2632.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493687.930e-2328.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489961.328e-2231.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423023.008e-1832.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000110.21.359e-2833.64collagen alpha-2(V) chain [Source:NCBI gene;Acc:10... [more]
col2a1a2.563e-2833.18collagen type II A [Source:NCBI gene;Acc:100682394... [more]
col2a1a2.924e-2833.18collagen type II A [Source:NCBI gene;Acc:100682394... [more]
col13.810e-2831.05collagen type I alpha 1 [Source:NCBI gene;Acc:1001... [more]
col16.236e-2831.05collagen type I alpha 1 [Source:NCBI gene;Acc:1001... [more]
back to top
BLAST of Fibrillar collagen NC1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031448.11.626e-17987.06SMESG000031448.1[more]
SMESG000045473.14.079e-6949.11SMESG000045473.1[more]
SMESG000038928.13.163e-4540.27SMESG000038928.1[more]
SMESG000026651.11.898e-3937.39SMESG000026651.1[more]
SMESG000026651.12.076e-3937.39SMESG000026651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006180 ID=SMED30006180|Name=Fibrillar collagen NC1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4084bp
ATAAATTATTGTCGTGTCAATTTAAGGAATTATCATTCAAAATATCAGAA
AATTAATTTGAAAAGTTTGGAAATTTATCAGCTGAACAGTTCTTTCTGGA
ACTGCAGATTCTAAAATGTTCAAAAATTCAATTTTTTCTGGAGCTATTTT
ACTTATTTTGATCTATGTTGATTTTTCTTACGGTCAATTCAGAACTCTAA
ATGAAGCCACTGGTCCTATAGGAATAAGAGGAAATCCAGGAAAAAGAGGA
AAAATTGGTCCTGACGGAGATCCTGGCTCATCAGGACCTCCAGGTCCTCC
TGGTAAAGACGGCTTAAGAGGTGCTCCTGGCCCAAATGGACCTGCTGGAG
GTGCAGGACCTGATGGAAAATCCGGAGTTACTGGCAACACAGGACCACCA
GGTTCACGGGGGGAACAAGGTCCTCCTGGCCCTGTTGGTAAGGAAGGTCT
AACCGGTCCAAATGGCTATCCAGGTCCATCTGGTGAAAAAGGAGATTCTG
GTTCTATTGGAGAACAAGGTGATCCTGGAGATATTGGTCCTCAGGGTCCA
GCTGGACCTTTAGGTCCACCAGGGCAATCTGGACCAACTGGCCCACAAGG
TACTGTTGGAGAACGTGGTCCGCATGGTCCAGATGGAGTTGTTGGTCCAC
CTGGTCCAGAAGGTCGAATGGGTTCTCCTGGTTCTCCAGGACGACCTGGA
GAACTGGGTAAAAAGGGCGAAGGTGGAGATGAGGGATTAAAAGGTGGAAA
GGGTGAAAATGGTAAAACTGGAATAAATGGTAAATCTGGAAAACCTGGAA
TAAGAGGACCAATTGGTCCAGTCGGAATCAATGGAAAACAAGGAAGAAAA
GGTGAATTAGGAGATATTGGATTAACGGGACCACAAGGTTTAATTGGACC
TCGAGGAGTACGCGGAACAGTAGGAAATCCAGGAGATAATGGTCCTAAAG
GCTCACAAGGGGATCAAGGCCCGATCGGATTAGAAGGAAAGCCTGGTCCA
TTTGGTCCGAAAGGGCAAAAGGGAGATAGAGGTCGTCCAGGACCACAAGG
CGAAACTGGTCCTTTAGGACCAGGTGGTCCAATTGGCCCAGATGGCGCTA
AAGGATCTAGAGGGGAAATTGGTCCTAATGGCTCTCCAGGAACCCCTGGA
CCTAATGGTAAACCTGGAGCTACTGGGCCTCCTGGTACTCCAGGACATCC
TGGTAATGCAGGACCTGGTGGTCAAGCAGGTCCTATTGGACGGCCAGGAC
CAAATGGAGCACCAGGACCTCGCGGAGAGATTGGACCAAATGGTCCGGAT
GGAAAATCAGGTAGAAAAGGGTCTTTGGGACCAACAGGACTTACAGGTTT
ACGTGGACCACAAGGCAATCCAGGAAAAGATGGGACACTGGGTCCATTAG
GAACACCAGGATTGAGAGGACCACCAGGCTCAATTGGAACACCTGGATTG
AAAGGTAATATCGGACCTCCCGGTTCAAAAGGAAAAGTCGGAAATGCAGG
AAAACCAGGACCTCTTGGAAAAAATGGAATCGACGGAAGTGAAGGTCCTA
TTGGAAATGCTGGTAGCCCTGGATTTCCTGGACCTAATGGAGATCCAGGG
CCTAATGGACCTCCTGGTTCTTTAGGTCTTGCTGGACTTGTCGGATATCC
TGGAAATCAAGGTCTTGCTGGTAAAAATGGTAATCCAGGAGTTGAAGGAA
AACCTGGTAAGGCCGGAACACCAGGTTCTCCTGGAAAACCCGGAGTTCCA
GGACCCGTTGGAGATGTTGGAAATATAGGTCCTCCAGGTCCTAATGGCTT
GAAAGGAGCTCCTGGTATTTACGGTGTACCTGGAAATTACGGTCCAAATG
GATCTCCGGGAGATCTTGGTCCATTAGGAAAACAAGGGCCAGAAGGTTTG
GTTGGTGCTCCAGGATTAGCTGGAAGTCCAGGACCAGATGGACCAAGAGG
TCCACCTGGTGCAAACGGTTCTCCTGGGTCTGCTGGTGGAGAAGGAGTTG
AAAAACACAAACCTCGTAGTGTTGGATCAGCTGGTATTAGGGGACCTGAA
GGAAAGCCTGGTATGGATGGATTTCCAGGTGATGTCGGACCTCCGGGTAA
ACAGGGTCCTGAAGGGGGTCCAGGTGATCCAGGGGATCCTGGAGATATGG
GACCTATTGGAAATTCTGGTGATCCAGGACCAGATGGAAAACCAGGTAAG
AACGGAGCACCAGGAAAGCAAGGACCGGAAGGATTACCTGGATCAGAAGG
AGCTTCTGGTCCGCCGGGAGATGTTGGAGATCCAGGGAAATCTGGACCAA
CAGGTCCAAGAGGCGGTCCTGGGAGAATTGGAAGTCCTGGTGGTCAGGGA
AAACAAGGTAAATCAGGAAACCAAGGAAAATTGGGACCAAGTGGAAAACC
TGGACCTGTTGGCAGTCCTGGTGTTACGGGACTTGATGGAACTATAGGTA
GAAAAGGGCCGTTAGGCCTAAGAGGTCCTTCTGGTCCTAAAGGTAAATCG
GGTGCTCCTGGAGTTGATGGAAAAGTTGGAACACAAGGTGTGAATGGATA
TCCCGGATATTTAGGTCCACCTGGACCTCCAGGTCCACAGGGACCAAATG
GTAAACCTGGTAAACCAGGGCCACCAGGAAATGTCGGACAGATAGGCGAT
CATGGAGAAATGGGTAATCCTGGTCCACAAGGTTCTGTAGGTCCGCCTGG
AGCAACAGGCCCTGTAGGCCCTAGAGGAGACGCAGGGGAGCCTGGTAGAA
AAGGTCCCATTGGACCGCAAGGTAAAAATGGAACAAGTGGTGGCAAAGGA
TACGACGGTCAGAGTGGAACAAGTGGTAAATCTGGCAAGGTTGGTACTCC
TGGCGATAAAGGTGGAGATGGAAAACCTGGTCCCAGCGGTGTACTTGGAG
ACGTTGGTTTAAGAGGAGCTAAAGGCAAAAAAGGAAAAGATGGTGTTCCA
GGAAGAGAAGGTAGACCTGGAGCTAGAGGGTCGAAAGGTGTAAAAGGACC
AAAAGGTGTACCGGGTTATCCAGGACGTCCAGGCGTTGAAGGTGATCCAG
GGCCACCGGGTTACCCTGGTCCAGATGGTCCAGTTGGCCCTAAAGGTCCA
GATGGATTACAAGGGCCTGTTGGAATTATTGGACCTCGTGGAGATCCTGG
TATTTCAGGACCGATTGGTCCAACTGGTCTTCATGGTAAAAAAGGTGGAA
TTGGTATAATGGGACCAGTTGGGCCACTTGGCCCACCAGGCCCTCCTGGA
CCACCAGGTGGTATTATGGCTATGCAAATGCGTTCGCCTACAAAAGGTGT
TACATATGGTGATGATCCATTGGCTGCTGAACTTCTTGGAAATAATGCCA
TAAAAAATCCTGAAGGAACAAAAGAAGTTCCGGCAATAACTTGTAAGCAA
TTGAGTGTGAAGCATCCTAACCTACCTGATGGTGAATATTGGATTGATCC
AAACGGAGGTAGAGTGAATGATGCAGTTAAAGTATATTGTAGGATATCTG
AGCAGAAAACGTGTATTAAACCTATTAATAATGAAATCAGTCTTCGATCG
TGGAAAAGCCATTCTGCCAATGGACATACATGGTTGAAATCTATTTTGAA
TAAAGAAGAGATACAATATTCGATACCAAATGGTCAGATTGCATTTTTAA
AAGTGAACAGTGATTCAGCCGTTCAAAGAGTTACTTTCACCTGTGAAAAT
CATCCTATAATAGGCAATGAAGAAAAGTTGAATAAAGTGACAGCACCTCG
TTTATTAGCAGACGATGATACCATCATCAAAATGACACATTCTCATTTGA
AATATACAGTGATAAAAGATGAGTGTCAGTATTCCAAATCCAGTGAAGCG
GAAAGTATTATTGAAGTGAGAAACTATGCAAACTTGCTGCCGATTCGTGA
TATTGGGGTCAGCATCATTAATAACAGAAAGAGCAAATTTGGAGTGACAA
TTGAAGAAGTCTGCTTTTCATAATTTGACAATTGGAAAATCTATGATTTA
CATTTTTCTAATAGTTGTATATTAAATCAAATTTATTTTGTTCTGTAATT
AATCAAAATAATCGTATTGAAATTTTAAAAAAAA
back to top

protein sequence of SMED30006180-orf-1

>SMED30006180-orf-1 ID=SMED30006180-orf-1|Name=SMED30006180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1286bp
MFKNSIFSGAILLILIYVDFSYGQFRTLNEATGPIGIRGNPGKRGKIGPD
GDPGSSGPPGPPGKDGLRGAPGPNGPAGGAGPDGKSGVTGNTGPPGSRGE
QGPPGPVGKEGLTGPNGYPGPSGEKGDSGSIGEQGDPGDIGPQGPAGPLG
PPGQSGPTGPQGTVGERGPHGPDGVVGPPGPEGRMGSPGSPGRPGELGKK
GEGGDEGLKGGKGENGKTGINGKSGKPGIRGPIGPVGINGKQGRKGELGD
IGLTGPQGLIGPRGVRGTVGNPGDNGPKGSQGDQGPIGLEGKPGPFGPKG
QKGDRGRPGPQGETGPLGPGGPIGPDGAKGSRGEIGPNGSPGTPGPNGKP
GATGPPGTPGHPGNAGPGGQAGPIGRPGPNGAPGPRGEIGPNGPDGKSGR
KGSLGPTGLTGLRGPQGNPGKDGTLGPLGTPGLRGPPGSIGTPGLKGNIG
PPGSKGKVGNAGKPGPLGKNGIDGSEGPIGNAGSPGFPGPNGDPGPNGPP
GSLGLAGLVGYPGNQGLAGKNGNPGVEGKPGKAGTPGSPGKPGVPGPVGD
VGNIGPPGPNGLKGAPGIYGVPGNYGPNGSPGDLGPLGKQGPEGLVGAPG
LAGSPGPDGPRGPPGANGSPGSAGGEGVEKHKPRSVGSAGIRGPEGKPGM
DGFPGDVGPPGKQGPEGGPGDPGDPGDMGPIGNSGDPGPDGKPGKNGAPG
KQGPEGLPGSEGASGPPGDVGDPGKSGPTGPRGGPGRIGSPGGQGKQGKS
GNQGKLGPSGKPGPVGSPGVTGLDGTIGRKGPLGLRGPSGPKGKSGAPGV
DGKVGTQGVNGYPGYLGPPGPPGPQGPNGKPGKPGPPGNVGQIGDHGEMG
NPGPQGSVGPPGATGPVGPRGDAGEPGRKGPIGPQGKNGTSGGKGYDGQS
GTSGKSGKVGTPGDKGGDGKPGPSGVLGDVGLRGAKGKKGKDGVPGREGR
PGARGSKGVKGPKGVPGYPGRPGVEGDPGPPGYPGPDGPVGPKGPDGLQG
PVGIIGPRGDPGISGPIGPTGLHGKKGGIGIMGPVGPLGPPGPPGPPGGI
MAMQMRSPTKGVTYGDDPLAAELLGNNAIKNPEGTKEVPAITCKQLSVKH
PNLPDGEYWIDPNGGRVNDAVKVYCRISEQKTCIKPINNEISLRSWKSHS
ANGHTWLKSILNKEEIQYSIPNGQIAFLKVNSDSAVQRVTFTCENHPIIG
NEEKLNKVTAPRLLADDDTIIKMTHSHLKYTVIKDECQYSKSSEAESIIE
VRNYANLLPIRDIGVSIINNRKSKFGVTIEEVCFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR000885Fib_collagen_C
IPR008160Collagen
Vocabulary: cellular component
TermDefinition
GO:0005581collagen trimer
GO:0005578proteinaceous extracellular matrix
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005201extracellular matrix structural constituent