protein pitchfork

Overview
Nameprotein pitchfork
Smed IDSMED30006149
Length (bp)747
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein pitchfork (SMED30006149) t-SNE clustered cells

Violin plots show distribution of expression levels for protein pitchfork (SMED30006149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein pitchfork (SMED30006149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein pitchfork (SMED30006149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30006149SMESG000045346.1 dd_Smed_v4_5490_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006149SMESG000044136.1 Contig5644GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006149SMESG000045346.1 Contig5644GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006149SMESG000045346.1 dd_Smed_v6_5490_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30006149SMESG000045346.1 dd_Smed_v4_5490_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein pitchfork vs. Ensembl Human
Match: PIFO (primary cilia formation [Source:HGNC Symbol;Acc:HGNC:27009])

HSP 1 Score: 83.1889 bits (204), Expect = 5.361e-19
Identity = 65/196 (33.16%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   91 AEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCL-NMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYY 669
            A+    Y FGTC  R+++P     + +GN   P+RG P+ GPGCY   D   +   ++KIP S  GY LG +TA RF+ +  E  P   +   +    +     K N APF     RF      TY   P PG YNP+     ++ +   FG      PD      + + T K  L+T K+ ++ + R+AYL LYY
Sbjct:    6 ADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCY-FSDGYGLAYDLSKIPTSIKGYTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQE---KHKQNFAPFNVLVPRFKNYPKDTY--YPSPGAYNPEKKPPPKIAWPMKFGS-----PDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYY 190          
BLAST of protein pitchfork vs. Ensembl Human
Match: PIFO (primary cilia formation [Source:HGNC Symbol;Acc:HGNC:27009])

HSP 1 Score: 56.225 bits (134), Expect = 2.295e-9
Identity = 55/197 (27.92%), Postives = 82/197 (41.62%), Query Frame = 1
Query:   91 AEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCL-NMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYYT 672
            A+    Y FGTC  R+++P     + +GN   P+RG P+ GPGCY  ++                     T  A R+Q++S + +                   K N APF     RF      TY   P PG YNP+     ++ +   FG      PD      + + T K  L+T K+ ++ + R+AYL LYY 
Sbjct:    6 ADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCYFSDEM--------------------TPHAGRYQKVSPQQE-----------------KHKQNFAPFNVLVPRFKNYPKDTY--YPSPGAYNPEKKPPPKIAWPMKFGS-----PDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYYN 158          
BLAST of protein pitchfork vs. Ensembl Zebrafish
Match: si:ch211-66i15.4 (si:ch211-66i15.4 [Source:ZFIN;Acc:ZDB-GENE-090313-121])

HSP 1 Score: 87.4261 bits (215), Expect = 9.757e-21
Identity = 62/191 (32.46%), Postives = 88/191 (46.07%), Query Frame = 1
Query:  103 SLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKK--PNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYY 669
            S   FG+C +R ++PT  A DR+GN M    G    GPGCYD      ++  +   P S  GY    +TA RF        P P++        D+T  K   P  APF  +++RF   +   E SPGPG Y       K+V +   FG    D   + +  +    TE L   KE ++ + R+AYL L+Y
Sbjct:   17 SRVAFGSCQNRLMFPTHFAPDRMGNEMLSQFGSAEGGPGCYDNHTVGTLLYELQHKPESKRGYVFAARTASRFLPALKAVTPSPQK-----YQLDWTLPKVCPPGKAPFNSTTLRFRPKDA--EISPGPGAYAHDAIQSKKVSWPMKFGS--PDWTKVPMLERRALRTE-LFHDKEFRKQRNRVAYLHLFY 197          
BLAST of protein pitchfork vs. Ensembl Zebrafish
Match: si:ch211-66i15.4 (si:ch211-66i15.4 [Source:ZFIN;Acc:ZDB-GENE-090313-121])

HSP 1 Score: 77.411 bits (189), Expect = 4.645e-17
Identity = 56/178 (31.46%), Postives = 79/178 (44.38%), Query Frame = 1
Query:  103 SLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKK--PNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDIT----LKSKICRNTEKLNTT 618
            S   FG+C +R ++PT  A DR+GN M    G    GPGCYD      ++  +   P S  GY    +TA RF        P P++        D+T  K   P  APF  +++RF   +   E SPGPG Y       K+V +   FG      PD T    L+ +  R   ++ +T
Sbjct:   17 SRVAFGSCQNRLMFPTHFAPDRMGNEMLSQFGSAEGGPGCYDNHTVGTLLYELQHKPESKRGYVFAARTASRFLPALKAVTPSPQK-----YQLDWTLPKVCPPGKAPFNSTTLRFRPKDA--EISPGPGAYAHDAIQSKKVSWPMKFGS-----PDWTKVPMLERRALRTEVQIGST 182          
BLAST of protein pitchfork vs. Ensembl Xenopus
Match: ENSXETT00000039082.1 (primary cilia formation [Source:NCBI gene;Acc:100489101])

HSP 1 Score: 110.923 bits (276), Expect = 1.626e-29
Identity = 71/190 (37.37%), Postives = 105/190 (55.26%), Query Frame = 1
Query:  115 FGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNS--APFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNT--EKLNTTKEEKRFQRRLAYLKLYYT 672
            FG+  D++ +P   A DR+GN++ PIRG PNLGPGCY++E+ TNM  ++++ P S  GY +  +TAPRF        P    G G   +F +T + K +S  APF  ++ RF          P PGTYN      ++V + G FG      PD +L   + + T   +L T KE ++ + R+AYL LYY+
Sbjct:   13 FGSTQDKKQFPHYCAPDRMGNNLAPIRGAPNLGPGCYNIEEVTNMQHLLDRKPVSVKGYVMSARTAPRFPPEKKMQTP----GPGEYQSF-WTKESKVSSAYAPFFINAARFPKKMSEAALYPSPGTYNIVSLQSQKVSWPGRFGS-----PDWSLIPALEKRTVRSELETDKEFRKRRNRIAYLSLYYS 192          
BLAST of protein pitchfork vs. Ensembl Xenopus
Match: ENSXETT00000027335.1 (primary cilia formation [Source:NCBI gene;Acc:100489101])

HSP 1 Score: 94.7449 bits (234), Expect = 1.409e-23
Identity = 59/170 (34.71%), Postives = 88/170 (51.76%), Query Frame = 1
Query:  115 FGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNS--APFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTT 618
            FG+  D++ +P   A DR+GN++ PIRG PNLGPGCY++E+ TNM  ++++ P S  GY +  +TAPRF        P P +         +T + K +S  APF  ++ RF          P PGTYN      ++V + G FG      PD +L   + + T +   T
Sbjct:   13 FGSTQDKKQFPHYCAPDRMGNNLAPIRGAPNLGPGCYNIEEVTNMQHLLDRKPVSVKGYVMSARTAPRFPPEKKMQTPGPGEYQSF-----WTKESKVSSAYAPFFINAARFPKKMSEAALYPSPGTYNIVSLQSQKVSWPGRFGS-----PDWSLIPALEKRTVRSEVT 172          
BLAST of protein pitchfork vs. Ensembl Mouse
Match: Pifo (primary cilia formation [Source:MGI Symbol;Acc:MGI:1923670])

HSP 1 Score: 91.2781 bits (225), Expect = 4.788e-22
Identity = 67/193 (34.72%), Postives = 97/193 (50.26%), Query Frame = 1
Query:  109 YIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAV-MNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNS-APF--LQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYY 669
            Y FGT   R+++P       LGN   P+RG P+ GPGCY      N +A  ++K+P S  GYA+G +TA RF+ +S +  P P    G+    D   +K   S APF  L    R      +Y   PGPGTYNP++    +V +   FG      PD +    + + T K  L+  K+ ++ + R+AY  LYY
Sbjct:   26 YSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYP----GMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSY---PGPGTYNPEMKSVPKVTWPMKFGS-----PDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYY 206          
BLAST of protein pitchfork vs. Ensembl Mouse
Match: Pifo (primary cilia formation [Source:MGI Symbol;Acc:MGI:1923670])

HSP 1 Score: 91.6633 bits (226), Expect = 7.913e-22
Identity = 67/193 (34.72%), Postives = 97/193 (50.26%), Query Frame = 1
Query:  109 YIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAV-MNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNS-APF--LQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYY 669
            Y FGT   R+++P       LGN   P+RG P+ GPGCY      N +A  ++K+P S  GYA+G +TA RF+ +S +  P P    G+    D   +K   S APF  L    R      +Y   PGPGTYNP++    +V +   FG      PD +    + + T K  L+  K+ ++ + R+AY  LYY
Sbjct:   65 YSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYP----GMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSY---PGPGTYNPEMKSVPKVTWPMKFGS-----PDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYY 245          
BLAST of protein pitchfork vs. UniProt/SwissProt
Match: sp|Q2TBS4|PIFO_BOVIN (Protein pitchfork OS=Bos taurus OX=9913 GN=PIFO PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.355e-26
Identity = 75/200 (37.50%), Postives = 104/200 (52.00%), Query Frame = 1
Query:   88 FAEKKSL--YIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYD-KKPNSAPFLQSSVRFGCLNMTYEES---PGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYY 669
            F++ ++L  Y FGTC  R+I+P     D LGN   PIRG P+ GPGCY  E+  ++   + KIP S  GY  G +TA RF+  + +  P P    G+  T +      KPN APF   S RF     TY +    PGPGTY  +  + ++V +   FG    D   +    K    TE L+T K+ ++ + RLAYL LYY
Sbjct:    3 FSQAETLVNYSFGTCQHRKIFPHFFPSDLLGNKFLPIRGVPHRGPGCYIAEESKDLAYSLAKIPTSIKGYGFGARTAVRFKPKNKDVTPYP----GMYQTVNLQEQTHKPNFAPFNTLSPRF----RTYSKDPCYPGPGTYKLEKKEPQKVTWPMKFGS--PDWSQVPCLQKRTLKTE-LSTDKDFRKHRNRLAYLSLYY 191          
BLAST of protein pitchfork vs. UniProt/SwissProt
Match: sp|Q9D9W1|PIFO_MOUSE (Protein pitchfork OS=Mus musculus OX=10090 GN=Pifo PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.349e-21
Identity = 67/193 (34.72%), Postives = 97/193 (50.26%), Query Frame = 1
Query:  109 YIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAV-MNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNS-APF--LQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYY 669
            Y FGT   R+++P       LGN   P+RG P+ GPGCY      N +A  ++K+P S  GYA+G +TA RF+ +S +  P P    G+    D   +K   S APF  L    R      +Y   PGPGTYNP++    +V +   FG      PD +    + + T K  L+  K+ ++ + R+AY  LYY
Sbjct:   26 YSFGTRQARKLFPHYHPPTWLGNLYLPLRGMPHTGPGCYAAATDWNGLAYNLSKVPTSTKGYAIGARTAVRFKPISKDVTPYP----GMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSY---PGPGTYNPEMKSVPKVTWPMKFGS-----PDWSQVPCLEKRTLKAELSADKDFRKHRSRVAYFSLYY 206          
BLAST of protein pitchfork vs. UniProt/SwissProt
Match: sp|Q8TCI5|PIFO_HUMAN (Protein pitchfork OS=Homo sapiens OX=9606 GN=PIFO PE=1 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.575e-18
Identity = 65/196 (33.16%), Postives = 94/196 (47.96%), Query Frame = 1
Query:   91 AEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCL-NMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEK--LNTTKEEKRFQRRLAYLKLYY 669
            A+    Y FGTC  R+++P     + +GN   P+RG P+ GPGCY   D   +   ++KIP S  GY LG +TA RF+ +  E  P   +   +    +     K N APF     RF      TY   P PG YNP+     ++ +   FG      PD      + + T K  L+T K+ ++ + R+AYL LYY
Sbjct:    6 ADAADNYPFGTCQQRKLFPHFHPPNLIGNKFVPLRGSPHRGPGCY-FSDGYGLAYDLSKIPTSIKGYTLGARTAVRFKPIQKEMTPHAGRYQKVSPQQE---KHKQNFAPFNVLVPRFKNYPKDTY--YPSPGAYNPEKKPPPKIAWPMKFGS-----PDWAQVPCLQKRTLKAELSTDKDFRKHRNRVAYLSLYY 190          
BLAST of protein pitchfork vs. TrEMBL
Match: A0A3S0ZJ66 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016252 PE=4 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.684e-43
Identity = 83/190 (43.68%), Postives = 116/190 (61.05%), Query Frame = 1
Query:  112 IFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVP---RQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMT-YEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYY 669
            +F TC DR+++PT+MA+DR GN + P+RG  + GPGCYD E+KTN    ++    S  GY++G +T PRF + +N   P P   +Q    P  F+ +        PF   S RF        +  PG GTY  ++P  ++VQ+H  FGG P  LP ITL+S I RNTEKL +TKEE+++ R+LAYLKLY+
Sbjct:   14 VFMTCKDREMFPTKMAQDRFGNELCPLRGAAHRGPGCYDNEEKTNFSYQVDNKLVSTKGYSMGARTGPRFMRGNNFKTPCPTEYQQHRNDPMEFETS------KKPFEIGSDRFPLYKRDLVDVVPGAGTYEHEIPRNRKVQWHQSFGGNPILLPSITLRSTIDRNTEKLYSTKEERKYHRKLAYLKLYF 197          
BLAST of protein pitchfork vs. TrEMBL
Match: A0A1S3JVE1 (protein pitchfork OS=Lingula unguis OX=7574 GN=LOC106176477 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.000e-42
Identity = 82/198 (41.41%), Postives = 120/198 (60.61%), Query Frame = 1
Query:   85 IFAEKKSLYI-FGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQ-GSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEES-PGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYY 669
            I  E + L + FGT  +R ++P  MA +R GN + P+RG PN GPGCY+ E+ +N    ++    S  GY +G +T PRF++   E  P P +  + +    ++T    P+  PF  ++ RF       EES PG GTY  ++P  ++VQ+H  FGG P +LP +T+KS +  NTEKL +TKE K+++RRLAYLKLYY
Sbjct:    3 ILEEPRKLNVSFGTTQNRTLFPVHMAPNRFGNDLKPLRGQPNTGPGCYNNEEVSNFKYQIDTYLTSQKGYTMGARTGPRFRKEFKEVTPAPPEYQTKVTDPIEFT----PSYKPFNAAADRFPVYKREIEESVPGAGTYEHEIPRNRKVQWHQSFGGAPINLPAVTIKSTLQPNTEKLLSTKETKKYERRLAYLKLYY 196          
BLAST of protein pitchfork vs. TrEMBL
Match: R7VHU4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_162847 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 7.448e-41
Identity = 85/197 (43.15%), Postives = 114/197 (57.87%), Query Frame = 1
Query:   91 AEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVP---RQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEE-SPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYY 669
             EKKS   F +  DRQ++PT +   R GN+M  IRG PN GPGCY+ ED TN    ++    SN GY+LG +TA + ++  +   P P   + G   P TF       P + PF  ++ RF      ++E +PGPGTY  +L   ++VQ+ G FG  P +LPDI   S I  NTEKL +TK+EK+  R LAYLKLYY
Sbjct:    5 VEKKSRVAFQSTLDRQVFPTHVPHTRFGNNMTAIRGAPNRGPGCYENEDATNFWHEVDSKITSNKGYSLGARTASKIKKDWSFLTPAPCTYQTGCTEPQTF------TPCAKPFHAAADRFPEYRRNFDEITPGPGTYGHELKMNRKVQWQGSFGSAPLNLPDIKQHSTIESNTEKLLSTKDEKKQHRVLAYLKLYY 195          
BLAST of protein pitchfork vs. TrEMBL
Match: A0A267H6F0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023260g1 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 9.208e-41
Identity = 78/209 (37.32%), Postives = 127/209 (60.77%), Query Frame = 1
Query:   76 IESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLS----NETKPVPRQGSGIPATFD-----YTYDKKPNSAPFLQSSVRFGCLNM-TYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 672
            +E +F EKKS ++F +C +R+++P  +  +R+G++M  +   P+LGPG Y+ E+KTN    + +   S  GYALG +TAPRF+  S    ++T  +      +P  +D        D++    PFL ++ RF       +E +P PG Y  ++   ++VQ+   FGG PT+LP +  KS + +NT+KL +TK+EK++QRRLAY+KL+YT
Sbjct:    1 MEDLFQEKKSAFVFDSCQNRRLFPFHIPTNRMGSNMPSVTAAPHLGPGYYNNEEKTNFGYTLEQKVGSTKGYALGARTAPRFRGASGGAGSDTGGLGPGAYHLPDNYDELQREAARDRELGRPPFLSATQRFPVFKRDIFEVNPSPGNYEHEVQRNRKVQWQQSFGGTPTNLPSVQQKSTLVQNTDKLRSTKDEKKYQRRLAYMKLFYT 209          
BLAST of protein pitchfork vs. TrEMBL
Match: A0A1I8FVQ5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023260g2 PE=4 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.015e-40
Identity = 78/209 (37.32%), Postives = 127/209 (60.77%), Query Frame = 1
Query:   76 IESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLS----NETKPVPRQGSGIPATFD-----YTYDKKPNSAPFLQSSVRFGCLNM-TYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 672
            +E +F EKKS ++F +C +R+++P  +  +R+G++M  +   P+LGPG Y+ E+KTN    + +   S  GYALG +TAPRF+  S    ++T  +      +P  +D        D++    PFL ++ RF       +E +P PG Y  ++   ++VQ+   FGG PT+LP +  KS + +NT+KL +TK+EK++QRRLAY+KL+YT
Sbjct:    1 MEDLFQEKKSAFVFDSCQNRRLFPFHIPTNRMGSNMPSVTAAPHLGPGYYNNEEKTNFGYTLEQKVGSTKGYALGARTAPRFRGASGGAGSDTGGLGPGAYHLPDNYDELQREAARDRELGRPPFLSATQRFPVFKREIFEVNPSPGNYEHEVQRNRKVQWQQSFGGTPTNLPSVQQKSTLVQNTDKLRSTKDEKKYQRRLAYMKLFYT 209          
BLAST of protein pitchfork vs. Ensembl Cavefish
Match: si:ch211-66i15.4 (primary cilia formation [Source:NCBI gene;Acc:103036214])

HSP 1 Score: 55.0694 bits (131), Expect = 4.419e-9
Identity = 48/157 (30.57%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  208 LGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNT--EKLNTTKEEKRFQRRLAYLKLYYT 672
            LGPG Y+      ++  +   P S  GY L ++TA RF  +S    P   +          +    P  APF  S+ RF     T   +PGPGTY    P  ++V +   FG      PD T   +  R    ++L   KE  + + R+AYL+L+YT
Sbjct:   29 LGPGSYENHAVGTILHNLQSRPESKRGYIL-SRTASRFPSISQAYTPSAHEEQ---QDRSLSITCSPARAPFNSSNQRFRSNTTTLFITPGPGTYAHDTPRNQKVSWPMKFGS-----PDWTQVPQPERKAARKELLCDKEFIKQRNRVAYLRLFYT 176          
BLAST of protein pitchfork vs. Ensembl Cavefish
Match: si:ch211-66i15.4 (primary cilia formation [Source:NCBI gene;Acc:103036214])

HSP 1 Score: 55.0694 bits (131), Expect = 4.419e-9
Identity = 48/157 (30.57%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  208 LGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNT--EKLNTTKEEKRFQRRLAYLKLYYT 672
            LGPG Y+      ++  +   P S  GY L ++TA RF  +S    P   +          +    P  APF  S+ RF     T   +PGPGTY    P  ++V +   FG      PD T   +  R    ++L   KE  + + R+AYL+L+YT
Sbjct:   29 LGPGSYENHAVGTILHNLQSRPESKRGYIL-SRTASRFPSISQAYTPSAHEEQ---QDRSLSITCSPARAPFNSSNQRFRSNTTTLFITPGPGTYAHDTPRNQKVSWPMKFGS-----PDWTQVPQPERKAARKELLCDKEFIKQRNRVAYLRLFYT 176          
BLAST of protein pitchfork vs. Ensembl Nematostella
Match: EDO36035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR2])

HSP 1 Score: 90.5077 bits (223), Expect = 7.541e-22
Identity = 56/172 (32.56%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  115 FGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRF---QQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTK 621
            FGT  DR++ P +   +R GN +  IRG PN GPGCYD  + +  +    + P    GY+LG +TAPRF     +     P  +     P  FD      P   PF   + RF       E  PG G+Y   +   ++++YHG FGG  T +  + +K   C N  + +T K
Sbjct:   16 FGTTLDRELMPIKAPNNRFGNELLAIRGAPNRGPGCYDNAEVSTFVYEQEQRPVCRRGYSLGARTAPRFPKPMHMDVPGAPTYQAVISKPQEFD------PAFKPFSVGANRFRETAQAKEALPGAGSYEHDVESNRKIKYHGSFGGPQTLINSVQIK---CNNFGERDTCK 178          
BLAST of protein pitchfork vs. Planmine SMEST
Match: SMESG000045346.1 (SMESG000045346.1)

HSP 1 Score: 437.573 bits (1124), Expect = 4.293e-158
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = 1
Query:   37 MTMYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 672
            MTMYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT
Sbjct:    1 MTMYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 212          
BLAST of protein pitchfork vs. Planmine SMEST
Match: SMESG000045346.1 (SMESG000045346.1)

HSP 1 Score: 432.95 bits (1112), Expect = 2.338e-156
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 1
Query:   43 MYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 672
            MYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT
Sbjct:    1 MYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMNPIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSNETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPGTYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRFQRRLAYLKLYYT 210          
The following BLAST results are available for this feature:
BLAST of protein pitchfork vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PIFO5.361e-1933.16primary cilia formation [Source:HGNC Symbol;Acc:HG... [more]
PIFO2.295e-927.92primary cilia formation [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein pitchfork vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein pitchfork vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-66i15.49.757e-2132.46si:ch211-66i15.4 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:ch211-66i15.44.645e-1731.46si:ch211-66i15.4 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000039082.11.626e-2937.37primary cilia formation [Source:NCBI gene;Acc:1004... [more]
ENSXETT00000027335.11.409e-2334.71primary cilia formation [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pifo4.788e-2234.72primary cilia formation [Source:MGI Symbol;Acc:MGI... [more]
Pifo7.913e-2234.72primary cilia formation [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of protein pitchfork vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q2TBS4|PIFO_BOVIN4.355e-2637.50Protein pitchfork OS=Bos taurus OX=9913 GN=PIFO PE... [more]
sp|Q9D9W1|PIFO_MOUSE3.349e-2134.72Protein pitchfork OS=Mus musculus OX=10090 GN=Pifo... [more]
sp|Q8TCI5|PIFO_HUMAN2.575e-1833.16Protein pitchfork OS=Homo sapiens OX=9606 GN=PIFO ... [more]
back to top
BLAST of protein pitchfork vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0ZJ663.684e-4343.68Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3JVE13.000e-4241.41protein pitchfork OS=Lingula unguis OX=7574 GN=LOC... [more]
R7VHU47.448e-4143.15Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A267H6F09.208e-4137.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FVQ51.015e-4037.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-66i15.44.419e-930.57primary cilia formation [Source:NCBI gene;Acc:1030... [more]
si:ch211-66i15.44.419e-930.57primary cilia formation [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein pitchfork vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein pitchfork vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360357.541e-2232.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein pitchfork vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein pitchfork vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000045346.14.293e-158100.00SMESG000045346.1[more]
SMESG000045346.12.338e-156100.00SMESG000045346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006149 ID=SMED30006149|Name=protein pitchfork|organism=Schmidtea mediterranea sexual|type=transcript|length=747bp
CTTTTACCGTAACTATAGTAATATTATATTTTCAATATGACTATGTATAG
CTCAGAACCTAGTATACTTGACAAAATTGAAAGTATATTCGCTGAAAAGA
AAAGCCTTTACATTTTTGGAACATGCGGAGATCGTCAAATTTATCCAACT
CAAATGGCACGGGATAGATTAGGAAATTCAATGAATCCTATCAGGGGACC
ACCAAATCTCGGACCGGGGTGTTATGATTTGGAAGATAAAACCAACATGA
TTGCTGTGATGAATAAAATACCTCGAAGCAATCTAGGATATGCTCTTGGC
ACGAAAACTGCACCAAGATTTCAACAACTATCAAACGAAACGAAACCCGT
ACCTCGACAAGGTTCAGGAATACCAGCCACATTCGATTATACCTACGATA
AAAAACCGAACTCTGCTCCATTTTTGCAGAGTTCTGTTCGTTTCGGTTGT
CTAAATATGACGTATGAAGAATCTCCAGGTCCTGGAACATACAACCCTAA
ATTGCCAGACTGCAAGCAAGTTCAATATCACGGTGGATTTGGTGGTAGAC
CAACAGATTTGCCAGATATTACATTAAAAAGTAAAATCTGTCGAAACACA
GAAAAGTTGAACACCACCAAAGAAGAAAAGCGATTTCAAAGACGTCTTGC
ATATTTGAAACTATATTACACCTGAATCAAAGGCTTGAATGAAAAGTCAC
ATAAAATGATTCTGTTTGTCAATAAAAAAATAAATTCACAGTGGATC
back to top

protein sequence of SMED30006149-orf-1

>SMED30006149-orf-1 ID=SMED30006149-orf-1|Name=SMED30006149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MTMYSSEPSILDKIESIFAEKKSLYIFGTCGDRQIYPTQMARDRLGNSMN
PIRGPPNLGPGCYDLEDKTNMIAVMNKIPRSNLGYALGTKTAPRFQQLSN
ETKPVPRQGSGIPATFDYTYDKKPNSAPFLQSSVRFGCLNMTYEESPGPG
TYNPKLPDCKQVQYHGGFGGRPTDLPDITLKSKICRNTEKLNTTKEEKRF
QRRLAYLKLYYT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR033602Pitchfork
IPR010736SHIPPO-rpt
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
GO:0031410cytoplasmic vesicle
GO:0036064ciliary basal body
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
Vocabulary: biological process
TermDefinition
GO:0030030cell projection organization
GO:0031344regulation of cell projection organization
GO:0033674positive regulation of kinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010736Sperm-tail PG-rich repeatPFAMPF07004SHIPPO-rptcoord: 146..174
e-value: 0.012
score: 16.5
coord: 57..74
e-value: 1.4
score: 9.9
IPR033602Protein pitchforkPANTHERPTHR31508FAMILY NOT NAMEDcoord: 19..211