Kinase D-interacting substrate

Overview
NameKinase D-interacting substrate
Smed IDSMED30006148
Length (bp)3589
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase D-interacting substrate (SMED30006148) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase D-interacting substrate (SMED30006148) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase D-interacting substrate (SMED30006148) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase D-interacting substrate (SMED30006148) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006148

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006148SMESG000051607.1 SmedASXL_015969SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30006148SMESG000051607.1 dd_Smed_v6_15438_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30006148SMESG000051607.1 OX_Smed_1.0.10122ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 155.606 bits (392), Expect = 1.172e-37
Identity = 184/814 (22.60%), Postives = 364/814 (44.72%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSSRPKSLGDI--PTTVIQTN----------VSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I + ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++           L +    L+   P++      P +V  +           VS    S   +G T     F  +        + +  L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct:  193 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLILY-LEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNRGSGPAPGPVVL--LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 971          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 155.221 bits (391), Expect = 2.060e-37
Identity = 184/814 (22.60%), Postives = 364/814 (44.72%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSSRPKSLGDI--PTTVIQTN----------VSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I + ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++           L +    L+   P++      P +V  +           VS    S   +G T     F  +        + +  L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct:  447 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLILY-LEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNRGSGPAPGPVVL--LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 1225          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 155.221 bits (391), Expect = 2.151e-37
Identity = 184/814 (22.60%), Postives = 364/814 (44.72%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSSRPKSLGDI--PTTVIQTN----------VSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I + ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++           L +    L+   P++      P +V  +           VS    S   +G T     F  +        + +  L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLILY-LEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVSPQPHSSYYSGMTGPQHPFYNRGSGPAPGPVVL--LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 1224          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 120.939 bits (302), Expect = 7.639e-27
Identity = 146/653 (22.36%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 59.3066 bits (142), Expect = 5.223e-8
Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
            L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct: 1188 LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 1262          
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Match: KIDINS220 (kinase D interacting substrate 220 [Source:HGNC Symbol;Acc:HGNC:29508])

HSP 1 Score: 120.553 bits (301), Expect = 9.731e-27
Identity = 146/653 (22.36%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 59.3066 bits (142), Expect = 5.321e-8
Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
            L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct: 1207 LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 1281          
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 94.7449 bits (234), Expect = 3.413e-19
Identity = 170/817 (20.81%), Postives = 344/817 (42.11%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQ--NEILLQPS--------------RLLFLFPCASSIISGFVLGITINW-VFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYP--SDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDT--DSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPI-FVLMTCIIFLGFFGCLPVFCKVLIMLFK---SPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDS----FHLLHSTFHLPVYM--DEIFSFIPTLPQKT-SFSNTNEMFCLRG---GS--SFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDIL---ECFNS--EHLNNKDFLLLAQDDKSISIFGNFLESE---SFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD-LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMIS 2822
            VLAD++ EP++  PL +G++ +   G ++  L KL E + H+ ++   + + L  S               L F    A   IS  V    I+W VF ++       +IFC + ++++    +    ++  +   A+   R+ L+  IL  +   +  D  + P+  +   ++             IV +++ A E  +  +  RL C  K          ++ C VP  +L+IV    L++     +++      + +D    P  F L   I FL  F  + ++   LI+++     P R + +  +N     +  +   ++ E+  +  +I + +A+  +   R+ ++V+  DNC ++++   +  L+ L + R   P ++I+A D + +++        +   N+    S +       L +   +P Y+    +      L +K  S +   E F  +    GS  S    +   S  KST +P +++N                 + +    L +     +N + +++++ +     ++++  +I+F W  L  W+ L   WP R+  +I+  ++             +H++ L   E +    +H+  +D L+  Q D+++  F  FL+S+   S   L++  +K F   +S L+PY++ +I E             R K L DI         +Q+ S+       +  P   R  F+     M I   L ++    V+NL+  ID + S +L     R   LN+ GLVL+ C L  L+  +++  GD+ + + L      LE+LK+  
Sbjct:  470 VLADIVCEPSLSLPLTIGLYAKWGSG-KSALLAKLKEAM-HSFSRDWLDGVSLSVSFALFFAIFLFFGMFSLTFTMLIA---ISNSVTAYLISWSVFLLIF------IIFCSLIVVVYYGDRKNWYTSMDIANFFARVFSRIRLVYNILTLHAPMNSEDSASMPVSFLFADYHRLSSIGGEQALAKIVATLFEAAETHFGVLPVRLFCCMKPPYPGIHGSLRRHCGVPHVILLIVAVFLLIMAQVFGTVW------LLSDRD--PNNFNLFIAIAFLCGFVMIAIYPLALIIMYSWTNVPRRRVNAAARNAHKLRFEGLMQKLQTEVDLLADMIRSLDAF-TRSHTRLVVVVDGLDNCEQERMVQTLDALELLFSARKHRPFITIIAVDPHVIVS--------AINHNMHSALSGTELTGHDYLKNIISMPFYLHNSALRQLQSKLREKRESMAEWKERFKRQDTFYGSHLSLREADGRTSRKKST-VPNMNSNS-------------VVGRNMNDGILGEDYFSNMNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALE-------------VHNNQLLLSEVYYQLKDHIPAQDDLM--QLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRE-------------RSKGLVDIE--------AQVGSA------GMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKID-IPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLL------LETLKVFG 1195          
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 93.9745 bits (232), Expect = 5.144e-19
Identity = 165/812 (20.32%), Postives = 345/812 (42.49%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQ--NEILLQPS--------------RLLFLFPCASSIISGFVLGITINW-VFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYP--SDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDT--DSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPI-FVLMTCIIFLGFFGCLPVFCKVLIMLFK---SPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDS----FHLLHSTFHLPVYM--DEIFSFIPTLPQKT-SFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDIL---ECFNS--EHLNNKDFLLLAQDDKSISIFGNFLESE---SFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD-LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMIS 2822
            VLAD++ EP++  PL +G++ +   G ++  L KL E + H+ ++   + + L  S               L F    A   IS  V    I+W VF ++       +IFC + ++++    +    ++  +   A+   R+ L+  IL  +   +  D  + P+  +   ++             IV +++ A E  +  +  RL C  K          ++ C VP  +L+IV    L++     +++      + +D    P  F L   I FL  F  + ++   LI+++     P R + +  +N     +  +   ++ E+  +  +I + +A+  +   R+ ++V+  DNC ++++   +  L+ L + R   P ++I+A D + +++        +   N+    S +       L +   +P Y+    +      L +K  S +   E F  +   +F   ++++  +        ++ K++    M S  +    + +    L +     +N + +++++ +     ++++  +I+F W  L  W+ L   WP R+  +I+  ++             +H++ L   E +    +H+  +D L+  Q D+++  F  FL+S+   S   L++  +K F   +S L+PY++ +I E             R K L DI         +Q+ S+       +  P   R  F+     M I   L ++    V+NL+  ID + S +L     R   LN+ GLVL+ C L  L+  +++  GD+ + + L      LE+LK+  
Sbjct:  470 VLADIVCEPSLSLPLTIGLYAKWGSG-KSALLAKLKEAM-HSFSRDWLDGVSLSVSFALFFAIFLFFGMFSLTFTMLIA---ISNSVTAYLISWSVFLLIF------IIFCSLIVVVYYGDRKNWYTSMDIANFFARVFSRIRLVYNILTLHAPMNSEDSASMPVSFLFADYHRLSSIGGEQALAKIVATLFEAAETHFGVLPVRLFCCMKPPYPGIHGSLRRHCGVPHVILLIVAVFLLIMAQVFGTVW------LLSDRD--PNNFNLFIAIAFLCGFVMIAIYPLALIIMYSWTNVPRRRVNAAARNAHKLRFEGLMQKLQTEVDLLADMIRSLDAF-TRSHTRLVVVVDGLDNCEQERMVQTLDALELLFSARKHRPFITIIAVDPHVIVS--------AINHNMHSALSGTELTGHDYLKNIISMPFYLHNSALRQLQSKLREKRESMAEWKERF--KRQDTFYGSHLSLREADGR-----TSRKKSTVPNMNSNSV--VGRNMNDGILGEDYFSNMNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALE-------------VHNNQLLLSEVYYQLKDHIPAQDDLM--QLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRE-------------RSKGLVDIE--------AQVGSA------GMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKID-IPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLL------LETLKVFG 1195          
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 67.0106 bits (162), Expect = 7.906e-11
Identity = 70/291 (24.05%), Postives = 133/291 (45.70%), Query Frame = 3
Query: 1977 INTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDIL---ECFNS--EHLNNKDFLLLAQDDKSISIFGNFLESE---SFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD-LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMIS 2822
            +N + +++++ +     ++++  +I+F W  L  W+ L   WP R+  +I+  ++             +H++ L   E +    +H+  +D L+  Q D+++  F  FL+S+   S   L++  +K F   +S L+PY++ +I E             R K L DI         +Q+ S+       +  P   R  F+     M I   L ++    V+NL+  ID + S +L     R   LN+ GLVL+ C L  L+  +++  GD+ + + L      LE+LK+  
Sbjct:  983 MNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALE-------------VHNNQLLLSEVYYQLKDHIPAQDDLM--QLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRE-------------RSKGLVDIE--------AQVGSA------GMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKID-IPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLL------LETLKVFG 1224          
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 67.0106 bits (162), Expect = 8.681e-11
Identity = 70/291 (24.05%), Postives = 133/291 (45.70%), Query Frame = 3
Query: 1977 INTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDIL---ECFNS--EHLNNKDFLLLAQDDKSISIFGNFLESE---SFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD-LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMIS 2822
            +N + +++++ +     ++++  +I+F W  L  W+ L   WP R+  +I+  ++             +H++ L   E +    +H+  +D L+  Q D+++  F  FL+S+   S   L++  +K F   +S L+PY++ +I E             R K L DI         +Q+ S+       +  P   R  F+     M I   L ++    V+NL+  ID + S +L     R   LN+ GLVL+ C L  L+  +++  GD+ + + L      LE+LK+  
Sbjct:  986 MNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALE-------------VHNNQLLLSEVYYQLKDHIPAQDDLM--QLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRE-------------RSKGLVDIE--------AQVGSA------GMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKID-IPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLL------LETLKVFG 1227          
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Match: kdin-1 (KiDINs220 (Vertebrate scaffold protein) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD72])

HSP 1 Score: 67.0106 bits (162), Expect = 8.926e-11
Identity = 70/291 (24.05%), Postives = 133/291 (45.70%), Query Frame = 3
Query: 1977 INTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDIL---ECFNS--EHLNNKDFLLLAQDDKSISIFGNFLESE---SFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD-LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMIS 2822
            +N + +++++ +     ++++  +I+F W  L  W+ L   WP R+  +I+  ++             +H++ L   E +    +H+  +D L+  Q D+++  F  FL+S+   S   L++  +K F   +S L+PY++ +I E             R K L DI         +Q+ S+       +  P   R  F+     M I   L ++    V+NL+  ID + S +L     R   LN+ GLVL+ C L  L+  +++  GD+ + + L      LE+LK+  
Sbjct:  983 MNPRAMRRIVNALTLTGRLMRAFEIDFSWMSLGHWVSLLEQWPSRMCWLIDRALE-------------VHNNQLLLSEVYYQLKDHIPAQDDLM--QLDRNLENFEGFLDSKGIPSAERLTVGHVKKFVPCTSSLDPYLRKLIRE-------------RSKGLVDIE--------AQVGSA------GMAIPPNARLLFSDDLTWMSIDTPLVEMKLDAVVNLIRKID-IPSNRLDSILDRFYQLNLCGLVLATCPLPELKDSMQLPLGDWTLIRLL------LETLKVFG 1224          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302707)

HSP 1 Score: 143.665 bits (361), Expect = 4.388e-34
Identity = 192/840 (22.86%), Postives = 372/840 (44.29%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGI-TINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSD--TDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL----QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFT-------DTTLLPIFVLMTCIIFLGFFGC--LPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEIN---LFQQFSDSFH-LLHSTFHLPVYMD----------EIFSFI--------------PTLPQKTS---FSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMD-YSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEF------PSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY--LEHMSQKLYSSRPKSLGDI-----PTTVIQT-----------NVSQINSSHNINGETLKTPI--FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESL 2810
             LAD+++EP +  P+ VG++ +   G ++  LNKL +E+++   +  E  ++ S LLF+     +++ G ++G+ T + V G+   V  ++L + L+  + + +       A      L K M R+ L+LQ+ FC+P    +D   KP+       N A  P+       ++ ++  A+E  Y  + TRL    +  C   D   R++++CC+P   +V++F LAL+   T +S+     +  FT       +  L+ ++V+      +G   C  L V  KV + LF S  R    +K       S    ++  E+  +  ++   +A+   +Q R+  ++++ D+C+ +++   +  +Q L +     P V +++ D + +          ++E N   LF +     H  L +  HLPVY+           ++ + +              PTL    S    SN +E+      SS E L     G     L +  +   +    +  +  +  ++  + ++ L+     ++N + +++L+       ++LK  +IEF W RL  WI L   WP R ++I+    D+F       S+S ++  +KL   +     +  L     L L +D++ +  F    +S+    L + DL+IF   +  L+PY++ ++ E    +E     +  +RP     +     PTT + +           N    N   + N  T   P+   +        D++    L+ L+ + VI+LL+ I+ M    L +    L +  + G VL  CD+ +L+  L ++FG +++F+ LI  LRE E L
Sbjct:  521 ALADVLSEPTLTTPITVGLYAKWGSG-KSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSAS-PTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIP---IVLIFELALVTVVTGISL----TVAYFTFADEKEKEHILVALYVIAAV---MGTLICTHLHVLAKVFVSLFTSHIRV---LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAF-TNQQSRLVGVIDALDSCDTERILTLLNAVQTLLS-SPNRPFVLLISVDPHVIAK--------AAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEII-----SSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIV-LHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPL-----LELDRDERKLDAFLQLHKSD----LLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPA-LPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERL 1319          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302704)

HSP 1 Score: 143.28 bits (360), Expect = 5.250e-34
Identity = 192/840 (22.86%), Postives = 372/840 (44.29%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGI-TINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSD--TDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL----QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFT-------DTTLLPIFVLMTCIIFLGFFGC--LPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEIN---LFQQFSDSFH-LLHSTFHLPVYMD----------EIFSFI--------------PTLPQKTS---FSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMD-YSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEF------PSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY--LEHMSQKLYSSRPKSLGDI-----PTTVIQT-----------NVSQINSSHNINGETLKTPI--FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESL 2810
             LAD+++EP +  P+ VG++ +   G ++  LNKL +E+++   +  E  ++ S LLF+     +++ G ++G+ T + V G+   V  ++L + L+  + + +       A      L K M R+ L+LQ+ FC+P    +D   KP+       N A  P+       ++ ++  A+E  Y  + TRL    +  C   D   R++++CC+P   +V++F LAL+   T +S+     +  FT       +  L+ ++V+      +G   C  L V  KV + LF S  R    +K       S    ++  E+  +  ++   +A+   +Q R+  ++++ D+C+ +++   +  +Q L +     P V +++ D + +          ++E N   LF +     H  L +  HLPVY+           ++ + +              PTL    S    SN +E+      SS E L     G     L +  +   +    +  +  +  ++  + ++ L+     ++N + +++L+       ++LK  +IEF W RL  WI L   WP R ++I+    D+F       S+S ++  +KL   +     +  L     L L +D++ +  F    +S+    L + DL+IF   +  L+PY++ ++ E    +E     +  +RP     +     PTT + +           N    N   + N  T   P+   +        D++    L+ L+ + VI+LL+ I+ M    L +    L +  + G VL  CD+ +L+  L ++FG +++F+ LI  LRE E L
Sbjct:  469 ALADVLSEPTLTTPITVGLYAKWGSG-KSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSAS-PTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIP---IVLIFELALVTVVTGISL----TVAYFTFADEKEKEHILVALYVIAAV---MGTLICTHLHVLAKVFVSLFTSHIRV---LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAF-TNQQSRLVGVIDALDSCDTERILTLLNAVQTLLS-SPNRPFVLLISVDPHVIAK--------AAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEII-----SSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIV-LHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPL-----LELDRDERKLDAFLQLHKSD----LLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPA-LPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERL 1267          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0342885)

HSP 1 Score: 143.28 bits (360), Expect = 5.405e-34
Identity = 192/840 (22.86%), Postives = 372/840 (44.29%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGI-TINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSD--TDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL----QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFT-------DTTLLPIFVLMTCIIFLGFFGC--LPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEIN---LFQQFSDSFH-LLHSTFHLPVYMD----------EIFSFI--------------PTLPQKTS---FSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMD-YSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEF------PSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITE--IYLEHMSQKLYSSRPKSLGDI-----PTTVIQT-----------NVSQINSSHNINGETLKTPI--FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESL 2810
             LAD+++EP +  P+ VG++ +   G ++  LNKL +E+++   +  E  ++ S LLF+     +++ G ++G+ T + V G+   V  ++L + L+  + + +       A      L K M R+ L+LQ+ FC+P    +D   KP+       N A  P+       ++ ++  A+E  Y  + TRL    +  C   D   R++++CC+P   +V++F LAL+   T +S+     +  FT       +  L+ ++V+      +G   C  L V  KV + LF S  R    +K       S    ++  E+  +  ++   +A+   +Q R+  ++++ D+C+ +++   +  +Q L +     P V +++ D + +          ++E N   LF +     H  L +  HLPVY+           ++ + +              PTL    S    SN +E+      SS E L     G     L +  +   +    +  +  +  ++  + ++ L+     ++N + +++L+       ++LK  +IEF W RL  WI L   WP R ++I+    D+F       S+S ++  +KL   +     +  L     L L +D++ +  F    +    S+L + DL+IF   +  L+PY++ ++ E    +E     +  +RP     +     PTT + +           N    N   + N  T   P+   +        D++    L+ L+ + VI+LL+ I+ M    L +    L +  + G VL  CD+ +L+  L ++FG +++F+ LI  LRE E L
Sbjct:  447 ALADVLSEPTLTTPITVGLYAKWGSG-KSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSAS-PTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIP---IVLIFELALVTVVTGISL----TVAYFTFADEKEKEHILVALYVIAAV---MGTLICTHLHVLAKVFVSLFTSHIRV---LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAF-TNQQSRLVGVIDALDSCDTERILTLLNAVQTLLS-SPNRPFVLLISVDPHVIAK--------AAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEII-----SSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIV-LHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPL-----LELDRDERKLDAFLQLHK----SDLLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPA-LPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERL 1245          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0302703)

HSP 1 Score: 143.28 bits (360), Expect = 5.806e-34
Identity = 192/840 (22.86%), Postives = 372/840 (44.29%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGI-TINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSD--TDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL----QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFT-------DTTLLPIFVLMTCIIFLGFFGC--LPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEIN---LFQQFSDSFH-LLHSTFHLPVYMD----------EIFSFI--------------PTLPQKTS---FSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMD-YSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEF------PSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY--LEHMSQKLYSSRPKSLGDI-----PTTVIQT-----------NVSQINSSHNINGETLKTPI--FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESL 2810
             LAD+++EP +  P+ VG++ +   G ++  LNKL +E+++   +  E  ++ S LLF+     +++ G ++G+ T + V G+   V  ++L + L+  + + +       A      L K M R+ L+LQ+ FC+P    +D   KP+       N A  P+       ++ ++  A+E  Y  + TRL    +  C   D   R++++CC+P   +V++F LAL+   T +S+     +  FT       +  L+ ++V+      +G   C  L V  KV + LF S  R    +K       S    ++  E+  +  ++   +A+   +Q R+  ++++ D+C+ +++   +  +Q L +     P V +++ D + +          ++E N   LF +     H  L +  HLPVY+           ++ + +              PTL    S    SN +E+      SS E L     G     L +  +   +    +  +  +  ++  + ++ L+     ++N + +++L+       ++LK  +IEF W RL  WI L   WP R ++I+    D+F       S+S ++  +KL   +     +  L     L L +D++ +  F    +S+    L + DL+IF   +  L+PY++ ++ E    +E     +  +RP     +     PTT + +           N    N   + N  T   P+   +        D++    L+ L+ + VI+LL+ I+ M    L +    L +  + G VL  CD+ +L+  L ++FG +++F+ LI  LRE E L
Sbjct:  521 ALADVLSEPTLTTPITVGLYAKWGSG-KSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSAS-PTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIP---IVLIFELALVTVVTGISL----TVAYFTFADEKEKEHILVALYVIAAV---MGTLICTHLHVLAKVFVSLFTSHIRV---LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAF-TNQQSRLVGVIDALDSCDTERILTLLNAVQTLLS-SPNRPFVLLISVDPHVIAK--------AAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEII-----SSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIV-LHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPL-----LELDRDERKLDAFLQLHKSD----LLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPA-LPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERL 1319          
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Match: CG42672 (gene:FBgn0261554 transcript:FBtr0342886)

HSP 1 Score: 142.895 bits (359), Expect = 6.125e-34
Identity = 192/840 (22.86%), Postives = 372/840 (44.29%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGI-TINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSD--TDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL----QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFT-------DTTLLPIFVLMTCIIFLGFFGC--LPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEIN---LFQQFSDSFH-LLHSTFHLPVYMD----------EIFSFI--------------PTLPQKTS---FSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMD-YSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEF------PSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY--LEHMSQKLYSSRPKSLGDI-----PTTVIQT-----------NVSQINSSHNINGETLKTPI--FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESL 2810
             LAD+++EP +  P+ VG++ +   G ++  LNKL +E+++   +  E  ++ S LLF+     +++ G ++G+ T + V G+   V  ++L + L+  + + +       A      L K M R+ L+LQ+ FC+P    +D   KP+       N A  P+       ++ ++  A+E  Y  + TRL    +  C   D   R++++CC+P   +V++F LAL+   T +S+     +  FT       +  L+ ++V+      +G   C  L V  KV + LF S  R    +K       S    ++  E+  +  ++   +A+   +Q R+  ++++ D+C+ +++   +  +Q L +     P V +++ D + +          ++E N   LF +     H  L +  HLPVY+           ++ + +              PTL    S    SN +E+      SS E L     G     L +  +   +    +  +  +  ++  + ++ L+     ++N + +++L+       ++LK  +IEF W RL  WI L   WP R ++I+    D+F       S+S ++  +KL   +     +  L     L L +D++ +  F    +S+    L + DL+IF   +  L+PY++ ++ E    +E     +  +RP     +     PTT + +           N    N   + N  T   P+   +        D++    L+ L+ + VI+LL+ I+ M    L +    L +  + G VL  CD+ +L+  L ++FG +++F+ LI  LRE E L
Sbjct:  487 ALADVLSEPTLTTPITVGLYAKWGSG-KSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVVGVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQSDSQAKPVRFHFAEANSAS-PTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVDVGWRWRRMCCIP---IVLIFELALVTVVTGISL----TVAYFTFADEKEKEHILVALYVIAAV---MGTLICTHLHVLAKVFVSLFTSHIRV---LKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAF-TNQQSRLVGVIDALDSCDTERILTLLNAVQTLLS-SPNRPFVLLISVDPHVIAK--------AAEANSRRLFTEGGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSARRLSNASEII-----SSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLTDDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIV-LHHDQFMDSNADESVSLQSVYEKLRPKLAYLREAAPL-----LELDRDERKLDAFLQLHKSD----LLVADLRIFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPPYQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRIEDMKPA-LPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERL 1285          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220b (kinase D-interacting substrate 220b [Source:NCBI gene;Acc:335881])

HSP 1 Score: 161.77 bits (408), Expect = 1.366e-39
Identity = 184/838 (21.96%), Postives = 369/838 (44.03%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMD-----EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNING-------------------ETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSED----IGELSP 2858
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ L           VLG T++    I + ++ + L++    ++ FGS  RR  ++   +  ++  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     L++   LL+++         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +  T + +  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++              P      N+            E L+  +S          GSK+T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  + +LK +++ I +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++       +M+   Y + P   G  P ++     S  + + + NG                      + P + R   + V     I  LS +S   +   +  ID +D   + +Y   +   N+ G VLS C++D L++E+ MNFGD+Q+F+  +L +R +E+  +     SE     +G + P
Sbjct:  455 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLFQFSWLVVLLSLLLCGSVALVLGFTVDPKLAIAISLSILALLYVFFVVVYFGS--RREGESWNWAWVISTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILGCLIMGMALLAVFKVDGQNQTVNAVLVSMASVVGLALLLNCRTWWQVTDSVLNSQRKRLHSAANKMHKLKSEGFMKV---LKNEVELMAKMAKTIDGF-TQNQTRLVVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSSAKKMCAPAPANGETGNSEGW--------HEELDRKLSQNSLGDQTKFGSKTT-LNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETDGIPDQTNLKTIYERISKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PVLAARDIRTFLPCTVNLDPKLREIIADVRAAREQVNMAGVTYPTLPLQEGR-PISMYSQQSSACSPTASFNGPYNPPGVSPQPHSAYFSGMAGPQHPFYNRGSASVVSGTPSIL-LSSMSTDVICERVKLIDGIDQNLISQYTATIKKANINGRVLSQCNIDELKKEMNMNFGDWQLFRTSVLEMRHVENQVLHEEAPSEQGSITVGHVEP 1253          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 157.147 bits (396), Expect = 3.875e-38
Identity = 182/812 (22.41%), Postives = 364/812 (44.83%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----GSKSTPLPIVSANKQNCSIKME-----SIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKL------------YSSRPKS-----------LGDIPTTVIQTNV---SQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ +           VLG  ++    I + +  + L++    ++ FG  GR++ ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K+ +++ + +K+ CCVP+FVL ++    L+    LL+I+      +  +  L+ +  ++   + L       V   VL    +    A + M  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++     + T  +    +  N    L   +  E ++  +S    G +       + N+++   + +     + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E   ++   +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++        L             S RP S            G  P +     V   +Q +SS+       + P + R         +    LS L+   V   L  I  +DS+ L +Y   +   NV G VLS C+LD L++E+ MNFGD+ +F++ ++  R  E
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLFQFSWLVVVLTLLLCGSVALVLGFAVDTKLAIAVALTLLALMYIFFVLVYFG--GRKAGESWSWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKNDEAQGKKWKKTCCVPSFVLFVLTSGCLITGMALLAIFKVDSENLTVNAVLISMASVVGLALLLNCRTWWQVADSVLHSQRRRLLNAANRMHKLKSEGFMKV---LKCEVELMAKMAKTIDSF-TQNQTRLAVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIIHLPVFLNS--RGLSTAKRLCISTAANGADQLNNDAWQEDVDRKLSQNSLGDQGRQGSKTALNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQIIFNWDRLASWINLTEEWPYRTSWIILF-LEETDGVTDLVTLKTIYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSHT-PVLTARDVEMFLPCTVNLDPKLREIIADVRDAREQMHLGGVSFPTLPLQDASVRPHSGFGQQSLACSPTGSFPGSFPNAGVLPATQPHSSYFSGLTGPQHPFYNRGSVVSSGSQVL---LSSLTIDGVCEKLRQIQGLDSSMLEQYIGTIKKANVNGRVLSQCNLDELKKEMNMNFGDWHLFRSTVVEQRHAE 1232          
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Match: kidins220a (kinase D-interacting substrate 220a [Source:ZFIN;Acc:ZDB-GENE-041014-170])

HSP 1 Score: 121.324 bits (303), Expect = 4.288e-27
Identity = 140/648 (21.60%), Postives = 300/648 (46.30%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----GSKSTPLPIVSANKQNCSIKME-----SIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ +           VLG  ++    I + +  + L++    ++ FG  GR++ ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K+ +++ + +K+ CCVP+FVL ++    L+    LL+I+      +  +  L+ +  ++   + L       V   VL    +    A + M  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++     + T  +    +  N    L   +  E ++  +S    G +       + N+++   + +     + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E   ++   +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLFQFSWLVVVLTLLLCGSVALVLGFAVDTKLAIAVALTLLALMYIFFVLVYFG--GRKAGESWSWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKNDEAQGKKWKKTCCVPSFVLFVLTSGCLITGMALLAIFKVDSENLTVNAVLISMASVVGLALLLNCRTWWQVADSVLHSQRRRLLNAANRMHKLKSEGFMKV---LKCEVELMAKMAKTIDSF-TQNQTRLAVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIIHLPVFLNS--RGLSTAKRLCISTAANGADQLNNDAWQEDVDRKLSQNSLGDQGRQGSKTALNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQIIFNWDRLASWINLTEEWPYRTSWIILF-LEETDGVTDLVTLKTIYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSHT-PVLTARDVEMFLPCTVNLDPKLREIIADV 1071          

HSP 2 Score: 58.151 bits (139), Expect = 7.434e-8
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 3
Query: 2154 ISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESE-----------SFSNLSIVDL-KIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
            + PK  L+++  D+ +     HL    F  L   D S+     F +             SF N  ++   +  SS+ S L           Y  H    L  + P      PT       S+++    +    +K+  F  K  + V    ++  LS L+   V   L  I  +DS+ L +Y   +   NV G VLS C+LD L++E+ MNFGD+ +F++ ++  R  E
Sbjct: 1060 LDPK--LREIIADVRDAREQMHLGGVSFPTLPLQDASVRPHSGFGQQSLACSPTGSFPGSFPNAGVLPATQPHSSYFSGLTGPQHPFYNRPYFPHHVYHLPRNYPGHPHHAPTRP----ASKLHKDPGLG--LIKSQPFRMKQGSVVSSGSQVL-LSSLTIDGVCEKLRQIQGLDSSMLEQYIGTIKKANVNGRVLSQCNLDELKKEMNMNFGDWHLFRSTVVEQRHAE 1279          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 167.548 bits (423), Expect = 3.655e-41
Identity = 183/815 (22.45%), Postives = 371/815 (45.52%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLL-FLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN-EMFCLRGGSS-FESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----------HMSQKLYSSRPKSL----------------GDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLR 2795
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ FL     S I G +L  T++   GI + ++ + +++     + FG  GRR  +    +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      ++T  + ++K+ CC+P+FV+ I   L +     LL+I+      M    T+  I + + C++ L F      + +V+  +  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K+   +++L  +  + +  P ++I A+D + +I        I+  +N   + S+      + +  HLPV+++     +    +  S S TN ++ C+  GS   E L+  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  +++LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++             + +  L  + P++                 G  P  V+     Q  SS+       + P + R   + V        L+ ++   V   L  ID ++ + L +Y   +   N+ G VL+ C +D L++E+ MNFGD+ +FK+ +  +R
Sbjct:  447 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTI-GLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFG--GRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNM----TVNAILIAVACVVGLVFVLNCRTWWQVMDSILNSQRKRLHGAASKLHKLKSEGFMKV---LKWEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDACEQDKV---LHMLDTVRILFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSNAKKLCSISATNGDVGCMESGSGGHEDLDRRVSQHSLAEASKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFHWDRLASWINLTEQWPYRTSWLI-LYLEETEGVPDQSTLKTIYERISKNIPT----TKDVEPLLEIDSDIRSFEVFLASRT-PVLIARDVKTFLPCTVNLDPKLREIIADVRAARDQMNIGGFPYPTLPLQDAPPRATSVFSQPSSVCSSSSFNGPFPAGVMS---PQPPSSYYSGMTGPQHPFYNRATSSSVA-GAHSSALAAMNVDGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMR 1224          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 164.081 bits (414), Expect = 4.077e-40
Identity = 178/804 (22.14%), Postives = 367/804 (45.65%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLL-FLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN-EMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSSRPKSL----------------GDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLR 2795
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ FL     S I G +L  T++   GI + ++ + +++     + FG  GRR  +    +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      ++T  + ++K+ CC+P+FV+ I   L +     LL+I+      M    T+  I + + C++ L F      + +V+  +  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K+   +++L  +  + +  P ++I A+D + +I        I+  +N   + S+      + +  HLPV+++     +    +  S S TN ++ C+  G   E L+  +S    + L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  +++LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++             + +  L  + P++                 G  P  V+     Q  SS+  +G T     F  +    +        L+ ++   V   L  ID ++ + L +Y   +   N+ G VL+ C +D L++E+ MNFGD+ +FK+ +  +R
Sbjct:  414 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTI-GLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFG--GRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNM----TVNAILIAVACVVGLVFVLNCRTWWQVMDSILNSQRKRLHGAASKLHKLKSEGFMKV---LKWEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDACEQDKV---LHMLDTVRILFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSNAKKLCSISATNGDVGCMESGG-HEDLDRRVS--HKSILCTCDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFHWDRLASWINLTEQWPYRTSWLI-LYLEETEGVPDQSTLKTIYERISKNIPT----TKDVEPLLEIDSDIRSFEVFLASRT-PVLIARDVKTFLPCTVNLDPKLREIIADVRAARDQMNIGGFPYPTLPLQDAPPRATSVFSQPSSVCSSSSFNGPFPAGVMS---PQPPSSY-YSGMTGPQHPFYNRVGAVLVAGAHSSALAAMNVDGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMR 1178          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 139.428 bits (350), Expect = 1.603e-32
Identity = 149/654 (22.78%), Postives = 308/654 (47.09%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLL-FLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN-EMFCLRGGSS-FESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ FL     S I G +L  T++   GI + ++ + +++     + FG  GRR  +    +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      ++T  + ++K+ CC+P+FV+ I   L +     LL+I+      M    T+  I + + C++ L F      + +V+  +  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K+   +++L  +  + +  P ++I A+D + +I        I+  +N   + S+      + +  HLPV+++     +    +  S S TN ++ C+  GS   E L+  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  +++LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  447 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTI-GLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFG--GRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNM----TVNAILIAVACVVGLVFVLNCRTWWQVMDSILNSQRKRLHGAASKLHKLKSEGFMKV---LKWEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDACEQDKV---LHMLDTVRILFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSNAKKLCSISATNGDVGCMESGSGGHEDLDRRVSQHSLAEASKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFHWDRLASWINLTEQWPYRTSWLI-LYLEETEGVPDQSTLKTIYERISKNIPT----TKDVEPLLEIDSDIRSFEVFLASRT-PVLIARDVKTFLPCTVNLDPKLREIIADV 1067          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 139.043 bits (349), Expect = 2.156e-32
Identity = 149/654 (22.78%), Postives = 308/654 (47.09%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLL-FLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN-EMFCLRGGSS-FESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ FL     S I G +L  T++   GI + ++ + +++     + FG  GRR  +    +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      ++T  + ++K+ CC+P+FV+ I   L +     LL+I+      M    T+  I + + C++ L F      + +V+  +  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K+   +++L  +  + +  P ++I A+D + +I        I+  +N   + S+      + +  HLPV+++     +    +  S S TN ++ C+  GS   E L+  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  +++LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  447 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTI-GLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFG--GRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNM----TVNAILIAVACVVGLVFVLNCRTWWQVMDSILNSQRKRLHGAASKLHKLKSEGFMKV---LKWEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDACEQDKV---LHMLDTVRILFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSNAKKLCSISATNGDVGCMESGSGGHEDLDRRVSQHSLAEASKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFHWDRLASWINLTEQWPYRTSWLI-LYLEETEGVPDQSTLKTIYERISKNIPT----TKDVEPLLEIDSDIRSFEVFLASRT-PVLIARDVKTFLPCTVNLDPKLREIIADV 1067          

HSP 2 Score: 53.9138 bits (128), Expect = 1.962e-6
Identity = 32/116 (27.59%), Postives = 57/116 (49.14%), Query Frame = 3
Query: 2508 GETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELS 2855
             ETL +PI      +          L+ ++   V   L  ID ++ + L +Y   +   N+ G VL+ C +D L++E+ MNFGD+ +FK+ +  +R  ++   I   +   +GE S
Sbjct: 1186 AETLSSPIRAFLATSSSVAGAHSSALAAMNVDGVCEKLKGIDGIEQSMLPQYTATIRKANINGRVLTQCTMDELKKEMNMNFGDWHLFKSALHEMRSSDT--QIQPEEGRMVGEPS 1299          
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Match: rab4b (RAB4B member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-946075])

HSP 1 Score: 138.658 bits (348), Expect = 2.806e-32
Identity = 145/644 (22.52%), Postives = 305/644 (47.36%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLL-FLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN-EMFCLRGGSS-FESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ FL     S I G +L  T++   GI + ++ + +++     + FG  GRR  +    +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      ++T  + ++K+ CC+P+FV+ I   L +     LL+I+      M    T+  I + + C++ L F      + +V+  +  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K+   +++L  +  + +  P ++I A+D + +I        I+  +N   + S+      + +  HLPV+++     +    +  S S TN ++ C+  GS   E L+  +S    + L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  +++LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  447 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILMLCSTI-GLLLSFTVDPKLGISVALSLLTVLYIFFAAVYFG--GRREGENWNWAWVLSTRLARQIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEETQGKKKWKKTCCLPSFVIFIFIMLCIFAGVLLLAIFKVDPKNM----TVNAILIAVACVVGLVFVLNCRTWWQVMDSILNSQRKRLHGAASKLHKLKSEGFMKV---LKWEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDACEQDKV---LHMLDTVRILFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSNAKKLCSISATNGDVGCMESGSGGHEDLDRRVS--HKSILCTCDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFHWDRLASWINLTEQWPYRTSWLI-LYLEETEGVPDQSTLKTIYERISKNIPT----TKDVEPLLEIDSDIRSFEVFLASRT-PVLIARDVKTFLPCTVNLDPKLREIIADV 1056          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 157.147 bits (396), Expect = 4.374e-38
Identity = 185/816 (22.67%), Postives = 367/816 (44.98%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR--FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSS--RPKSLGDIPTTVIQTNVS------------QINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G V   T++    I + ++ + L++    +I FG  GR+  ++   +  L+  + R    ++LL +++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K  DS+ +  +K+ CC+P+F++ +     ++   TLL+I+      +    T+  I + +  I+ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++            TS +N  ++ C       E  +  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   + E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++           L +    L+ +  RP S    P +V  ++ S            Q +SS+       + P + R        ++    LS ++   V   L  I+ +D   L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++++L +R +E
Sbjct:  404 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILLLCGGLGLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFG--GRQEGESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAIFRVDPKHL----TVNAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATN-GDISCSEATGVQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLI-LYLGETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKTFLPCTVNLDPKLREIIADVRAAREQINIGGLAYPPLPLHEAPPRPPSGYSQPASVCSSSASFNGPFPGGVVSPQPHSSYYSGLSGPQHPFYNRASVPATGTSLL---LSSMTVDIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1182          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 145.206 bits (365), Expect = 1.417e-34
Identity = 191/855 (22.34%), Postives = 376/855 (43.98%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR--FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSF---SNTN-EMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSS--RPKSLGDIPTTVIQTNVS------------QINSSHNINGETLKTPIFVRKCF--------------------TKVKDNM-RIKD--------------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G V   T++    I + ++ + L++    +I FG  GR+  ++   +  L+  + R    ++LL +++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K  DS+ +  +K+ CC+P+F++ +     ++   TLL+I+      +    T+  I + +  I+ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++        L     F   S TN ++ C       E  +  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I + + E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++           L +    L+ +  RP S    P +V  ++ S            Q +SS+       + P + R  F                    + VK ++ R ++              LS ++   V   L  I+ +D   L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++++L +R +E
Sbjct:  276 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILLLCGGLGLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFG--GRQEGESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAIFRVDPKHL----TVNAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS-----RGLSNARKFLVTSATNGDISCSEATGVQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLILY-LGETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKTFLPCTVNLDPKLREIIADVRAAREQINIGGLAYPPLPLHEAPPRPPSGYSQPASVCSSSASFNGPFPGGVVSPQPHSSYYSGLSGPQHPFYNRPFFAPYLYTPRYYPGGSQHLISRSSVKTSLPRDQNNGLASVPATGTSLLLSSMTVDIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1092          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 117.087 bits (292), Expect = 8.471e-26
Identity = 146/654 (22.32%), Postives = 295/654 (45.11%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR--FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G V   T++    I + ++ + L++    +I FG  GR+  ++   +  L+  + R    ++LL +++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K  DS+ +  +K+ CC+P+F++ +     ++   TLL+I+      +    T+  I + +  I+ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++            TS +N  ++ C       E  +  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   + E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILLLCGGLGLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFG--GRQEGESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAIFRVDPKHL----TVNAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATN-GDISCSEATGVQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLI-LYLGETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKTFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 59.3066 bits (142), Expect = 4.225e-8
Identity = 26/74 (35.14%), Postives = 47/74 (63.51%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
            LS ++   V   L  I+ +D   L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++++L +R +E
Sbjct: 1230 LSSMTVDIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1303          
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Match: Kidins220 (kinase D-interacting substrate 220 [Source:MGI Symbol;Acc:MGI:1924730])

HSP 1 Score: 116.701 bits (291), Expect = 1.049e-25
Identity = 146/654 (22.32%), Postives = 295/654 (45.11%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR--FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G V   T++    I + ++ + L++    +I FG  GR+  ++   +  L+  + R    ++LL +++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K  DS+ +  +K+ CC+P+F++ +     ++   TLL+I+      +    T+  I + +  I+ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++            TS +N  ++ C       E  +  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   + E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLILLLCGGLGLVFAFTVDTNLAIAVSLSFLALLYIFFIVIYFG--GRQEGESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDSQGKKKWKKTCCLPSFIIFLFIVGCIIAGITLLAIFRVDPKHL----TVNAILISIASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATN-GDISCSEATGVQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLI-LYLGETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKTFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 58.9214 bits (141), Expect = 4.359e-8
Identity = 26/74 (35.14%), Postives = 47/74 (63.51%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELE 2804
            LS ++   V   L  I+ +D   L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++++L +R +E
Sbjct: 1200 LSSMTVDIVCEKLRQIEGLDQGMLPQYCTTIKKANINGRVLAQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVE 1273          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q7T163|KDISB_DANRE (Kinase D-interacting substrate of 220 kDa B OS=Danio rerio OX=7955 GN=kidins220b PE=1 SV=3)

HSP 1 Score: 161.77 bits (408), Expect = 1.095e-38
Identity = 184/838 (21.96%), Postives = 369/838 (44.03%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMD-----EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNING-------------------ETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSED----IGELSP 2858
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+ L           VLG T++    I + ++ + L++    ++ FGS  RR  ++   +  ++  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     L++   LL+++         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +  T + +  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++              P      N+            E L+  +S          GSK+T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  + +LK +++ I +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++       +M+   Y + P   G  P ++     S  + + + NG                      + P + R   + V     I  LS +S   +   +  ID +D   + +Y   +   N+ G VLS C++D L++E+ MNFGD+Q+F+  +L +R +E+  +     SE     +G + P
Sbjct:  455 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLFQFSWLVVLLSLLLCGSVALVLGFTVDPKLAIAISLSILALLYVFFVVVYFGS--RREGESWNWAWVISTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILGCLIMGMALLAVFKVDGQNQTVNAVLVSMASVVGLALLLNCRTWWQVTDSVLNSQRKRLHSAANKMHKLKSEGFMKV---LKNEVELMAKMAKTIDGF-TQNQTRLVVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSSAKKMCAPAPANGETGNSEGW--------HEELDRKLSQNSLGDQTKFGSKTT-LNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETDGIPDQTNLKTIYERISKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PVLAARDIRTFLPCTVNLDPKLREIIADVRAAREQVNMAGVTYPTLPLQEGR-PISMYSQQSSACSPTASFNGPYNPPGVSPQPHSAYFSGMAGPQHPFYNRGSASVVSGTPSIL-LSSMSTDVICERVKLIDGIDQNLISQYTATIKKANINGRVLSQCNIDELKKEMNMNFGDWQLFRTSVLEMRHVENQVLHEEAPSEQGSITVGHVEP 1253          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q9ULH0|KDIS_HUMAN (Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3)

HSP 1 Score: 120.553 bits (301), Expect = 4.673e-26
Identity = 146/653 (22.36%), Postives = 295/653 (45.18%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDE-----IFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G +   T++   GI + ++ + L++    +I FG  GRR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +DT  + ++K+ CC+P+FV+ +     ++   TLL+I+      +  +  L+ I      ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++         F+ T         ++            S N    M   GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K+F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLFAFTVHPNLGIAVSLSFLALLYIFFIVIYFG--GRREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPSFVIFLFIIGCIISGITLLAIFRVDPKHLTVNAVLISI----ASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHNAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDVPCSDTTGIQEDADRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETEGIPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKVFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 59.3066 bits (142), Expect = 2.555e-7
Identity = 27/75 (36.00%), Postives = 47/75 (62.67%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
            L+ L+   V   L  I+ +D + L +Y T +   N+ G VL+ C++D L++E+ MNFGD+ +F++ +L +R  ES
Sbjct: 1207 LNSLNVDAVCEKLKQIEGLDQSMLPQYCTTIKKANINGRVLAQCNIDELKKEMNMNFGDWHLFRSTVLEMRNAES 1281          
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Match: sp|Q9EQG6|KDIS_RAT (Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus OX=10116 GN=Kidins220 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.279e-25
Identity = 144/654 (22.02%), Postives = 297/654 (45.41%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAIS----------GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEI 2390
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+           G V   T++    I + ++ + LI+    +I FG  GRR  ++   +  L+  + R    ++LL +++F  P +        +P+      +N             ++ ++  A E+++  + TRL      +++  + ++K+ CC+P+FV+ +     ++   TLL+I+      +    T+  I + +  ++ L F      + +VL  L  S  +    A S++  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D C + K      +LQ L T+R   +  P ++I A+D + +I        I+  +N   + S  +    + +  HLPV+++            TS +N  ++ C     + E  +  +S          GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   +  + +LK +++ I +   +     KD   L + D  I  F  FL S +   L   D+K F   +  L+P ++ II ++
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQTEPLFQFSWLIVFLTLLLCGGLGLVFAFTVDTNLAIAISLSFLALIYIFFIVIYFG--GRREGESWNWAWALSTRLARHIGYLELLFKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFRTEESQGKKKWKKTCCLPSFVIFLFIVGCIIAGITLLAIFRVDPKHL----TVNAILISIASVVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKV---LKCEVELMARMAKTIDSF-TQNQTRLVVIIDGLDACEQDK------VLQMLDTVRVLFSKGPFIAIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATN-GDITCSDTTGTQEDTDRRVSQNSLGEMTKLGSK-TALNRRDTYRRRQMQRTITRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQITFNWDRLASWINLTEQWPYRTSWLI-LYLEETEGLPDQMTLKTIYERISKNIPT----TKDVEPLLEIDGDIRNFEVFLSSRT-PVLVARDVKTFLPCTVNLDPKLREIIADV 1065          

HSP 2 Score: 62.003 bits (149), Expect = 4.017e-8
Identity = 27/75 (36.00%), Postives = 49/75 (65.33%), Query Frame = 3
Query: 2583 LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
            LS ++   V   L  I+ +D + + +Y T +   N+ G VLS C++D L++E+ MNFGD+ +F++++L +R +ES
Sbjct: 1199 LSSMTVDVVCEKLRQIEGLDQSMMPQYCTTIKKANINGRVLSQCNIDELKKEMAMNFGDWHLFRSMVLEMRSVES 1273          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A5K4F683 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 3.911e-60
Identity = 224/950 (23.58%), Postives = 430/950 (45.26%), Query Frame = 3
Query:  492 RVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSES-RFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSP------------------------ARAISEMKN----------------IENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDW---TLLTPISSEI-NLFQQFS--------DSFHLLHSTFHLPVYMD-EIFSFIPTLPQK---------------TSFSNTNEMF-------------------------CLRGG---SSFESLNMAISGSKSTPLPIVSANKQNCSIKME-SIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPS---ISPKASLKKLHDDILECF--NSEHLNNKDFLL--LAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEH----------------MSQKLYSSRPKSLGDIP--------TTVIQTN------VSQINSSHNI--------NGETLKTP--IFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLR--ELESLKMISLTDSEDIGELSPQIFD 2870
               N I+VLAD+ T      P+ VGIF +        +L++LA E+ +    +N I L+ S+LLF+FP   S I G+ +G+  NW  G+ +G   M +    + +I+ GS+  +   A+ AS  +A F++ + L L I FCYP  +     P+  I++ H +    + +    ++VE +W  + + Y +IL RLQ + K + + + ++K+VCC+P F+++I F++A +I+++++ +Y  +   +     LL +FV+M+ I+FL F G LP   +++  L  +P                         ++I ++ +                +E       D  +K E  ++C L  TF+ +   +Q R  + ++++    +  LA  +Y + NL       P   +L A+F  L+ D    T+L+P ++   N F Q S        D+FHL+H++ +LP+Y++  IF+ +P + +                  +S+ N  F                         C+      + F++ +   S ++     I+S N +    K+E + E ++S+  I  +FL   +L + N KVIKQL++S  F  ++LK+  +    + ++ W+ L  +WP+    +I ++ D   S    S K    ++  +++E F    + +     +L  LA +D+ +     FL S+S + + +  LK   + S   NP+I   I  +           L H                 +Q L   + +    +P        +++ QTN         ++S+ N+        +  T+ T    F + C  ++K       + Q +  +V  L + I  +  + +  Y +++  LN+ G+VLS+CDL++L++EL +   D+Q+   LI +LR    +  +  S +  + +G +S   FD
Sbjct:   66 HAANTIRVLADMFTCRLSNFPMTVGIFTQQN---NKEYLSQLASELHNLNRLENPIPLKFSKLLFIFPLVISAILGYFVGMLTNWQVGLSIGHIGMFIQITFLALIITGSRFCQKPFAIRASYSIACFLQWIKLFLNICFCYPVRSINTKTPVRVIVVYHRICPSSTTNMALFSLVEKMWFGLVRHYGQILIRLQRAGKPSGNPNIKYKRVCCLPAFIVMIAFWIAFLISTSIIRLYSGQLTKLLGHGGLLSLFVIMSSIMFLSFVGSLPSIFRIIKGLLINPITPIKTALTTFLQSNNDIDKEFFITKSIGKLNDTLMYSSSTSFKDLAITVEEKKACKADLFIKSEFAKLCNLSITFDQFNNIQQTRFILCLDASSILQKDLLAKLIYQIHNLLLTVINAPVAIVLEANFKILLGDLVCSTILSPNNTTFCNSFTQESKFIAQIVGDNFHLVHASLYLPIYLEPPIFTDLPEIKKSNNEQMKHNQLLHSSLNGYSSANATFQSSIISTSEISTISVSSKKVSSSPNCVSSHVPRAMFDNFHGTNSNNRHCS-KIISINNEKEQNKIEVTEENEFSVNDIASMFLHNHELADWNGKVIKQLVLSTAFTYRLLKLYNMNIEIELVVLWVTLVHHWPYHTTWLIIYLEDLNASNSLNSDKEQSPEMKINLMEAFLEIKKRVGESIEILEALATEDRDLERLKKFLYSKSSTQVPVNSLKQLIACSLIHNPFIHYSIQALVGMINGRQSSGLHHSFFNPLDAVIEEKSDTTNQSLALDKVRQTNSVPIYASIQLNSSIGQTNQMGCKTTGSLSSAENLPPNAYWPCSSGTITTGDNFFNKPCPIRLKKRYPSLPIHQFTVNDVCELFSSIVDIHPSHMQSYISKIKQLNINGIVLSVCDLESLRQELMIEISDWQVIYKLITWLRSSSTDGHRTFSESSQQRLGGISSNEFD 1011          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A4E0RMV2 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_001102 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 7.024e-49
Identity = 220/960 (22.92%), Postives = 398/960 (41.46%), Query Frame = 3
Query:  375 NEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQ--TQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTD-SESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI---------------------------------------------SEMKNI----ENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWT--------LLTPISS-EINLFQQFSDSFHLLHSTFHLPVYMDE-IFSFIPTLPQ-----------------------------------KTSFSNTNEMFCLRGG---SSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSIS---PKASLKKLHDDILECFN---SEHLNNKDFL-LLAQDDKSISIFGNFLESESFSNLSIVDLKIFSS----HSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQIN-SSHNIN---------------------GETLKTPIFVRKC----FTKVKDNMRIKD------------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
            ++   P+T     S   D    L L +F       T   +    N I+ LAD+ T      P+  GIF  TT   +  +L++LA E+ +       + L+ S LLFLFP   S   G+++G+   W  G+ +G   M L    + +I+ GS+   +  A   S  +A+F+  + L+L + FCYP+       P+  I++ H L    + +    ++++ +W  + + + +I  RLQ + + +     RFK+VCC+P F++V+ F ++ M  + ++  Y      M T+   + IFV+ + I+FLG FG +P   +++  L  +P + +                                             + +KN+    E       D L+K    ++C L  TF+ + + +Q R  I +++++      LA  +Y + +L    +T P   +L A+F  L+ D          L TP +    +  +  SD+ HL++S+ HLP+Y++  +F+ + + PQ                                   ++ F N   +   RGG   SS + L   +S S ST    +S + + C             + I  +FL   +L + N K++KQL+ +  F  + L++  +E   + +I WI L   WP+ I  ++ ++       S    K    +   ++++CF    +    + D L  L +DD+ +     +L +++   +SI +LK   S    H+ FL   I++ I        S+              TT+++  V     ++ NI                      G T    +    C     T  +   RI              LSQ +  +V NL+++I  ++      YQT + D NV+GLV+   D + L+ E+ MN  D+Q F   + YL   ES
Sbjct:   22 DDSKQPVTPSSTQSKRNDLDTLLELGAFHCPLDLITADVKNHGTNTIRALADMFTCRLTNFPVTTGIF--TTQNDKE-YLSRLASELRNISRLSGPVALRFSVLLFLFPLFVSTFLGYLVGMLTTWQVGLSIGHVGMFLQITFLVIIITGSRVCHNHIATRISHSVAQFLRWLQLILNVCFCYPTQQIDTKAPVKTIVVYHRLWPSTTPNVALFSMIDKMWTGLIRMHGEISIRLQRASRASPLPNRRFKRVCCLPAFLVVLAFCVSFMTETGMIRYYSGEFTAMLTEKGTIVIFVISSSILFLGLFGSIPSLYRLIRSLTINPVQPLRTALADFLSDEANEEEYNHLRPQGKHTCLPRRVAQPSEPVVLGNSTSLKNMAITAEEERARRADILIKEVFTQLCKLSITFDRFLSDQQTRFIICLDASETKQCDVLAKLIYQIHSLVLTESTAPVAFVLEANFKVLLGDTVASAICPPYLGTPNTGVPEDAPRTLSDNLHLINSSIHLPIYLEAPLFTDVESEPQSKDLTPNSVNVSPNGFPHPAPAQSAKRTSGIMYTPRSIFGNRGSVAPFRGGPEKSSTQLLTGQLSHSNST----LSRSVETC-------------QGIAGIFLRDHELADWNGKMMKQLISATSFTSRFLRLCNLEVPIEEMILWITLVEYWPYHIAWLVVYLEGLVEGKSYGMGKPVSNQTGINLIDCFQEVKARVAASIDQLEPLVEDDRDLERLEGYLRAKASRPISIGNLKKLISCVLIHNPFLRHCIRAQILNPDRRSASEDRRGGHLGPFSPALTTLVEGQVDSFRKTNQNIGSSGPYAMNRSNSGKGRLSIPLGPTDAQGVHFFPCNADLLTSAEQTPRISYEGHTKEIGQHLLLSQYTVSDVCNLIDNIREIEPEHKYIYQTNVRDHNVSGLVICRTDSERLKHEIGMNQSDWQAFCRSVQYLHGQES 961          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A4Z2DVE7 (Kinase D-interacting substrate OS=Schistosoma japonicum OX=6182 GN=EWB00_004527 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 7.398e-47
Identity = 169/652 (25.92%), Postives = 287/652 (44.02%), Query Frame = 3
Query:  468 NQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSES-RFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSP---------------------------ARAISEMK-------------NIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLF------------QQFSDSFHLLHSTFHLPVYMD-EIFS----------------------------FIPTLPQKT----SFSNTNEMF--------CLRGGSSFESLNMAIS-----GSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLII 2126
            N +        N I+VLAD+ T      P+ VGIF++        +L+ LA E+ +     N I L+ S+LLF+FP   S I G+ +G+  NW  G+ +G   M +    + +I+ GS+      A+ AS  +A F+  V L L + FCYP  +     P+  I++ H +    + +    ++VE +W  + + Y +IL RLQ + K + S S ++K+VCC+P FV++I F+++ +I+++++ +Y  +   +     LL +FV+M+ I+FL FFG LP   +++  L  +P                           A  ++E               + E       D  VK E  ++C L  TF+ +   +Q R  + ++++    +  LA  +Y + NL     + P   +L A+F  L+ D      +SS    F            Q  SD+ HL+H++ HLP+Y++  IF+                             IPTL  KT      SN N           C+         N +         KS  +P+ S  +QN  I         +   I ++FL   +L + N KVIKQL++S  F  ++LK+  +      ++ WI L  +WP+    +I
Sbjct:   58 NNSPDVNNHAANTIRVLADMFTCRLSNFPMTVGIFSQQN---NKEYLSHLASELHNLDRFGNPIPLKFSKLLFIFPLVISAILGYFVGMLTNWQVGLSIGHIGMFIQITFLALIITGSRFCHKPMAIRASYSVACFLHWVKLFLSVCFCYPIKSVNTKTPVRLIVVYHRICPSSTTNIALFSLVEKMWFGLLRHYGQILIRLQRAGKPSGSPSCKYKRVCCLPAFVVMIAFWISFLISTSIMRLYSGQLAKLLGHGGLLSLFVIMSSIMFLSFFGSLPSLFRIIKGLLINPITPVKSALAAFLQTNNEMDKEFYNTKSAGKVNEAAFLASSTSFKDLAISAEEQRACKADLFVKSEFAKICNLSVTFDRFTNTQQTRFILCLDASSTSQKDLLAKLIYQIHNLILSDISAPVAVVLEANFKILLGDLVCSAILSSYSAAFCSNLTLEPKLITQIVSDNVHLVHASLHLPIYLEPPIFTDFNELTKSYNEHSKQNQHSHSSLNDYSPMIPTLQPKTISTGVISNINTTSRKVSCNPNCISSNIPRAMFNNSYGTHMNNQQKSKIIPVNSETEQN-KIDFTGEYEIINFSDIARMFLHNHELADWNGKVIKQLVLSTTFTYRLLKLYNMNIETGLIVTWITLVHHWPYHTTWLI 705          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A3Q3QP05 (ANK_REP_REGION domain-containing protein OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 5.483e-41
Identity = 187/812 (23.03%), Postives = 374/812 (46.06%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRL---LFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTP--LPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSS--------RPKSLGDIPTTVIQTNVS-------QINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L   L L  C S  +   +LG ++N    I + +  + +++    ++ FGS  RR  ++   +  ++  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K+ + + + +K+ CCVP+FVL  +    L+    LL+I+      +    T+  + + M  ++ L     +  + +V   +F S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++    FI       + ++  E+F   G +  E L+  +S +   P  + I S N  N        +M  S+ +     + +L +++    +I+ + +++L+       ++L+ N+I F WDRL  WI L   WP+R + II F ++E   +S + +LK +++ + +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       +M    Y +        RP+S    P+     + +       Q +S++       + P + R     +        LS ++   V   L  ID +D   L +Y + +   N+ G VLS C+LD L++E+EMNFGD+Q+F+ +++  R  ES  ++
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLTLLLCGSVTV---ILGFSVNPKLAIAVSLTLLTILYIFFVLVYFGS--RRERESWNWAWVISTRLARQVGYMELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDEVQGKKWKKTCCVPSFVLFALTVGCLITGLALLAIFKVDPDNL----TINAVLIAMASVVGLALLLNIKTWWQVADSVFNSQRKRLHSAANNLHKLKSEGFMKVLKHEVELMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS-RGFIKAKKLCMAAASNGEVFLAEGCN--EDLDRKLSQNSLGPDQVKIGSKNTLNRRDTYRRRQMQRSITRQMSFDLTKLLVTEDWFSDISPQTMRRLVNIVSITGRLLRANQIIFNWDRLASWINLTEEWPYRTSWIILF-LEENDGVSDQVTLKTIYERLSKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PVLTARDVEMFLPCTVNLDPKLREIIADVRAAREQMNMGGVTYPTLPLQEAVPRPQSGYGQPSVACSPSGAFPGSLPPQPHSAYFSGMTGPQHPFYNRASPVVL--------LSSVTTDAVCERLKQIDGIDPNMLSKYTSTIKKANINGRVLSQCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQALL 1225          
BLAST of Kinase D-interacting substrate vs. TrEMBL
Match: A0A3B3BNY7 (ANK_REP_REGION domain-containing protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 8.314e-41
Identity = 191/809 (23.61%), Postives = 361/809 (44.62%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXX--XXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL-QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMD-EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLY--------SSRPKSLGDIPTTVIQTNVS-------QINSSHNINGETLKTPIFVRKCFT---KVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+       S     +LG T++    I + ++ +  ++    ++ FGS+  R S       S +LA+ +  ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL +    D     ++K+ CCVP+FVL  +    L+    LL I+      M    T+  + + M  ++ L        + +V + +  S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++   FS    L   T+ S   E     G    E+  ++ +        + S N  N        +M  ++ +     + +L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E   +S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       HM    Y        + RP+     P+T      S       Q +SS+       + P + R   +   K+K       LS LS + V   L   D +D   L +Y   +   N+ G VL  C+LD L++E+EMNFGD+Q+F+ +++  R  ES   I
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLTLLLSGTVAVILGFTVDHKLAIAVSLSLLAFLYIFFALVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCVPSFVLFSLTVCCLITGMALLVIFKVDPENM----TVNAVLIAMASVVGLALLLNSRTWWQVAVSVLNSQRKRLHSAANNLHKLKSEGFMKVLKHEVEMMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGFSTAKKLFMATTTSG--EALPTEGSLDEENRKLSQNSLAQDQSKLGSRNALNRRDTYRRRQMQRTITRQMSFDLTKLLVTEDWFCDISPQTMRRLLNIVSITGRLLRANQIIFHWDRLASWIYLTEEWPYRTSWIILF-LEETDGVSDQHTLKNVYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PFLTARDVEMFLPCTVNLDPKLREIIADVRAAREQMHMGGVTYPTLPLQEAAPRPQPGYGQPSTACSPTGSFAGSLPAQPHSSYFSGMTGPQHPFYNRHLKSLPFKIKQVGPAVILSSLSTEAVCERLKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQAAI 1236          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 171.4 bits (433), Expect = 1.474e-42
Identity = 193/807 (23.92%), Postives = 374/807 (46.34%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN------EMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP---------KSLGDIPTTVIQTNV--SQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E LLQ S L+ +           +LG T++    + + ++ + L++    ++ FG  GR+  ++   +  ++  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K+ +S+ + +K+ CCVP+FVL  +    L+    LL+I+        ++ T+  + V M  ++ L        + +V   +  S  R    A + M  +++  +  V   +K E++ +  +  T + +  + Q R+ ++++  D+C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++     + T  + +  + TN      E +       F+S N     A  GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I F ++E   +S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       H+    Y + P            G  P     T    +Q +SS+       + P + R     +        LS LS + V   L HID +D + L +Y T +   N+ G VL  C+LD L++E+ MNFGD+ +FKA++L  R++ES
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLLQFSWLVVVLSLLLCGSVALILGFTVDTKLAVAVALSLLALLYIFFVLVYFG--GRKGGESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEP----SNITVNAVLVAMASVVGLALLLNCRTWWQVADSVLHSQRRRLHSAANSMHKLKSEGFMKV---LKCEVELMAKMAKTIDGF-TQNQTRLVVIIDGLDSCEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSTAKKLSMAAPTNGDLLSAEAWHEEMDRKFQSQNSLGEQAKQGSK-TALNRRDTYRRRQMQRTVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQIIFNWDRLASWINLTEEWPYRTSWLILF-LEENDIVSEQVTLKTIYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PVLTAHDVEMFLPCTVNLDPKLREIIADVRDAREQMHVGGVSYPTLPLQEAPARTHSVFGQAPAACPPTASFPTQPHSSYFSGLTGPQHPFYNRGSGAAIPPG----PLSSLSIEGVCERLRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVES 1221          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 169.859 bits (429), Expect = 4.126e-42
Identity = 187/814 (22.97%), Postives = 369/814 (45.33%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRL---LFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMD--------EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP-KSLGDIPTTVIQTNVSQINSSHNING-------------------ETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L   L L  C S  +   +LG T++    I + ++ + L++    ++ FGS  RR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + +RL      +DT  + ++K+ CC+P+FV+ +   + L+    LL+I+         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++        ++ +  P   +  +    +E    +   S  SL+ A      T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  +A+LK +++ I +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++       +M    Y + P    G  PT++     S  + + + NG                      + P + R   + V     +  LS ++   V   L  ID MD   L +Y   +   NV G VLS C+LD L++E+ MNFGD+Q+F+  ++ +R +ES
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLSLMLCGSVAL---LLGFTVDPKLAIAVSLSLLALLYVFFVVVYFGS--RREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMASRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILVCLITGMALLAIFKVDGENQTVNAILVAMVSVVGLAVLLNCRTWWQVTDSVLNSQRKRLHSAANKMHKLKSEGFMKV---LKSEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSSAKKMCAPAPANGETGNSEGWHEELDRK--LSQHSLSEAAKLGSKTALNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETDGIPDQATLKTIYERISKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PVLAARDIRTFLPCTVNLDPKLREIIADVRAAREQMNMGGVTYPTLPLHEAGPRPTSIYSQQSSACSPTASYNGPYNPPGVSPQPHSAYYSGMAGPQHPFYNRGTASVVSGAPSVL-LSSMNTDMVCERLKVIDGMDQAMLAQYTATIKKANVNGRVLSQCNLDELKKEMSMNFGDWQLFRGTVMEMRHIES 1233          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220a (kinase D-interacting substrate of 220 kDa [Source:NCBI gene;Acc:103043425])

HSP 1 Score: 167.548 bits (423), Expect = 1.940e-41
Identity = 197/817 (24.11%), Postives = 379/817 (46.39%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPAR----AISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTN------EMFCLRGGSSFESLN----MAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP---------KSLGDIPTTVIQTNV--SQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKD----------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E LLQ S L+ +           +LG T++    + + ++ + L++    ++ FG  GR+  ++   +  ++  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL    K+ +S+ + +K+ CCVP+FVL  +    L+    LL+I+        ++ T+  + V M  ++ L        + +V   +  S  R    A + M  +++  +  V   +K E++ +  +  T + +  + Q R+ ++++  D+C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++     + T  + +  + TN      E +       F+S N     A  GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I F ++E   +S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       H+    Y + P            G  P     T    +Q +SS+       + P + R   TK +   R+K           LS LS + V   L HID +D + L +Y T +   N+ G VL  C+LD L++E+ MNFGD+ +FKA++L  R++ES
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQVEPLLQFSWLVVVLSLLLCGSVALILGFTVDTKLAVAVALSLLALLYIFFVLVYFG--GRKGGESWSWAWNISTRLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMATRLFRVFKNDESQGKKWKKTCCVPSFVLFALTLACLVTGMALLAIFKVEP----SNITVNAVLVAMASVVGLALLLNCRTWWQVADSVLHSQRRRLHSAANSMHKLKSEGFMKV---LKCEVELMAKMAKTIDGF-TQNQTRLVVIIDGLDSCEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNS--RGLSTAKKLSMAAPTNGDLLSAEAWHEEMDRKFQSQNSLGEQAKQGSK-TALNRRDTYRRRQMQRTVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQIIFNWDRLASWINLTEEWPYRTSWLILF-LEENDIVSEQVTLKTIYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PVLTAHDVEMFLPCTVNLDPKLREIIADVRDAREQMHVGGVSYPTLPLQEAPARTHSVFGQAPAACPPTASFPTQPHSSYFSGLTGPQHPFYNR---TKSQPP-RVKQGSGAAIPPGPLSSLSIEGVCERLRHIDGLDDSMLEQYTTTVKKANINGRVLCQCNLDELRKEMNMNFGDWHLFKAVVLEQRQVES 1231          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 165.622 bits (418), Expect = 7.952e-41
Identity = 187/823 (22.72%), Postives = 368/823 (44.71%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRL---LFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMD--------EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP-KSLGDIPTTVIQTNVSQINSSHNING-------------------ETLKTPIFVRKCFTKVKDNMRIKD---------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L   L L  C S  +   +LG T++    I + ++ + L++    ++ FGS  RR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + +RL      +DT  + ++K+ CC+P+FV+ +   + L+    LL+I+         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++        ++ +  P   +  +    +E    +   S  SL+ A      T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  +A+LK +++ I +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++       +M    Y + P    G  PT++     S  + + + NG                      + P + R     +K                LS ++   V   L  ID MD   L +Y   +   NV G VLS C+LD L++E+ MNFGD+Q+F+  ++ +R +ES
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLSLMLCGSVAL---LLGFTVDPKLAIAVSLSLLALLYVFFVVVYFGS--RREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMASRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILVCLITGMALLAIFKVDGENQTVNAILVAMVSVVGLAVLLNCRTWWQVTDSVLNSQRKRLHSAANKMHKLKSEGFMKV---LKSEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSSAKKMCAPAPANGETGNSEGWHEELDRK--LSQHSLSEAAKLGSKTALNRRDTYRRRQMQRSVTRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETDGIPDQATLKTIYERISKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PVLAARDIRTFLPCTVNLDPKLREIIADVRAAREQMNMGGVTYPTLPLHEAGPRPTSIYSQQSSACSPTASYNGPYNPPGVSPQPHSAYYSGMAGPQHPFYNRFKVVPLKTKQGTASVVSGAPSVLLSSMNTDMVCERLKVIDGMDQAMLAQYTATIKKANVNGRVLSQCNLDELKKEMSMNFGDWQLFRGTVMEMRHIES 1243          
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Match: kidins220b (kinase D interacting substrate 220 [Source:NCBI gene;Acc:103040274])

HSP 1 Score: 147.902 bits (372), Expect = 2.118e-35
Identity = 177/787 (22.49%), Postives = 352/787 (44.73%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRL---LFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP-KSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L   L L  C S  +   +LG T++    I + ++ + L++    ++ FGS  RR  ++   +  L+  + R    ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + +RL      +DT  + ++K+ CC+P+FV+ +   + L+    LL+I+         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +  T +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++               S+  +M C    ++ E+ N   S  ++    I    ++  S+   + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + +I   ++E   I  +A+LK +++ I +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++       +M    Y + P    G  PT++     S  + + + NG     P    +  +     M                            G         NV G VLS C+LD L++E+ MNFGD+Q+F+  ++ +R +ES
Sbjct:  446 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLSLMLCGSVAL---LLGFTVDPKLAIAVSLSLLALLYVFFVVVYFGS--RREGESWNWAWVLSTRLARHIGYLELLLKLMFVNPPELPEQTTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFMASRLFRVFKTEDTQGKKKWKKTCCIPSFVIFLFILVCLITGMALLAIFKVDGENQTVNAILVAMVSVVGLAVLLNCRTWWQVTDSVLNSQRKRLHSAANKMHKLKSEGFMKV---LKSEVELMAKMAKTIDSF-TQNQTRLVVIIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLN-----------SRGLSSAKKM-CAPAPANGETGN---SEGQADMYRIFRTIRRTRSV---TRQMSFDLTK---LLVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINLTEQWPYRTSWLI-LYLEETDGIPDQATLKTIYERISKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PVLAARDIRTFLPCTVNLDPKLREIIADVRAAREQMNMGGVTYPTLPLHEAGPRPTSIYSQQSSACSPTASYNG-PYNPPGVSPQPHSAYYSGM---------------------------AGPQHPFYNRANVNGRVLSQCNLDELKKEMSMNFGDWQLFRGTVMEMRHIES 1155          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000022722.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 166.777 bits (421), Expect = 3.775e-41
Identity = 192/809 (23.73%), Postives = 363/809 (44.87%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXX--XXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL-QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMD-EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP--------------KSLGDIPTTVIQTNV-SQINSSHNINGETLKTPIFVRKCFT---KVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+       S +   VLG T++    I + ++ + L++    ++ FGS+  R S       S +LA+ +  ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL +    D     ++K+ CC+P+FVL  +    L+    LL I+      M    T+  + + M  ++ L        + +V I +  S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++   FS    L   T+ S   E     G    E+  ++ +        + S N  N         M  ++ +     + +L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E  ++S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       HM    + + P               S    PT     ++ +Q +SS+       + P + R   +   KVK       LS LS + V   L   D +D   L +Y   +   N+ G VL  C+LD L++E+EMNFGD+Q+F+ +++  R  ES   I
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENM----TVNAVLIAMASVVGLALLLNSRTWWQVAISVLNSQRKRLHSAANNLHKLKSEGFMKVLKHEVEMMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGFSTAKKLFMATATSG--EALPTEGSLDEENRKLSQNSLAQDQGKLGSRNTLNRRDTYRRRHMQRTITRQMSFDLTKLLVTEDWFCDISPQTMRRLLNIVSITGRLLRANQIIFHWDRLASWIYLTEEWPYRTSWIILF-LEETDAVSDQHTLKNVYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PFLTPRDVEMFLPCTVNLDPKLREIIADVRAAREQMHMGGVTFPTLPLQEAAPRHQPGYGQPSAACSPTGSFAGSLPAQPHSSYFSGMTGPQHPFYNRHLKSLPFKVKKVGPAVMLSSLSTEAVCERLKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQAAI 1236          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000018863.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 165.622 bits (418), Expect = 8.895e-41
Identity = 189/805 (23.48%), Postives = 356/805 (44.22%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXX--XXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL-QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMD-EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP--------------KSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+       S +   VLG T++    I + ++ + L++    ++ FGS+  R S       S +LA+ +  ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL +    D     ++K+ CC+P+FVL  +    L+    LL I+      M    T+  + + M  ++ L        + +V I +  S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++   FS    L   T+ S   E     G    E+  ++ +        + S N  N         M  ++ +     + +L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E  ++S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       HM    + + P               S    PT     ++     S   +G T     F  +    V        LS LS + V   L   D +D   L +Y   +   N+ G VL  C+LD L++E+EMNFGD+Q+F+ +++  R  ES   I
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENM----TVNAVLIAMASVVGLALLLNSRTWWQVAISVLNSQRKRLHSAANNLHKLKSEGFMKVLKHEVEMMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGFSTAKKLFMATATSG--EALPTEGSLDEENRKLSQNSLAQDQGKLGSRNTLNRRDTYRRRHMQRTITRQMSFDLTKLLVTEDWFCDISPQTMRRLLNIVSITGRLLRANQIIFHWDRLASWIYLTEEWPYRTSWIILF-LEETDAVSDQHTLKNVYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PFLTPRDVEMFLPCTVNLDPKLREIIADVRAAREQMHMGGVTFPTLPLQEAAPRHQPGYGQPSAACSPTGSFAGSLPAQPHSSYFSGMTGPQHPFYNRVGPAVM-------LSSLSTEAVCERLKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQAAI 1225          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000018862.2 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 161.384 bits (407), Expect = 1.858e-39
Identity = 189/818 (23.11%), Postives = 363/818 (44.38%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXX--XXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL-QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMD-EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP--------------KSLGDIPTTVIQTNV-SQINSSHNINGETLKTPIFVRKCFTK-VKDNMRIKD-----------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+       S +   VLG T++    I + ++ + L++    ++ FGS+  R S       S +LA+ +  ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL +    D     ++K+ CC+P+FVL  +    L+    LL I+      M    T+  + + M  ++ L        + +V I +  S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++   FS    L   T+ S   E     G    E+  ++ +        + S N  N         M  ++ +     + +L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E  ++S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       HM    + + P               S    PT     ++ +Q +SS+       + P + R    +  ++ +               LS LS + V   L   D +D   L +Y   +   N+ G VL  C+LD L++E+EMNFGD+Q+F+ +++  R  ES   I
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENM----TVNAVLIAMASVVGLALLLNSRTWWQVAISVLNSQRKRLHSAANNLHKLKSEGFMKVLKHEVEMMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGFSTAKKLFMATATSG--EALPTEGSLDEENRKLSQNSLAQDQGKLGSRNTLNRRDTYRRRHMQRTITRQMSFDLTKLLVTEDWFCDISPQTMRRLLNIVSITGRLLRANQIIFHWDRLASWIYLTEEWPYRTSWIILF-LEETDAVSDQHTLKNVYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PFLTPRDVEMFLPCTVNLDPKLREIIADVRAAREQMHMGGVTFPTLPLQEAAPRHQPGYGQPSAACSPTGSFAGSLPAQPHSSYFSGMTGPQHPFYNRDVIAEDAREGLPWSPSDPIVVGPAVMLSSLSTEAVCERLKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQAAI 1245          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: ENSORLT00000033617.1 (kinase D interacting substrate 220 [Source:NCBI gene;Acc:101155812])

HSP 1 Score: 158.688 bits (400), Expect = 1.172e-38
Identity = 192/836 (22.97%), Postives = 365/836 (43.66%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXX--XXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL-QCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI-SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSD--SFHLLHSTFHLPVYMD-EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKK-----IQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE----HMSQKLYSSRP--------------KSLGDIPTTVIQTNV-SQINSSHNINGETLKTPIFVRKCFTK--------------------VKDNMRIKD----------LSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMI 2819
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L+       S +   VLG T++    I + ++ + L++    ++ FGS+  R S       S +LA+ +  ++LLL+++F  P +        +P+      +N             ++ ++  A E+++  + TRL +    D     ++K+ CC+P+FVL  +    L+    LL I+      M    T+  + + M  ++ L        + +V I +  S  + + S   N+          ++K E++ +  +  T + +  + Q R+ ++++  D C + K+      LQ L T+R   +  P +SI A+D + +I        I+  +N   + S+      + +  HLPV+++   FS    L   T+ S   E     G    E+  ++ +        + S N  N         M  ++ +     + +L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI L   WP+R + II F ++E  ++S + +LK +++ I +   +     KD   L + D  I  F  FL S +   L+  D+++F   +  L+P ++ II ++       HM    + + P               S    PT     ++ +Q +SS+       + P + R  F                      +K   + +D          LS LS + V   L   D +D   L +Y   +   N+ G VL  C+LD L++E+EMNFGD+Q+F+ +++  R  ES   I
Sbjct:  454 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVIFLTLLLSGMVAVVLGFTVDHKLAIAVSLSLLALLYIFFVLVYFGSRRERESWRWAWLISTRLARQIGYLELLLKLMFVNPLELPEQTTRALPVRFLFTDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFMNDEIKGQKWKKTCCIPSFVLFSLTVCCLITGMALLVIFKVDPENM----TVNAVLIAMASVVGLALLLNSRTWWQVAISVLNSQRKRLHSAANNLHKLKSEGFMKVLKHEVEMMSKMAKTIDGF-TQNQTRMAVIIDGLDACEQDKV------LQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGFSTAKKLFMATATSG--EALPTEGSLDEENRKLSQNSLAQDQGKLGSRNTLNRRDTYRRRHMQRTITRQMSFDLTKLLVTEDWFCDISPQTMRRLLNIVSITGRLLRANQIIFHWDRLASWIYLTEEWPYRTSWIILF-LEETDAVSDQHTLKNVYERISKNIPT----TKDVEPLLEIDGDIRSFEVFLSSRT-PFLTPRDVEMFLPCTVNLDPKLREIIADVRAAREQMHMGGVTFPTLPLQEAAPRHQPGYGQPSAACSPTGSFAGSLPAQPHSSYFSGMTGPQHPFYNRPYFPHHVYHLPRHFSHHAPPPSRPTIKPPGQAQDTSGLVGPAVMLSSLSTEAVCERLKQTDGIDPNMLPQYTATIKKANINGRVLLHCNLDELKKEMEMNFGDWQLFRGMVMEQRYAESQAAI 1263          
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Match: kidins220b (kinase D-interacting substrate of 220 kDa B [Source:NCBI gene;Acc:101173112])

HSP 1 Score: 152.91 bits (385), Expect = 7.280e-37
Identity = 184/821 (22.41%), Postives = 371/821 (45.19%), Query Frame = 3
Query:  513 VLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRL---LFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMER----VDLLLQILFCYPSDTDLINKPIVPI---ILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRL--QCSCKDTDSESR-FKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMR---TTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFS--DSFHLLHSTFHLPVYMD--------EIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIY----------LEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPI--------------------FVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELES 2807
             LAD+++EP +  P+ VG++ +   G ++  L KL +E+     +Q E L Q S L   L L  C S  I   VLG T++    + + ++ + L++    ++ FG  GRR   +   +  L+  + R    ++LLL+++F  P +    +   +P+      +N             ++ ++  A E+++  + +RL      ++T  ++R +K+ CC+P+F+L I   L L+    LL+++         +  L+ +  ++   + L       V   VL    K    A ++M  +++  +  V   +K E++ +  +    +++  + Q R+ ++++  D+C + K      +LQ L T+R   +  P +SI A+D + +I        I+  +N   + S  +    + +  HLPV+++        +I +  P      +    +E    +   S  SL     GSK T L      ++    +  + +M + L K   L +++    +I+ + +++LL       ++L+ N+I F WDRL  WI +   WP+R + +I F +++   +  +A+LK +++ + +   +     KD   L + D  +  F  FL S +   L+  D++ F   +  L+P ++ II ++           + + +  L  S+P+     PT+V     S  + S +  G   + P                     F  +    V   +    LS ++   V   +  ++ +D   +G+Y   +   NV G VL  C++D L++E+ MNFGD+Q+F+A +L +R +ES
Sbjct:  455 ALADILSEPTMQPPICVGLYAQWGSG-KSFLLKKLEDEMKTFAGQQIEPLFQFSWLVVFLSLLLCGSVAI---VLGFTVDPKLAVAVSLSLLALLYLFFVVVYFG--GRREGDSWTWAWLLSTRLARHIGYLELLLKLMFVNPPELPEQSTRALPVRFLFTDYNRLSSVGGETSMAEMIATLSDACEREFGFLASRLFRVFKAEETQGKNRKWKKTCCLPSFILFIFVLLCLVSGLALLAVFKVDRENQTVNALLVGVGSVVGLAVLLNCKTWWRVTDSVLNSQRKRLHGAANKMHKLKSEGFMKV---LKNEVELMAKMAKNIDSF-TQHQTRLVVVIDGLDSCEQDK------VLQMLDTVRVLFSKGPFISIFASDPHIIIK------AINQNLNTVLRDSNINGHDYMRNIVHLPVFLNSRGLSSARKISAAAPANGDTNNSEGWHEELDRK--LSQHSLGDLKFGSK-TALNRRDTYRRRQVQRSVTRQMSFDLTK---LMVTEDWFSDISPQTMRRLLNIVSVTGRLLRANQISFNWDRLASWINMTEQWPYRTSWLILF-LEDTDGVPDQATLKTIYERVSKNIPT----TKDVEPLLEIDGDVRSFEVFLSSRT-PFLTARDIRTFLPCTVNLDPKLREIIADVRAAREQINMGGVTYPAVALTDSQPR-----PTSVYSQVSSTCSPSASFCGPFNQPPGGILSPPHSSYYSGMVGPQHPFYNRGSASVMSGVMPTPLSSMTTDAVCERVRQMEGIDQGMVGQYTATIRKANVNGRVLFQCNIDELKKEMNMNFGDWQLFRATVLEMRHMES 1236          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000051607.1 (SMESG000051607.1)

HSP 1 Score: 2140.15 bits (5544), Expect = 0.000e+0
Identity = 1062/1062 (100.00%), Postives = 1062/1062 (100.00%), Query Frame = 3
Query:  300 MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK 3485
            MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK
Sbjct:    1 MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK 1062          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000051607.1 (SMESG000051607.1)

HSP 1 Score: 2128.6 bits (5514), Expect = 0.000e+0
Identity = 1058/1062 (99.62%), Postives = 1058/1062 (99.62%), Query Frame = 3
Query:  300 MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK 3485
            MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIIT    EHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK
Sbjct:    1 MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNLNSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIIT----EHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNETKSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGRHNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGDNVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRLSCILPESVTTNK 1058          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000079991.1 (SMESG000079991.1)

HSP 1 Score: 625.935 bits (1613), Expect = 0.000e+0
Identity = 371/970 (38.25%), Postives = 578/970 (59.59%), Query Frame = 3
Query:  330 SGLIIPNEDCIKMNYNEQA-SPLTSPD--MFSSNKDKKN---WLNLNSFQF---HNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRTTHLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDW-----TLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDY----SLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYL--EHMSQKLYS--------------SRPKSL---GDIPTTVIQTN-----VSQINS---------SHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTK-LGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGELSPQIFDNLAFWTEPEHEINYGSDNDQSQVK----SFSSSVNQKDTAPIITNETKSQ---NNLDQILRDSKKSKLKFN 3062
            +G+II N +    N    A  PL+S D  + S + +K N   ++ LN F +   H  +    ++ +  I+ LAD++  PN   P+ +G+F+R   GIRTTHL KL++E+       N+  LQPS LLF+FP    I+ G ++G+  NW+ G+ LG +  ++ F LI +I+FGS  +R  KAL A++ LA F + + L L ILF YP + +L  KP+  II  HNL++Y SA H+ L+IVE +W AVEKKY  +L+RLQ SCK+ +S ++FK +CC+P FVLVI+FF A++IN+TL +IY+K  + +F +  LLP+FV+MTCI+FL  FG LP+ C+ +  L +SP+R + +    EN D+   D LVK EL ++C +IS FEAY   E++R+F+ +++ D  +R+KLAN +YL+  L  M +  P   ILAADF TL  +W        +  S++ N+FQ+ SD+FHL+HST HLP+YM+E   F      K  ++ +N MFC+RGG+SFESLNM  +G+K   +P+ +         + S+  D     + K IQQLFL++ DL +IN K+IKQL  +A F+ ++L+IN IEF  + LI W+ + INWP++  L+  F+ ++  +++PK +L ++H+ +L    S+  N  +  LLA+DD+       F++ +  + L+   LK F S S F+NPY++ ++ + YL  ++++Q   S              S P  +    D+P  +I  +     V+QI S         +H   G+  KTPI +++C  K+KD    KDLSQL K E+  L+  I+ + S + + +Y+ +LI LNVTGLVLS+CD+D LQ E+EMNFGD+Q+FK LI +LR +E+ K      S+D+  +     D  +FW E   +I+  SD D  ++     +     N+  +  I +  +KS+   NNL  I + ++  K+K N
Sbjct:   24 TGVIISNNEENSKNVGIGAFGPLSSSDATILSGDMNKNNVEDFIGLNYFNYPLDHCGSNIRAQKTVTYIQALADMLVCPNTNFPISIGLFSRVGAGIRTTHLEKLSDELISLTKINNQKTLQPSLLLFMFPVFLFIVVGIIVGLGTNWIVGVSLGASLSLMSFLLIEIIIFGSNHKRWGKALRAARWLASFTQSLQLFLDILFRYPHENELTTKPLSIIITHHNLSNYSSASHMNLSIVEKLWKAVEKKYSCLLSRLQISCKNPESSTKFKNICCIPIFVLVIIFFSAIIINATLFTIYNKNPMDIFVNKGLLPLFVIMTCIVFLCIFGTLPLVCRTITFLVRSPSRQLKQFMESENIDFQASDTLVKNELLKLCQIISIFEAYLNSEKIRMFVFIDAADTESREKLANSIYLVNGLLQMSSNAPIALILAADFQTLNTEWNSSSNNPNSCSSAKSNIFQEISDNFHLIHSTIHLPIYMEEGIDFNRNSSGKKKYA-SNGMFCIRGGNSFESLNMVTTGTKQNSVPVSTRKTSIYLSALNSLNADSNSKGASKSIQQLFLTRGDLSDINNKMIKQLTAAAAFIGRLLRINLIEFKLENLISWLSISINWPYQTALMALFLEEQCANLTPKHTLLQIHEQVLSKIGSKDSNPAEIELLARDDRDFGKLDAFIKKDVGATLTFSILKYFVSWSPFMNPYLRYVLRD-YLTNKNLAQTRGSRNQLTSPPLTSMALSDPSDVPMDEDLPQPIISPSTGSGLVNQITSWSKSSIGNLAH--KGDRPKTPIAIKRCMVKLKDGYPGKDLSQLDKYEIGILMCQIEGLSSEENIEKYKEKLIQLNVTGLVLSVCDMDQLQNEMEMNFGDWQLFKTLIYHLRSVEAFK------SDDLSIVGDPFVDPNSFWEEA--DIDGESDEDDDRISQTCWAGYGRSNKAISKRIRSTMSKSRSQTNNLRSISKRNEVLKVKVN 981          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000080369.1 (SMESG000080369.1)

HSP 1 Score: 168.703 bits (426), Expect = 5.600e-42
Identity = 194/800 (24.25%), Postives = 358/800 (44.75%), Query Frame = 3
Query:  561 VGIFNRTTPGIRTTHLNKLAE--EISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTH-NLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTD-SESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIF-----VLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISE-MKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLAN----CVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN-MAISGSKSTPLPIVSANKQNCSIKM---ESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSII--------------TEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDS--EDIGELSP 2858
            +GIF +    +R  ++ +L +  E  +  +  N I  + +  L    C  S+I G++ G+ I+W  G+ +G   + ++F  I +IL G+  +    AL A   L   +    L L++ F  PS     N   +  I TH  L++Y +  H     +ESIW ++EK Y     RL  +  + D  E +FK++CC+PTFV  I   + ++   T+L +      T+F +  +L  F     VL  CII L F     +FC     +  SP   +   +K+      +     +  E   V  L+S  + Y+   +  I   V++T   + + L      C  LL+N   +  T+  + ++    Y+L          S EI  F +FS    LL  + H       + SF   L   T   +   M        F++++ + ++ +     P +   K   SI     +S+E + +++ I    + K  L + N   +K+L+I+++F  K+ ++  I     +LID +    +WPF  + +  F+++    +    SL+KL+++I+       +  +  L L++ D  +++  + +       L+I +  I +      N  +Q+ +              T    +  S + YSS+  +    P     TN   ++S  +     LKTP  V+KC   +K+      LS++S   VI +++ ID +    + +YQ ++ ++N  GLVL+ CD + L++EL+M+FGD+ +F  LI YL+ +E     S      E + ++SP
Sbjct:  128 IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLILSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFC-----VIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDI--TMCFLILIDNQIYSLAKS-------SEEIINFIKFSK---LLSLSLHFND-CTTMGSFNSNLNDVTLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLE-EMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPN--NTNEILLDSEKH-----LKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 901          
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Match: SMESG000080369.1 (SMESG000080369.1)

HSP 1 Score: 168.318 bits (425), Expect = 6.493e-42
Identity = 194/800 (24.25%), Postives = 358/800 (44.75%), Query Frame = 3
Query:  561 VGIFNRTTPGIRTTHLNKLAE--EISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWVFGIVLGVASMVLIFCLIGMILFGSKGRRXXXXXXXXXXXXXXMERVDLLLQILFCYPSDTDLINKPIVPIILTH-NLADYPSAHHLTLAIVESIWIAVEKKYLKILTRLQCSCKDTD-SESRFKQVCCVPTFVLVIVFFLALMINSTLLSIYHKREITMFTDTTLLPIF-----VLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAISE-MKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNSTDNCNRQKLAN----CVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISSEINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCLRGGSSFESLN-MAISGSKSTPLPIVSANKQNCSIKM---ESIEMDYSLKKIQQLFLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCINWPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLAQDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSII--------------TEIYLEHMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCFTKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGLVLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDS--EDIGELSP 2858
            +GIF +    +R  ++ +L +  E  +  +  N I  + +  L    C  S+I G++ G+ I+W  G+ +G   + ++F  I +IL G+  +    AL A   L   +    L L++ F  PS     N   +  I TH  L++Y +  H     +ESIW ++EK Y     RL  +  + D  E +FK++CC+PTFV  I   + ++   T+L +      T+F +  +L  F     VL  CII L F     +FC     +  SP   +   +K+      +     +  E   V  L+S  + Y+   +  I   V++T   + + L      C  LL+N   +  T+  + ++    Y+L          S EI  F +FS    LL  + H       + SF   L   T   +   M        F++++ + ++ +     P +   K   SI     +S+E + +++ I    + K  L + N   +K+L+I+++F  K+ ++  I     +LID +    +WPF  + +  F+++    +    SL+KL+++I+       +  +  L L++ D  +++  + +       L+I +  I +      N  +Q+ +              T    +  S + YSS+  +    P     TN   ++S  +     LKTP  V+KC   +K+      LS++S   VI +++ ID +    + +YQ ++ ++N  GLVL+ CD + L++EL+M+FGD+ +F  LI YL+ +E     S      E + ++SP
Sbjct:  122 IGIFFKYAKFLRGQNILRLKDFIEKKYFSSTINNIKFRLTPFLSFTICFLSVICGYLCGLIISWEVGLAVGFTILFVLFIGIILILIGTYCQEWRMALQAGIVLCNAIRSFKLWLRLFFLNPSQGQNYNSNELRFIYTHLILSNYSNNFHAIAKFIESIWSSIEKNYNNFFIRLMKASLNQDYGERKFKRICCLPTFVYFIGTLICVLGIGTILKVNETNLSTVFNNKLILIGFSFLAIVLFICIIILLFLTVKIIFC-----VIHSPTHNLKGFLKSYNIYGEASTQTFLMSEFNSVLQLLSQLDKYENDHRSFIVTFVDATGTTDLKVLMEFCSFCHVLLKNNNDI--TMCFLILIDNQIYSLAKS-------SEEIINFIKFSK---LLSLSLHFND-CTTMGSFNSNLNDVTLKPDQKVMKINDKAQIFDNIHYIGVNANCERFKPELIIQKLYKSIDENPNDSLE-EMNIQNISDYLIIKSKLSDFNVTYVKELVITSMFSYKLSQLQNINTDIYKLIDLVTFYYHWPFLYSWMTLFIVNNIYVLKKSLSLRKLYENIMRNMLQSMIEEQFLLELSKLDLDLNVLESMMMHNYIGELTIEEFLILTHACHLQNIPMQNFLKNAVKKNEMKKTKCTNSLYDGFSDRSYSSKTNNCPIYPPN--NTNEILLDSEKH-----LKTPKNVQKCIQNIKELFSSLILSEISLDNVIWMISQIDEISKENIAKYQEKIKEINANGLVLATCDPNELRKELQMSFGDWHLFYTLISYLKSIEEASESSFFQEIIEPVSKVSP 895          
The following BLAST results are available for this feature:
BLAST of Kinase D-interacting substrate vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIDINS2201.172e-3722.60kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2202.060e-3722.60kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2202.151e-3722.60kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2207.639e-2722.36kinase D interacting substrate 220 [Source:HGNC Sy... [more]
KIDINS2209.731e-2722.36kinase D interacting substrate 220 [Source:HGNC Sy... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdin-13.413e-1920.81KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-15.144e-1920.32KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-17.906e-1124.05KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-18.681e-1124.05KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
kdin-18.926e-1124.05KiDINs220 (Vertebrate scaffold protein) homolog [... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426724.388e-3422.86gene:FBgn0261554 transcript:FBtr0302707[more]
CG426725.250e-3422.86gene:FBgn0261554 transcript:FBtr0302704[more]
CG426725.405e-3422.86gene:FBgn0261554 transcript:FBtr0342885[more]
CG426725.806e-3422.86gene:FBgn0261554 transcript:FBtr0302703[more]
CG426726.125e-3422.86gene:FBgn0261554 transcript:FBtr0342886[more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kidins220b1.366e-3921.96kinase D-interacting substrate 220b [Source:NCBI g... [more]
kidins220a3.875e-3822.41kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
kidins220a4.288e-2721.60kinase D-interacting substrate 220a [Source:ZFIN;A... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab4b3.655e-4122.45RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b4.077e-4022.14RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b1.603e-3222.78RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b2.156e-3222.78RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
rab4b2.806e-3222.52RAB4B member RAS oncogene family [Source:Xenbase;A... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Kidins2204.374e-3822.67kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2201.417e-3422.34kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2208.471e-2622.32kinase D-interacting substrate 220 [Source:MGI Sym... [more]
Kidins2201.049e-2522.32kinase D-interacting substrate 220 [Source:MGI Sym... [more]
back to top
BLAST of Kinase D-interacting substrate vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q7T163|KDISB_DANRE1.095e-3821.96Kinase D-interacting substrate of 220 kDa B OS=Dan... [more]
sp|Q9ULH0|KDIS_HUMAN4.673e-2622.36Kinase D-interacting substrate of 220 kDa OS=Homo ... [more]
sp|Q9EQG6|KDIS_RAT1.279e-2522.02Kinase D-interacting substrate of 220 kDa OS=Rattu... [more]
back to top
BLAST of Kinase D-interacting substrate vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F6833.911e-6023.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0RMV27.024e-4922.92Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4Z2DVE77.398e-4725.92Kinase D-interacting substrate OS=Schistosoma japo... [more]
A0A3Q3QP055.483e-4123.03ANK_REP_REGION domain-containing protein OS=Monopt... [more]
A0A3B3BNY78.314e-4123.61ANK_REP_REGION domain-containing protein OS=Oryzia... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kidins220a1.474e-4223.92kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220b4.126e-4222.97kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220a1.940e-4124.11kinase D-interacting substrate of 220 kDa [Source:... [more]
kidins220b7.952e-4122.72kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b2.118e-3522.49kinase D interacting substrate 220 [Source:NCBI ge... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kinase D-interacting substrate vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022722.23.775e-4123.73kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018863.28.895e-4123.48kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000018862.21.858e-3923.11kinase D interacting substrate 220 [Source:NCBI ge... [more]
ENSORLT00000033617.11.172e-3822.97kinase D interacting substrate 220 [Source:NCBI ge... [more]
kidins220b7.280e-3722.41kinase D-interacting substrate of 220 kDa B [Sourc... [more]
back to top
BLAST of Kinase D-interacting substrate vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051607.10.000e+0100.00SMESG000051607.1[more]
SMESG000051607.10.000e+099.62SMESG000051607.1[more]
SMESG000079991.10.000e+038.25SMESG000079991.1[more]
SMESG000080369.15.600e-4224.25SMESG000080369.1[more]
SMESG000080369.16.493e-4224.25SMESG000080369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006148 ID=SMED30006148|Name=Kinase D-interacting substrate|organism=Schmidtea mediterranea sexual|type=transcript|length=3589bp
GTTGGGCATTTAAAACAAAAAAATGTCGACAGTCGACCAATAAACATCAA
GTATCAAATGCAGAAGAGAAATTACAAATACTATCTTTAGTGAAAGACAT
GAAAATTTTTATTTGAGTAACATAACGATATCTTGATTCGAACGAAACGA
TGCCATGTTTTTCTTGGAGGAAATTCTCTGTGATTCTTTGATTGTTGATC
CATTTGGAAATATCTGCCTCGTTCTGCCTGCCGCTGCCAGCACTCTAGGT
TTAAATGATGAGTGAGCTGCACAGACTAAGTCTATGAGATTCTCTGTCAA
TGGAAGACAACTGTTATCAAGACTGCTCAAGCGGTCTCATCATTCCAAAC
GAAGACTGCATCAAGATGAATTACAATGAACAGGCCTCCCCATTAACGTC
ACCGGATATGTTTAGTTCTAATAAAGACAAAAAGAATTGGCTAAATCTCA
ACTCGTTTCAATTCCATAATCAAACCCAATCGGCCCGTGAAAGAGTGATA
AATATTATAAAGGTTTTAGCTGATTTGATGACTGAACCAAATGTTCCACA
TCCTCTTTATGTTGGGATCTTCAATCGAACGACGCCTGGTATCAGAACGA
CACATTTAAACAAATTAGCAGAGGAGATTTCTCACACATGTGCAAAACAA
AATGAAATATTGCTACAACCTTCCAGACTTTTGTTTCTATTTCCATGCGC
ATCATCAATCATATCTGGATTCGTACTAGGAATAACAATTAATTGGGTTT
TTGGAATAGTTCTTGGCGTAGCCTCCATGGTTCTAATCTTTTGTCTAATT
GGCATGATACTTTTTGGTAGTAAAGGTCGGCGTTCTTCCAAAGCACTTTT
TGCATCAAAGAAATTGGCCAAGTTTATGGAGCGAGTGGATTTATTGCTGC
AAATTCTGTTTTGTTATCCATCTGATACGGATCTTATTAACAAGCCAATT
GTACCAATAATTTTGACTCACAACCTTGCAGACTACCCTTCTGCTCACCA
TCTCACTCTAGCTATCGTGGAGAGCATTTGGATCGCCGTGGAGAAAAAAT
ATCTTAAAATATTAACGAGGCTTCAATGCTCTTGCAAAGATACTGATTCC
GAAAGCCGCTTCAAACAGGTCTGCTGTGTTCCGACATTCGTTCTAGTAAT
TGTATTCTTTTTGGCATTGATGATAAATTCTACTCTTTTATCAATCTATC
ACAAAAGAGAAATCACAATGTTTACAGACACGACTTTACTGCCAATTTTT
GTGCTTATGACTTGCATCATATTTCTGGGATTTTTCGGTTGTTTACCAGT
GTTCTGTAAAGTTTTGATCATGCTATTTAAATCTCCTGCCCGAGCGATAA
GCGAAATGAAAAACATCGAAAATCCCGATTATTCTCTCGTTGATAATTTG
GTAAAATTGGAACTCCAAAGAGTCTGTATGCTGATTTCTACGTTTGAAGC
ATATCAGGCTAAGGAACAATTGAGGATTTTTATAATGGTCAATTCAACCG
ACAACTGTAACAGACAAAAACTGGCAAATTGTGTTTATTTGTTACAGAAT
CTTACTACAATGAGAACAACAGTTCCGACGGTTTCTATCTTAGCTGCTGA
CTTTTATACTCTCATCAATGATTGGACTCTGTTGACCCCAATTAGCTCAG
AAATTAACCTTTTCCAACAATTCAGCGACAGCTTTCATTTATTGCATTCG
ACTTTTCATCTTCCAGTGTACATGGATGAGATATTCAGTTTCATTCCAAC
CTTACCCCAGAAAACCTCATTTTCCAATACTAATGAAATGTTTTGCTTGC
GAGGTGGATCTTCGTTTGAATCACTAAACATGGCCATCTCTGGTAGCAAA
TCAACCCCATTGCCTATTGTAAGTGCCAACAAACAAAATTGTTCCATAAA
AATGGAATCTATTGAAATGGACTATTCTTTGAAAAAGATCCAACAACTAT
TTCTATCAAAACCGGATCTTTTAGAAATCAATACAAAAGTGATCAAACAG
CTATTAATTTCAGCCATTTTTCTAGAAAAGATACTCAAAATCAATAAAAT
AGAATTTGTCTGGGATCGATTAATTGATTGGATAATACTCTGTATTAATT
GGCCTTTCCGAATAAATCTCATCATCAATTTTGTCATCGATGAATTTCCT
TCGATCAGTCCGAAAGCCAGTCTGAAAAAACTCCATGACGACATTTTGGA
ATGCTTCAATTCCGAGCACCTTAACAACAAAGACTTTCTATTGTTAGCGC
AAGATGATAAATCAATAAGTATTTTTGGGAATTTCCTAGAATCGGAATCC
TTTTCCAATTTATCGATTGTCGACTTGAAAATCTTTTCTTCTCACAGCTC
ATTTCTTAATCCATATATCCAATCGATAATAACCGAAATTTATTTAGAGC
ATATGTCTCAGAAATTATATAGCAGTAGACCGAAAAGCCTTGGAGACATT
CCAACTACCGTAATTCAAACAAATGTCAGTCAAATAAATTCCAGTCACAA
TATCAATGGAGAAACTCTGAAAACTCCAATCTTTGTACGAAAATGTTTTA
CAAAGGTTAAAGATAATATGAGAATCAAAGATTTATCCCAACTGAGCAAG
AAAGAGGTTATTAACCTCCTGAACCATATCGACACAATGGACTCGACCAA
GCTTGGACGATACCAAACTCGCCTAATTGATCTCAACGTCACTGGACTTG
TTTTGAGTATTTGCGATCTTGACAATTTACAACGGGAACTCGAAATGAAC
TTCGGAGATTTCCAAATTTTCAAAGCTCTCATTCTTTATTTGAGAGAATT
GGAGTCTTTAAAAATGATAAGTCTGACAGACTCTGAAGACATTGGAGAGT
TGTCACCTCAGATTTTTGACAATTTAGCATTTTGGACTGAACCGGAACAT
GAAATTAATTACGGTTCAGACAACGATCAATCGCAAGTGAAATCATTTTC
CTCTTCGGTCAATCAAAAAGACACAGCTCCCATTATAACCAATGAAACAA
AATCTCAGAACAACCTAGATCAAATATTGCGCGATTCCAAGAAATCCAAA
TTGAAATTTAATGGAAAATATACTAATAAAACTAATAAAAACTTCAGTGA
TAGCAATCATAGCCCATTTCAAGGGCGCCATCAATTTACGGAAGGGCGGC
ACAATCAGAATCCAGCTTACAATTCAATGTCAGAGGGTGTTGACAAACTT
AGTTCAACGTGCAAGAAATATCCCAGGAGTCGAGAATACACTACGACCTA
CATTCCGGTTATTATTCCCAATGCTGCTGAGTTGAATCCCGACGGAGACA
ATGTCAAAAGGTGCACATGTGATTATTGGTTTACTATTGGTAAGGAGAAA
GTTCCCTTGTCAAGATTCATCAGTGATCCGATGAATTGTTTGAATTCTCA
TGTAAATTCTCATGACGTGTCCGAAGATGATGACTTTAATCCTCGGCTAT
CGTGCATTTTGCCCGAAAGCGTTACTACTAACAAACAGAGCTGATCTTTT
TTTCAATTTTCTTTGTCATTTATTCCAGAGATATATTAGATTTTGTTGAA
GTTTTAATTATATTTGTATGTCCAGTTTATGTAAGCAGG
back to top

protein sequence of SMED30006148-orf-1

>SMED30006148-orf-1 ID=SMED30006148-orf-1|Name=SMED30006148-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1065bp
MEDNCYQDCSSGLIIPNEDCIKMNYNEQASPLTSPDMFSSNKDKKNWLNL
NSFQFHNQTQSARERVINIIKVLADLMTEPNVPHPLYVGIFNRTTPGIRT
THLNKLAEEISHTCAKQNEILLQPSRLLFLFPCASSIISGFVLGITINWV
FGIVLGVASMVLIFCLIGMILFGSKGRRSSKALFASKKLAKFMERVDLLL
QILFCYPSDTDLINKPIVPIILTHNLADYPSAHHLTLAIVESIWIAVEKK
YLKILTRLQCSCKDTDSESRFKQVCCVPTFVLVIVFFLALMINSTLLSIY
HKREITMFTDTTLLPIFVLMTCIIFLGFFGCLPVFCKVLIMLFKSPARAI
SEMKNIENPDYSLVDNLVKLELQRVCMLISTFEAYQAKEQLRIFIMVNST
DNCNRQKLANCVYLLQNLTTMRTTVPTVSILAADFYTLINDWTLLTPISS
EINLFQQFSDSFHLLHSTFHLPVYMDEIFSFIPTLPQKTSFSNTNEMFCL
RGGSSFESLNMAISGSKSTPLPIVSANKQNCSIKMESIEMDYSLKKIQQL
FLSKPDLLEINTKVIKQLLISAIFLEKILKINKIEFVWDRLIDWIILCIN
WPFRINLIINFVIDEFPSISPKASLKKLHDDILECFNSEHLNNKDFLLLA
QDDKSISIFGNFLESESFSNLSIVDLKIFSSHSSFLNPYIQSIITEIYLE
HMSQKLYSSRPKSLGDIPTTVIQTNVSQINSSHNINGETLKTPIFVRKCF
TKVKDNMRIKDLSQLSKKEVINLLNHIDTMDSTKLGRYQTRLIDLNVTGL
VLSICDLDNLQRELEMNFGDFQIFKALILYLRELESLKMISLTDSEDIGE
LSPQIFDNLAFWTEPEHEINYGSDNDQSQVKSFSSSVNQKDTAPIITNET
KSQNNLDQILRDSKKSKLKFNGKYTNKTNKNFSDSNHSPFQGRHQFTEGR
HNQNPAYNSMSEGVDKLSSTCKKYPRSREYTTTYIPVIIPNAAELNPDGD
NVKRCTCDYWFTIGKEKVPLSRFISDPMNCLNSHVNSHDVSEDDDFNPRL
SCILPESVTTNKQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR24116FAMILY NOT NAMEDcoord: 555..916
NoneNo IPR availableTMHMMTMhelixcoord: 151..173
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 278..300