slc18a-6

Overview
Nameslc18a-6 (AKN21541.1)
Smed IDSMED30006145
Length (bp)2107
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc18a-6 (SMED30006145) t-SNE clustered cells

Violin plots show distribution of expression levels for slc18a-6 (SMED30006145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc18a-6 (SMED30006145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc18a-6 (SMED30006145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006145

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006145SMESG000051356.1 SmedASXL_012005SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006145SMESG000051356.1 dd_Smed_v4_11630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006145SMESG000051356.1 dd_Smed_v4_11630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006145SMESG000051356.1 dd_Smed_v4_11630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006145SMESG000051356.1 dd_Smed_v4_11630_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006145SMESG000051356.1 Contig54277newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006145SMESG000051356.1 Contig54277uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30006145SMESG000051356.1 dd_Smed_v6_11630_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30006145SMESG000051356.1 OX_Smed_1.0.02618ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc18a-6 vs. Ensembl Human
Match: SLC18A3 (solute carrier family 18 member A3 [Source:HGNC Symbol;Acc:HGNC:10936])

HSP 1 Score: 442.965 bits (1138), Expect = 5.551e-148
Identity = 225/437 (51.49%), Postives = 289/437 (66.13%), Query Frame = 2
Query:  266 VERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMH-------------------------------------TEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNI 1465
            V   +  P  Q  +VL++V +ALLLDNMLYMVIVPIVP Y+ +M+  G+    +  +                                       TE  + ++G+LFA KAI+QLL+NPLSG  IDR+ YD+P++IGL ++F ST  FAF +    +F AR LQG+GSAFADTSG+AMIAD++ EE  R+ ALG+ALAFISFGSLVAPPFG +LY++ GK  PF  LA ++L D  LL+ + KP     R   A  NLP GTPI +L +DPYIA+ AG L   N+ LAFLEPTI +WM       SE  +G+ WLPAF PHV GV++TV+LAA+YP  QWL   +GLA+ G S   +P C +F  L++ +  LCFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISYS+AYA+GPIVAG IV ++GF  L++
Sbjct:   21 VGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAAR---ARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAA-SEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSL 453          
BLAST of slc18a-6 vs. Ensembl Human
Match: SLC18A2 (solute carrier family 18 member A2 [Source:HGNC Symbol;Acc:HGNC:10935])

HSP 1 Score: 271.166 bits (692), Expect = 3.656e-82
Identity = 147/355 (41.41%), Postives = 220/355 (61.97%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            N Q+GLLFA KA VQL+ NP  G + +RIGY IP+  G  I+FVST  FAF  +   + +AR LQG+GS+ +  +G+ M+A  +T++  R   +GIAL  ++ G LV PPFG+VLY++ GK  PF  LA + LLDG + + +++P R++           KGTP+  L  DPYI I AG++  AN+ +A LEP +  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL A +G+ + G+S + IPF  N   L+ P   + F I +VD++++P +GYLVD RHVSVYGSVYAIAD+++ + YAIGP   G+I   IGF  L  I+ ++ I + P+ + +R+
Sbjct:  128 NVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ-------KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETM-CSRKWQLGVAFLPASISYLIGTNIFGILAHK--MGRWLCALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRS 472          
BLAST of slc18a-6 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 256.529 bits (654), Expect = 2.066e-76
Identity = 155/370 (41.89%), Postives = 231/370 (62.43%), Query Frame = 2
Query:  410 QSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
              NN        EE  T++G+LFA KA++QLL+NP  G + +RIGY IPM  G +I+F+ST  FAF  T  ++F+AR LQG+GS+F+  +GL M+A  +T++  R  A+G AL  ++ G LV  PFG+V+Y++ GK  PF  LAF+ALLDG L + I++P ++            KGTP+  L  DPYI + AG++  AN+ +A LEPT+  WM+     P +  +GL +LPA   ++ G  +   LA K    +WL + IG+ + G S + +P   N   L+ P + L   I +VD++++P +G+LVD RH SVYGSVYAIAD+++ + +AIGP   G+IV  IGF  L +I  V++I Y P+ Y +R+
Sbjct:  121 HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESA-------KGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSP-KWQLGLAFLPASVSYLIGTNLFGVLANK--MGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS 480          
BLAST of slc18a-6 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 256.529 bits (654), Expect = 2.066e-76
Identity = 155/370 (41.89%), Postives = 231/370 (62.43%), Query Frame = 2
Query:  410 QSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
              NN        EE  T++G+LFA KA++QLL+NP  G + +RIGY IPM  G +I+F+ST  FAF  T  ++F+AR LQG+GS+F+  +GL M+A  +T++  R  A+G AL  ++ G LV  PFG+V+Y++ GK  PF  LAF+ALLDG L + I++P ++            KGTP+  L  DPYI + AG++  AN+ +A LEPT+  WM+     P +  +GL +LPA   ++ G  +   LA K    +WL + IG+ + G S + +P   N   L+ P + L   I +VD++++P +G+LVD RH SVYGSVYAIAD+++ + +AIGP   G+IV  IGF  L +I  V++I Y P+ Y +R+
Sbjct:  121 HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESA-------KGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSP-KWQLGLAFLPASVSYLIGTNLFGVLANK--MGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS 480          
BLAST of slc18a-6 vs. Ensembl Human
Match: SLC18A1 (solute carrier family 18 member A1 [Source:HGNC Symbol;Acc:HGNC:10934])

HSP 1 Score: 227.639 bits (579), Expect = 2.519e-66
Identity = 140/334 (41.92%), Postives = 209/334 (62.57%), Query Frame = 2
Query:  410 QSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIG 1411
              NN        EE  T++G+LFA KA++QLL+NP  G + +RIGY IPM  G +I+F+ST  FAF  T  ++F+AR LQG+GS+F+  +GL M+A  +T++  R  A+G AL  ++ G LV  PFG+V+Y++ GK  PF  LAF+ALLDG L + I++P ++            KGTP+  L  DPYI + AG++  AN+ +A LEPT+  WM+     P +  +GL +LPA   ++ G  +   LA K    +WL + IG+ + G S + +P   N   L+ P + L   I +VD++++P +G+LVD RH SVYGSVYAIAD+++ + +AIG
Sbjct:  121 HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLSTVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGLLVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESA-------KGTPLFMLLKDPYILVAAGSICFANMGVAILEPTLPIWMMQTMCSP-KWQLGLAFLPASVSYLIGTNLFGVLANK--MGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDLRHTSVYGSVYAIADVAFCMGFAIG 444          
BLAST of slc18a-6 vs. Ensembl Celegans
Match: unc-17 (Vesicular acetylcholine transporter unc-17 [Source:UniProtKB/Swiss-Prot;Acc:P34711])

HSP 1 Score: 486.878 bits (1252), Expect = 1.236e-165
Identity = 253/509 (49.71%), Postives = 339/509 (66.60%), Query Frame = 2
Query:  221 KVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKN-----KGQSNNESM----SMMHTEEGNT--------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIH-------YQNHIEPNSH 1675
             VP+ N D++ +K   ++ + + ++Q   VL++VS+ALLLDNMLYMVIVPI+P Y+  + N     +G  N  S     + +  E G          ++G LFA KA++Q+ +NP SG +IDR+GY+IPM++GL  +F ST+ FA G++  V+  AR LQG GSAFADTSGLAMIADRFTEE+ R+ ALGIALAFISFG LVAPPFG+VLY   GK  PF  L+F+ L D   + M++ P    RR   + G   +GTP+ +LFMDP+IA C+G L +ANVSLAFLEPTIT+WM    P      +G+IWLP FFPHV GV+VTVK+   +P + W +A +GLA+EGI+C  IP+ ++   L+IP+S +CFGIAL+DT++LP LG+LVDTRHVSVYGSVYAIADISYSLAYA GPI+AG IV+  GFT+LNII+F  ++ Y PVL+L+R ++ +       D        S   +   NG   EA   E+         YQN  +  +H
Sbjct:    4 NVPVINRDSEILKADAKKWLEQQDNQKKCVLVIVSIALLLDNMLYMVIVPIIPKYLRDIHNYQVTFEGYHNETSQLANGTYLVREVGGRINFLDEELELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERSAALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINP---HRRGTDSHGEKVQGTPMWRLFMDPFIACCSGALIMANVSLAFLEPTITTWMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFAIPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYAFGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLRKVHSYDTLGAKGDTAEMTQLNSSAPAGGYNGKP-EATTAESYQGWEDQQSYQNQAQIPNH 508          
BLAST of slc18a-6 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710585:-1 gene:WBGene00000295.1 transcript:W01C8.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 268.855 bits (686), Expect = 5.737e-82
Identity = 154/370 (41.62%), Postives = 236/370 (63.78%), Query Frame = 2
Query:  413 SNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWML-SWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            S  E   ++ +E  N  +GL+F  KA+VQLL+NP  G + +RIGY +PM  G +I+F ST  FAFG +   ++LAR LQGVGSA   TSG+ M+A  + ++  R +A+GIAL  ++ G LV PP+G +LYQ+ GKE PF  LA +AL DG +  M+++P +++R E       P+G+ I++L  DPYI + AG + I N+ +A LEP++  WM+ SW     E   G  +LPA   ++ G  +   LA +    +WL + IGL + G S + IP  ++   L+IP +LL F I ++D ++ P +GYLVD RHV VYGS+YAIAD ++  A+A+GP  +G +V ++GF ++  I+ V+S  Y P+++L++N
Sbjct:   82 SEEERHKLLASE--NVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALFDGSIQFMVLQP-KIDRGE-------PEGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLER--GAAFLPASISYLIGTNIFGPLAHRIG--RWLSSFIGLVVIGFSLLSIPSATSVAGLIIPHALLGFSIGMIDASMFPLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKN 437          
BLAST of slc18a-6 vs. Ensembl Celegans
Match: cat-1 (pep chromosome:WBcel235:X:5705719:5710625:-1 gene:WBGene00000295.1 transcript:W01C8.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cat-1)

HSP 1 Score: 269.626 bits (688), Expect = 1.647e-81
Identity = 154/370 (41.62%), Postives = 236/370 (63.78%), Query Frame = 2
Query:  413 SNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWML-SWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            S  E   ++ +E  N  +GL+F  KA+VQLL+NP  G + +RIGY +PM  G +I+F ST  FAFG +   ++LAR LQGVGSA   TSG+ M+A  + ++  R +A+GIAL  ++ G LV PP+G +LYQ+ GKE PF  LA +AL DG +  M+++P +++R E       P+G+ I++L  DPYI + AG + I N+ +A LEP++  WM+ SW     E   G  +LPA   ++ G  +   LA +    +WL + IGL + G S + IP  ++   L+IP +LL F I ++D ++ P +GYLVD RHV VYGS+YAIAD ++  A+A+GP  +G +V ++GF ++  I+ V+S  Y P+++L++N
Sbjct:  145 SEEERHKLLASE--NVHVGLMFGSKALVQLLVNPWIGPLTNRIGYTMPMFGGFVIMFCSTILFAFGDSYFTLWLARALQGVGSACTSTSGMGMLAQAYPDDLERGSAMGIALGGLALGVLVGPPYGGLLYQWSGKELPFVLLALLALFDGSIQFMVLQP-KIDRGE-------PEGSSIKQLAKDPYIIVAAGAITIGNLGIAMLEPSLPLWMMESWGANSLER--GAAFLPASISYLIGTNIFGPLAHRIG--RWLSSFIGLVVIGFSLLSIPSATSVAGLIIPHALLGFSIGMIDASMFPLMGYLVDIRHVGVYGSIYAIADAAFCFAFALGPFFSGPLVKSLGFPTMMYIIAVISFLYAPLMFLLKN 500          
BLAST of slc18a-6 vs. Ensembl Celegans
Match: vpat-1 (Vesicular PolyAmine Transporter [Source:UniProtKB/TrEMBL;Acc:Q8MPU6])

HSP 1 Score: 67.3958 bits (163), Expect = 2.423e-11
Identity = 91/359 (25.35%), Postives = 145/359 (40.39%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAF------GQT-LEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEG-----ISCIFI---PFCSNFGYL-----MIPISLLCFGIALVDTAILPTLGYLVD-------TRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGF 1450
             TQ G++F        +I+PL G  I  IG     ++G+ +  V+   F F      G T      L R L+ VG A   TS  A+ A  F +  +    +GI   F   G    P  G   Y   G + PF  L  + L+   L   +++  + +    + +G L       ++   P I +   ++    +SL+FL+PT+++ + S++  P+E  IGL++L      + G F TV           L  G  L L G     +S  FI   P  +  GY+     +I ISL   G+A      +P     +D         +   YG V  I   ++     IGP     +V  +GF
Sbjct:  261 ETQTGIVFGIFEFTMFIISPLFGKYIIFIGARTMFIVGIAVTGVTAILFGFLNFLPSGNTFFWFSVLVRILEAVGDAAFVTSSFAIAAKSFPKNVA--FVVGILETFAGLGYTAGPVIGGFFYDIGGFQLPFLVLGIVLLVASVLAFFLIENTKDDESNPEDKGML-------EILRLPQIWLPIFSVVSCAISLSFLDPTLSNHLESFKLTPTE--IGLMFL------LCGGFYTVMCPVFGAIMDRLHNGENLLLFGSIATLLSMFFIGPTPLLN--GYVEKDLWVIGISLAVLGLA-ASALYIPCFQMCLDEVKDKGFDDNFHTYGCVSGIFQAAFGFGSFIGPTFGSVVVERVGF 599          
BLAST of slc18a-6 vs. Ensembl Celegans
Match: vpat-1 (Vesicular PolyAmine Transporter [Source:UniProtKB/TrEMBL;Acc:Q8MPU6])

HSP 1 Score: 64.6994 bits (156), Expect = 1.363e-10
Identity = 91/359 (25.35%), Postives = 145/359 (40.39%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAF------GQT-LEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEG-----ISCIFI---PFCSNFGYL-----MIPISLLCFGIALVDTAILPTLGYLVD-------TRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGF 1450
             TQ G++F        +I+PL G  I  IG     ++G+ +  V+   F F      G T      L R L+ VG A   TS  A+ A  F +  +    +GI   F   G    P  G   Y   G + PF  L  + L+   L   +++  + +    + +G L       ++   P I +   ++    +SL+FL+PT+++ + S++  P+E  IGL++L      + G F TV           L  G  L L G     +S  FI   P  +  GY+     +I ISL   G+A      +P     +D         +   YG V  I   ++     IGP     +V  +GF
Sbjct:  119 ETQTGIVFGIFEFTMFIISPLFGKYIIFIGARTMFIVGIAVTGVTAILFGFLNFLPSGNTFFWFSVLVRILEAVGDAAFVTSSFAIAAKSFPKNVAFV--VGILETFAGLGYTAGPVIGGFFYDIGGFQLPFLVLGIVLLVASVLAFFLIENTKDDESNPEDKGML-------EILRLPQIWLPIFSVVSCAISLSFLDPTLSNHLESFKLTPTE--IGLMFL------LCGGFYTVMCPVFGAIMDRLHNGENLLLFGSIATLLSMFFIGPTPLLN--GYVEKDLWVIGISLAVLGLA-ASALYIPCFQMCLDEVKDKGFDDNFHTYGCVSGIFQAAFGFGSFIGPTFGSVVVERVGF 457          
BLAST of slc18a-6 vs. Ensembl Fly
Match: VAChT (gene:FBgn0270928 transcript:FBtr0083671)

HSP 1 Score: 509.22 bits (1310), Expect = 1.318e-173
Identity = 268/500 (53.60%), Postives = 355/500 (71.00%), Query Frame = 2
Query:  212 ASMKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNN-------------ESMSMMHTEEG-NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWML------SWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATD---QDPEIIRPSRK-KSYLMNGTSLEAKNLEN 1639
            AS ++P+ N +   +K  V  KI  P +Q  ++L++VS+ALLLDNMLYMVIVPI+P   DY++  G  ++             + + + H   G ++  G+LFA KAIVQL++NP SG +ID+IGYD+PMMIGL I+F ST+ FA G +  V+F AR LQG GSAFADT+GLAMIADRFTEE+ R+ ALGIALAFISFG LVAPPFG  LYQ+ GKE PF  LA + LLDG +L+++MKPV+   ++ K   +  +  PI +L MDPYIA+CAG L ++NV+LAFLEPTI+ WM       +W+       IG++WLPAFFPHV GV +TVK+A KYPQ+QWLMA  GLALEG SC  IPFCS +  LM+PI ++CFGIAL+DTA+LPTLGYLVD R+VSVYGS+YAIADISYS+AYA+GPI+AG +V  IGFT+LN ++   ++AY PVL  +RNIY F   +   +   QDP    P+++ ++Y+M+        ++N
Sbjct:    2 ASFQIPVINLEVREVKDIVWEKIQEPVNQRRLILVIVSIALLLDNMLYMVIVPIIP---DYLREIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMKQSKDVQD--QVIPIWRLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWK-------IGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFKPFENEANILMQDP----PNKEYQTYVMHDQKPVEGGVKN 485          
BLAST of slc18a-6 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0310062)

HSP 1 Score: 295.819 bits (756), Expect = 9.941e-91
Identity = 170/451 (37.69%), Postives = 260/451 (57.65%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK---------------------------NKGQSNNE--SMSMMHTEEGNT-----------------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +VL++V++ALLLDNML   +VPI+P ++  ++                           NK  S      +S +  EE  T                 ++GLLFA KA VQLL+NP+ G +  RIGY IPM  G +I+F+ST  FAFG++  V+F+AR LQG+GS+ +  SG+ M+ADRFT++  R  A+GIAL  ++ G L+ PPFG V+Y++ GK  PF  LA +AL DG L + +++P        KAE   P    ++ L  DPYI I AG +  AN+ +A LEP++  WM+      +    G+ +LPA   ++ G  +   L  K    +W  A +GL + G   IFIP  ++  +L+IP + L F I +VD++++P LGYLVD RH +VYGSVYA+ D+++ + +A+GP ++GS+V +IGF  +   + ++   Y P+L L++N
Sbjct:  140 LVLVIVAIALLLDNMLLTTVVPIIPEFLYDIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQP-----SIQKAETEPPS---LKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGA-TRWEQGVAFLPASISYLIGTNLFGPLGHKI--GRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKN 579          
BLAST of slc18a-6 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091491)

HSP 1 Score: 295.819 bits (756), Expect = 9.941e-91
Identity = 170/451 (37.69%), Postives = 260/451 (57.65%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK---------------------------NKGQSNNE--SMSMMHTEEGNT-----------------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +VL++V++ALLLDNML   +VPI+P ++  ++                           NK  S      +S +  EE  T                 ++GLLFA KA VQLL+NP+ G +  RIGY IPM  G +I+F+ST  FAFG++  V+F+AR LQG+GS+ +  SG+ M+ADRFT++  R  A+GIAL  ++ G L+ PPFG V+Y++ GK  PF  LA +AL DG L + +++P        KAE   P    ++ L  DPYI I AG +  AN+ +A LEP++  WM+      +    G+ +LPA   ++ G  +   L  K    +W  A +GL + G   IFIP  ++  +L+IP + L F I +VD++++P LGYLVD RH +VYGSVYA+ D+++ + +A+GP ++GS+V +IGF  +   + ++   Y P+L L++N
Sbjct:  140 LVLVIVAIALLLDNMLLTTVVPIIPEFLYDIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQP-----SIQKAETEPPS---LKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGA-TRWEQGVAFLPASISYLIGTNLFGPLGHKI--GRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKN 579          
BLAST of slc18a-6 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091493)

HSP 1 Score: 295.819 bits (756), Expect = 9.941e-91
Identity = 170/451 (37.69%), Postives = 260/451 (57.65%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK---------------------------NKGQSNNE--SMSMMHTEEGNT-----------------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +VL++V++ALLLDNML   +VPI+P ++  ++                           NK  S      +S +  EE  T                 ++GLLFA KA VQLL+NP+ G +  RIGY IPM  G +I+F+ST  FAFG++  V+F+AR LQG+GS+ +  SG+ M+ADRFT++  R  A+GIAL  ++ G L+ PPFG V+Y++ GK  PF  LA +AL DG L + +++P        KAE   P    ++ L  DPYI I AG +  AN+ +A LEP++  WM+      +    G+ +LPA   ++ G  +   L  K    +W  A +GL + G   IFIP  ++  +L+IP + L F I +VD++++P LGYLVD RH +VYGSVYA+ D+++ + +A+GP ++GS+V +IGF  +   + ++   Y P+L L++N
Sbjct:  140 LVLVIVAIALLLDNMLLTTVVPIIPEFLYDIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQP-----SIQKAETEPPS---LKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGA-TRWEQGVAFLPASISYLIGTNLFGPLGHKI--GRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKN 579          
BLAST of slc18a-6 vs. Ensembl Fly
Match: Vmat (gene:FBgn0260964 transcript:FBtr0091492)

HSP 1 Score: 296.204 bits (757), Expect = 1.817e-90
Identity = 170/451 (37.69%), Postives = 260/451 (57.65%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK---------------------------NKGQSNNESM--SMMHTEEGNT-----------------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +VL++V++ALLLDNML   +VPI+P ++  ++                           NK  S    +  S +  EE  T                 ++GLLFA KA VQLL+NP+ G +  RIGY IPM  G +I+F+ST  FAFG++  V+F+AR LQG+GS+ +  SG+ M+ADRFT++  R  A+GIAL  ++ G L+ PPFG V+Y++ GK  PF  LA +AL DG L + +++P        KAE   P    ++ L  DPYI I AG +  AN+ +A LEP++  WM+      +    G+ +LPA   ++ G  +   L  K    +W  A +GL + G   IFIP  ++  +L+IP + L F I +VD++++P LGYLVD RH +VYGSVYA+ D+++ + +A+GP ++GS+V +IGF  +   + ++   Y P+L L++N
Sbjct:  140 LVLVIVAIALLLDNMLLTTVVPIIPEFLYDIRHPDAPLDSFPRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVGLLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQP-----SIQKAETEPPS---LKSLISDPYILIAAGAITFANMGIAMLEPSLPLWMVDNMGA-TRWEQGVAFLPASISYLIGTNLFGPLGHKI--GRWFAACLGLIIIGGCLIFIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKN 579          
BLAST of slc18a-6 vs. Ensembl Zebrafish
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 489.189 bits (1258), Expect = 1.289e-166
Identity = 239/419 (57.04%), Postives = 307/419 (73.27%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ----SNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNI 1522
            I  PE Q  ++L++V +ALLLDNMLYMVIVPIVP Y+ +++++ +      N S+++   E  + Q+G+LFA KAI+QLL+NPL+GT IDR+GYDIP++IGL I+FVST  FAF +    +F+AR LQG+GSAFADTSG+AMIAD++ EES R+ ALGIALAFISFGSL APPFG VLY++ GK FPF  LA + L DG L + ++KP     RE     N+P GTPI KL +DPYIA+ AG L   N+ LAFLEPTI +WM       S+  IG+ WLPAFFPH+ GV++TVKLAAKYP  QW    +G+ + G S   +P C NF  L+IP+  +CFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISY +AYA+GPIVAG IV  +GF  LN+ + + ++ Y P L L+RN+
Sbjct:   31 IQDPERQRRIILVIVCVALLLDNMLYMVIVPIVPDYLAHLESESEQAHVKGNSSINITQNENFDLQIGVLFASKAILQLLVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATLFMARSLQGLGSAFADTSGIAMIADKYAEESERSRALGIALAFISFGSLAAPPFGGVLYEFAGKRFPFIALACVCLADGILCLTVLKPFSSRTRE-----NMPVGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMNA-SQWQIGITWLPAFFPHILGVYLTVKLAAKYPHLQWFYGALGMVIIGASSCIVPACKNFEQLIIPLCGVCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYALGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNV 443          
BLAST of slc18a-6 vs. Ensembl Zebrafish
Match: slc18a3b (solute carrier family 18 member 3b [Source:NCBI gene;Acc:394082])

HSP 1 Score: 321.627 bits (823), Expect = 1.360e-102
Identity = 186/417 (44.60%), Postives = 253/417 (60.67%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQ 1528
            +  PE Q  ++L+VV +ALLLDNMLYMVIVPI+P Y+  ++  G+  N S  +      + Q+G+LFA KA++QLL+NPLSGT IDR+GYD+P++IGL+++F+ST  FA                    FA+                            ++G+L    F A   Q  G  F           D   L+ ++KP     RE     N+P GTPI +L +DPYIA+ AG L + N+ LAFLEPTI +WM S     S+  +GL+WLPAF PHV GV++TV+LAA+YP+ QW    +G+ + G S   +P C  FG L+ P+  +CFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISYS+AYA+GP+VAG IV  +GF  LN+ + +V++ Y P L L+R + Q
Sbjct:   31 LREPERQRRLLLVVVCVALLLDNMLYMVIVPIIPDYLADLR--GERGNSSADL------DIQIGVLFASKALLQLLVNPLSGTFIDRVGYDLPLLIGLLVMFLSTCIFA--------------------FAE----------------------------NYGTL----FAARSLQGLGSAFA----------DTSXLLTVVKPFSDRTRE-----NMPVGTPIHRLMVDPYIAVVAGALTVCNIPLAFLEPTIANWMESTMDA-SKWQMGLVWLPAFLPHVLGVYITVRLAARYPERQWFYGALGMVIIGASSCTVPACKTFGELVFPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYAMGPVVAGQIVHNLGFVQLNLGMGLVNVLYAPALLLLRPVCQ 371          
BLAST of slc18a-6 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 309.301 bits (791), Expect = 1.585e-96
Identity = 187/524 (35.69%), Postives = 285/524 (54.39%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSN------------------------NESMSMMHT------------------------------EEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIR-----PSRKKSYLMNG-------TSLEAKNLENIHYQNHIEPNSHD 1678
            +VL VV +ALLLDNML  V+VPI+P ++   +++ Q N                        N S+S+  T                              E  N ++GLLFA KA+VQLL+NP  G + +RIGY IPM  G +I+FVST  FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T++S R  A+GIAL  ++ G L+  PFG+++Y++  K  PF  LAF+A+ DG L + I++P ++    M       +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+     P +  +G+ +LPA   ++ G  +   LA K    +WL + +G+ + GIS + +PF  N   L+ P   L F + +VDT++   +GYLVD RHVSVYGSVYAIAD++  + +A+GP   G++V TIGF +L +I+ +++I Y P+ + ++N           + + +++R     P   KSY  +G            ++ EN    +H E   H 
Sbjct:   21 LVLAVVCVALLLDNMLLTVVVPIIPAFLYATEHQAQKNPPTTPFEAHPTNTSLLSLYNTTTYNTSVSLNFTNFSSASSTNENLGVNSSSADYGCKEDSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSM-------EGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAP-KWQLGVAFLPASVSYLIGTNLFGILANK--MGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKN---------PANWEEKMVRLKHECPLHMKSYNTSGYREFPLSEDDSEEDTENACINSHKESMDHQ 525          
BLAST of slc18a-6 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 299.286 bits (765), Expect = 1.424e-92
Identity = 168/436 (38.53%), Postives = 260/436 (59.63%), Query Frame = 2
Query:  401 NKGQSNNESMSMMHTE--EG-NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNG-------TSLEAKNLENIHYQNHIEPNSHD 1678
            +   S NE++ + +++  EG N ++GLLFA KA+VQLL+NP  G + +RIGY IPM  G +I+FVST  FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T++S R  A+GIAL  ++ G L+  PFG+++Y++  K  PF  LAF+A+ DG L + I++P ++    M       +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+     P +  +G+ +LPA   ++ G  +   LA K    +WL + +G+ + GIS + +PF  N   L+ P   L F + +VDT++   +GYLVD RHVSVYGSVYAIAD++  + +A+GP   G++V TIGF +L +I+ +++I Y P+ + ++N   +       +Q+     P   KSY  +G            ++ EN    +H E   H 
Sbjct:  120 SSASSTNENLGVNNSDFLEGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSM-------EGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAP-KWQLGVAFLPASVSYLIGTNLFGILANK--MGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKNPANWEEKMAIVNQE----CPLHMKSYNTSGYREFPLSEDDSEEDTENACINSHKESMDHQ 541          
BLAST of slc18a-6 vs. Ensembl Zebrafish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:571483])

HSP 1 Score: 296.59 bits (758), Expect = 8.714e-92
Identity = 164/418 (39.23%), Postives = 249/418 (59.57%), Query Frame = 2
Query:  446 EEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNG-------TSLEAKNLENIHYQNHIEPNSHD 1678
            E  N ++GLLFA KA+VQLL+NP  G + +RIGY IPM  G +I+FVST  FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T++S R  A+GIAL  ++ G L+  PFG+++Y++  K  PF  LAF+A+ DG L + I++P ++    M       +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+     P +  +G+ +LPA   ++ G  +   LA K    +WL + +G+ + GIS + +PF  N   L+ P   L F + +VDT++   +GYLVD RHVSVYGSVYAIAD++  + +A+GP   G++V TIGF +L +I+ +++I Y P+ + ++N   +       +Q+     P   KSY  +G            ++ EN    +H E   H 
Sbjct:  115 EGENVKVGLLFASKAMVQLLVNPFVGPLTNRIGYHIPMFAGFVIMFVSTIMFAFSGTYTLLFFARSLQGIGSSFSTVAGLGMLASVYTDDSERGIAMGIALGGLAMGVLIGAPFGSIMYEFVSKSSPFLVLAFLAMFDGALQLCILQPSKISPTSM-------EGTPLFILLKDPYILISAGSLCFANMGVAVLEPTLPIWMMQTMCAP-KWQLGVAFLPASVSYLIGTNLFGILANK--MGRWLCSMVGMFIVGISLLCVPFAKNLYGLIGPNGGLGFAVGMVDTSMFAIMGYLVDIRHVSVYGSVYAIADVALCVGFAVGPSTGGALVRTIGFPNLMVIIGIINILYAPLCFFLKNPANWEEKMAIVNQE----CPLHMKSYNTSGYREFPLSEDDSEEDTENACINSHKESMDHQ 518          
BLAST of slc18a-6 vs. Ensembl Xenopus
Match: slc18a3 (solute carrier family 18 (vesicular acetylcholine transporter), member 3 [Source:NCBI gene;Acc:780320])

HSP 1 Score: 466.077 bits (1198), Expect = 3.394e-157
Identity = 241/430 (56.05%), Postives = 306/430 (71.16%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK----------NKGQSNNESMSMMH---TEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQ 1528
            I  P  Q  ++LI+V +AL LDNMLYMVIVPI+P Y+  ++          +  Q  N+S ++      E  + Q+G+LFA KAI+QLLINPLSGT IDR+GYDIP++IGL+++F ST  FAF +    +F+AR LQG+GSAFADTSG+AMIAD +TEE+ R+ ALGIALAFISFGSLVAPPFG +LYQ+ GK  PF  LA IAL+DG LL++++KP     R      N+P GTPI +L +DPYIA+ AG L   N+ LAFLEPTI +WM +     SE  +GL WLPAFFPHV GV++TVKLAA YP YQW    IG+ + G S   +P C NF  L++P+  +CFGIALVDTA+LPTL  LVD RHVSVYGSVYAIADISY +AYA+GP+VA  IV T GFT LN+ + + ++ Y P L  +RN+ Q
Sbjct:   32 IKEPHHQRRIILIIVCVALFLDNMLYMVIVPIIPDYIQNLRADREHAKSINSSSQYRNKSFAIRPQYPAENEDMQIGVLFASKAILQLLINPLSGTFIDRVGYDIPLLIGLVVLFFSTVIFAFAENYATLFVARSLQGLGSAFADTSGIAMIADTYTEEAERSKALGIALAFISFGSLVAPPFGGILYQFVGKRMPFLVLASIALIDGVLLLLVIKPFTNRTR-----ANMPIGTPIHRLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMKTTMDA-SEWQMGLTWLPAFFPHVLGVYITVKLAANYPHYQWFYGAIGMVIIGASSCTVPACKNFWELIVPLCGICFGIALVDTALLPTLALLVDVRHVSVYGSVYAIADISYCVAYALGPVVASQIVHTTGFTQLNLGMGLANVLYAPALLFLRNVCQ 455          
BLAST of slc18a-6 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 251.521 bits (641), Expect = 8.557e-76
Identity = 144/383 (37.60%), Postives = 224/383 (58.49%), Query Frame = 2
Query:  383 YMDYMKNKGQS-NNESMSMMHTE---EGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            Y D + N  +S  N++      +   E N  +GLL A KA++QLL NP+ G +I+R GYD P+  G II+F+ST  FAF  +   + +ARGLQG+GS+F     L M+A  F +++ R  A+GIAL+ ++ G L  PPFG+ +Y++ GK  PF  +A +ALLDG L + I++P R    ++ A       TP + L MDPYI + A  L I N++   LE T+   M+     P    +GL +LP    +   + V  +LA K    +WL   +G+ + GIS I +P   N  YL+ P + L  G  +++T+++P + +LVD RH S YG +YAI+DI+  + YA+GP+  G+I   +GF  L II+ ++++ + P+  L+RN
Sbjct:   40 YRDSIINNTESAGNQTQCYEEKDYLNEENVLVGLLLAIKALLQLLTNPIVGKIINRTGYDAPLFCGTIIMFLSTLMFAFADSYAFLCVARGLQGIGSSFTAVPALGMLAHVFPDDAERGKAMGIALSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPA-------TPYKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAP-RYQLGLCFLPCIVAYFICLNVFAELAQKIG--RWLCIMLGMLILGISVICMPLALNIYYLIGPSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRN 412          
BLAST of slc18a-6 vs. Ensembl Xenopus
Match: gtf2e1.2 (general transcription factor IIE, polypeptide 1, alpha 56kDa, gene 2 [Source:Xenbase;Acc:XB-GENE-6001963])

HSP 1 Score: 251.521 bits (641), Expect = 5.879e-75
Identity = 153/424 (36.08%), Postives = 240/424 (56.60%), Query Frame = 2
Query:  341 DNMLYMVIVPIVPH--YMDYMKNKG----------------------------QSNNESMSMMHT-EEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            DNML+ V+VPI+P   Y   +KN                               S+N+     HT    N Q+GLLFA KAIVQLL+NPL G + +R G+D P+  G +I+F+ST  FAF  +  ++F+AR +QG+GS+F+  +GL ++A  + ++  R  A+GIAL  ++ G L   PFG+V+Y++ G+  PF  LA +ALLDG L + I++P +               TP  +L  DPYI + A  L IAN+++  LEPT+  WM+     P +  +G+ +LPA   ++    +   L+ K    +WL + +G+ + G   + +P   N   L+ P + +   + +VD++I+P +GYLVD RH SVYG +YAI D +  L +A+GP +AG I S IGF+ L +I+ +++I + P+  L+RN
Sbjct:   34 DNMLFTVVVPIIPSFLYEKELKNASVTTTELHSPISAYNSSVLFNASLHDSPTNSSNKCEKKKHTLHSENVQVGLLFASKAIVQLLVNPLVGLITNRFGFDAPLFAGFVILFLSTLMFAFSGSYALLFVARSIQGIGSSFSSVAGLGLLASVYMDDFERGQAMGIALTGLAVGVLAGAPFGSVMYEFVGRSSPFLVLAALALLDGALQLCILRPSKFSPTTAAP-------TPYHELLRDPYILVAAACLWIANMAVGMLEPTLPIWMMETMCSP-DWQLGIAFLPASVAYLICTNLFGILSHK--MGRWLCSMLGMIVVGGGLLCVPLARNIYGLIGPNAAIGIALGMVDSSIMPIMGYLVDLRHTSVYGGIYAICDTALCLGFAVGPSLAGVIASNIGFSWLMVIIGIINILFSPLCILLRN 447          
BLAST of slc18a-6 vs. Ensembl Xenopus
Match: ddx42 (DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-972670])

HSP 1 Score: 247.284 bits (630), Expect = 1.327e-73
Identity = 152/450 (33.78%), Postives = 247/450 (54.89%), Query Frame = 2
Query:  308 VLIVVSMALLLDNMLYMVIVPIVP---HYMDYMK-------NKGQ---SNNESM-SMMHTE--------------------------------EGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +L+VV++ + +D +L+ +I PI P   ++++Y +       + GQ   SN +S+ ++ H E                                E N ++GLL A KA +QLL NP+ G ++ RIGYD PM  G +I+ VST  FAF  +  ++ +ARG QG+GS+F     L  +A  F ++  R  A+G+A++ ++ G L  PPFG+ +Y++ GK  PF  +A +ALLDG L + I++P R    ++ A       TP + L MDPYI + A  L I N++   LE T+   M+     P    +GL +LP    +   + V  +LA K    +WL   +G+ + GIS I +P   N  YL+ P + L  G  +++T+++P + +LVD RH S YG +YAI+DI+  + YA+GP+  G+I   +GF  L II+ ++++ + P+  L+RN
Sbjct:   21 ILLVVAVVMFVDCILFTIIAPIAPALLYHIEYGRGNRTFKNSSGQYPVSNYDSIFNLSHLEDSRKGPYHDQIINITESPGDKKNCYEGKDFLNEENVRVGLLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQGIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSAPFLAIAALALLDGVLQLCILRPTRFSTVDVPA-------TPYKNLLMDPYILVAAVGLCICNLTFGMLETTLPIRMMETMCAP-RYQLGLCFLPCIVAYFICLNVFAELAQKIG--RWLCIMLGMLILGISVICMPLALNIYYLIGPSAALGIGFGMMETSVMPLMAHLVDLRHTSNYGGIYAISDIALCIGYALGPLCGGAIAKAVGFKWLMIILGIINLVFAPLFILLRN 460          
BLAST of slc18a-6 vs. Ensembl Xenopus
Match: kansl3 (KAT8 regulatory NSL complex subunit 3 [Source:Xenbase;Acc:XB-GENE-6054064])

HSP 1 Score: 244.973 bits (624), Expect = 1.661e-73
Identity = 137/376 (36.44%), Postives = 213/376 (56.65%), Query Frame = 2
Query:  392 YMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            Y+ NK      + S++  E  N  +GLL A KAIVQ+L NP+   +  R+GY++PM+ G II   S   FAF  +  ++F+AR LQG+G++F   SG+A++A+++T++  R  A+GIAL  ++ G +  PPFG+ +Y + GK  PF  LA + LLDG                               L  DPYI + AG++ + N+ +A  EPT+  WML     P +  +G+++ PA   ++    +  +L+ K    +WL + +G+ L GIS + +P   NF  L+ PI+     I +VD +++P + YLVD RH SVYG VYAI+DI+ +L +A+GP VAG     IG   L +I+ V++I Y P+  L+RN
Sbjct:   43 YVPNKETICKNNTSVLQEE--NITVGLLLASKAIVQILFNPIVSLITYRLGYELPMIFGFIITLPSILLFAFASSYSLLFVARSLQGIGTSFTSVSGMAILANKYTDDKERGEAMGIALGGVALGLVAGPPFGSAMYAFVGKASPFLILAALTLLDGAFC---------------------------ALLKDPYIVLAAGSICLTNMVIAMAEPTLPVWMLGTMCTP-DWLLGIVFFPASISYLVCTNLLPRLSQKIG--RWLCSLLGMVLAGISFLCVPLAVNFYGLITPIAAFGISIGMVDVSMVPLMAYLVDLRHSSVYGGVYAISDIALNLGFAVGPCVAGITAKAIGLPWLMVIIAVLNIMYSPLCILLRN 386          
BLAST of slc18a-6 vs. Ensembl Mouse
Match: Slc18a3 (solute carrier family 18 (vesicular monoamine), member 3 [Source:MGI Symbol;Acc:MGI:1101061])

HSP 1 Score: 444.506 bits (1142), Expect = 6.557e-149
Identity = 228/437 (52.17%), Postives = 293/437 (67.05%), Query Frame = 2
Query:  266 VERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQS------------------------NNESMS-------------MMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNI 1465
            V   +  P+ Q  +VL++V +ALLLDNMLYMVIVPIVP Y+ +M+   +S                         N S S                TE  + ++G+LFA KAI+QLL+NPLSG  IDR+ YD+P++IGL ++F ST  FAF +    +F AR LQG+GSAFADTSG+AMIAD++ EE  R+ ALG+ALAFISFGSLVAPPFG +LY++ GK  PF  LA ++L D  LL+ + KP     R   A  NLP GTPI +L +DPYIA+ AG L   N+ LAFLEPTI +WM       SE  +G++WLPAF PHV GV++TV+LAA+YP  QWL   +GLA+ G+S   +P C +F  L++ +  LCFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISYS+AYA+GPIVAG IV ++GF  L++
Sbjct:   21 VGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGSESPTLISEVWEPTLPPPTLANASAYLANTSASPTAAGSARSILRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAAR---ARANLPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAA-SEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSL 453          
BLAST of slc18a-6 vs. Ensembl Mouse
Match: Slc18a2 (solute carrier family 18 (vesicular monoamine), member 2 [Source:MGI Symbol;Acc:MGI:106677])

HSP 1 Score: 275.789 bits (704), Expect = 4.552e-84
Identity = 150/355 (42.25%), Postives = 221/355 (62.25%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            N Q+GLLFA KA VQLL NP  G + +RIGY IPM  G  I+F+ST  FAF  +   + +AR LQG+GS+ +  +G+ M+A  +T++  R  A+GIAL  ++ G LV PPFG+VLY++ GK  PF  LA + LLDG + + +++P R++           KGTP+  L  DPYI I AG++  AN+ +A LEP +  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL A +G+ + GIS + IPF  N   L+ P   + F I +VD++++P +GYLVD RHVSVYGSVYAIAD+++ + YAIGP   G+I   IGF  L  I+ ++ I + P+ + +R+
Sbjct:  131 NVQVGLLFASKATVQLLTNPFIGLLTNRIGYPIPMFAGFCIMFISTVMFAFSSSYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNAMGIALGGLAMGVLVGPPFGSVLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQ-------KGTPLTTLLKDPYILIAAGSICFANMGIAMLEPALPIWMMETM-CSRKWQLGVAFLPASISYLIGTNIFGILAHK--MGRWLCALLGMIVVGISILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDIVFAPLCFFLRS 475          
BLAST of slc18a-6 vs. Ensembl Mouse
Match: Slc18a1 (solute carrier family 18 (vesicular monoamine), member 1 [Source:MGI Symbol;Acc:MGI:106684])

HSP 1 Score: 254.603 bits (649), Expect = 5.564e-76
Identity = 156/369 (42.28%), Postives = 230/369 (62.33%), Query Frame = 2
Query:  413 SNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
             NN    +   EE N ++G+LFA KA++QLL+NP  G + +RIGY IPM +G +I+F+ST  FAF  T  ++F+AR LQG+GS+F+  +GL M+A  +T+   R  A+GIAL  ++ G LV  PFG+V+Y++ GK  PF  LAF+ALLDG L   I+ P ++             GTP+  L  DPYI + AG++ +AN+ +A LEPT+  WM+     P E  +GL +LPA   ++ G  +   LA K    +WL + +G+   GIS + +P   N   L+ P + L F I +VD++++P +GYLVD RH SVYGSVYAIAD+++ + +AIGP   G IV  IGF  L +I+  ++I Y P+   ++N
Sbjct:  119 KNNCLQGIEFLEEENVRIGILFASKALMQLLVNPFVGPLTNRIGYHIPMFVGFMIMFLSTLMFAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDNYERGRAMGIALGGLALGLLVGAPFGSVMYEFVGKSSPFLILAFLALLDGALQFCILWPSKVSPESA-------MGTPLLTLLKDPYILVAAGSICLANMGVAILEPTLPIWMMQTMCSP-EWQLGLAFLPASVAYLIGTNLFGVLANK--MGRWLCSLVGMVAVGISLLCVPLAHNIFGLIGPNAGLGFAIGMVDSSLMPIMGYLVDLRHTSVYGSVYAIADVAFCVGFAIGPSTGGVIVPVIGFPWLMVIIGTINIIYAPLCCFLQN 477          
BLAST of slc18a-6 vs. Ensembl Mouse
Match: Slc18b1 (solute carrier family 18, subfamily B, member 1 [Source:MGI Symbol;Acc:MGI:1923556])

HSP 1 Score: 59.6918 bits (143), Expect = 7.291e-9
Identity = 94/411 (22.87%), Postives = 168/411 (40.88%), Query Frame = 2
Query:  272 RKINRPESQCTMVLIVVSMALLLDNML-YMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTL-------EVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQY-QWLMAGIGLALEGISCIF--IPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRH-------VSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGF 1450
            R+ +R  S+  + ++V + ++ L  M+ Y ++ P  P   +    KG SN             T +G++F C A+ +LL + + G  +  IG     + G+ +    T  F     L        + FL R +  +G   A T+  +++A  F    +  T +G    F   G +  PP G +LYQ  G E PF  L  I LL        M P+ L      A+ + P      KL   P + + A  +   +    FL+PT++ +++  +   S   +GL++L     +     +   L+ K P   +WL+    L   G   +   +P       L + + +L         +I+PT   ++   +       +S  G V  +    +S+   +GPI+ G +   IGF
Sbjct:   23 RETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAE---KKGASN-------------TMIGMIFGCYALFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGVLDQLPEGPIFIAMCFLVRIVDAIGFGAAITASSSILAKAFPNNVA--TVMGSLEVFSGLGLVAGPPLGGLLYQSFGYEVPFIFLGCIVLL--------MIPLNLYILPSYAQESDPGKQSFWKLVTLPKMGLLAFVIISLSSCFGFLDPTLSLFVME-KFSLSTGYVGLVFLGLSLSYAISSPLFGLLSDKMPTLRKWLLVFGNLITAGCYMLLGPVPLLHIKSQLWLLVLVLVVNGISAGMSIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGAMWSVGAFMGPILGGFLCEKIGF 406          
BLAST of slc18a-6 vs. Ensembl Mouse
Match: Slc18b1 (solute carrier family 18, subfamily B, member 1 [Source:MGI Symbol;Acc:MGI:1923556])

HSP 1 Score: 54.6842 bits (130), Expect = 2.935e-7
Identity = 93/411 (22.63%), Postives = 168/411 (40.88%), Query Frame = 2
Query:  272 RKINRPESQCTMVLIVVSMALLLDNML-YMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTL-------EVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQY-QWLMAGIGLALEGISCIF--IPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRH-------VSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGF 1450
            R+ +R  S+  + ++V + ++ L  M+ Y ++ P  P   +    KG SN             T +G++F C A+ +LL + + G  +  IG     + G+ +    T  F     L        + FL R +  +G   A T+  +++A  F    +  T +G    F   G +  PP G +LYQ  G E PF  L  I LL        M P+ L    + +  + P      KL   P + + A  +   +    FL+PT++ +++  +   S   +GL++L     +     +   L+ K P   +WL+    L   G   +   +P       L + + +L         +I+PT   ++   +       +S  G V  +    +S+   +GPI+ G +   IGF
Sbjct:   23 RETSRRLSREQIFVLVSAASMNLGCMMTYSILGPFFPKEAE---KKGASN-------------TMIGMIFGCYALFELLASLVFGKYLVHIGAKFMFIAGMFVSGGVTILFGVLDQLPEGPIFIAMCFLVRIVDAIGFGAAITASSSILAKAFPNNVA--TVMGSLEVFSGLGLVAGPPLGGLLYQSFGYEVPFIFLGCIVLL--------MIPLNL--YILPSYESDPGKQSFWKLVTLPKMGLLAFVIISLSSCFGFLDPTLSLFVME-KFSLSTGYVGLVFLGLSLSYAISSPLFGLLSDKMPTLRKWLLVFGNLITAGCYMLLGPVPLLHIKSQLWLLVLVLVVNGISAGMSIIPTFPEMLSCAYANGFEDSISTLGLVSGLFGAMWSVGAFMGPILGGFLCEKIGF 404          
BLAST of slc18a-6 vs. UniProt/SwissProt
Match: sp|O17444|VACHT_DROME (Vesicular acetylcholine transporter OS=Drosophila melanogaster OX=7227 GN=VAChT PE=2 SV=2)

HSP 1 Score: 509.22 bits (1310), Expect = 1.321e-172
Identity = 268/500 (53.60%), Postives = 355/500 (71.00%), Query Frame = 2
Query:  212 ASMKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNN-------------ESMSMMHTEEG-NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWML------SWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATD---QDPEIIRPSRK-KSYLMNGTSLEAKNLEN 1639
            AS ++P+ N +   +K  V  KI  P +Q  ++L++VS+ALLLDNMLYMVIVPI+P   DY++  G  ++             + + + H   G ++  G+LFA KAIVQL++NP SG +ID+IGYD+PMMIGL I+F ST+ FA G +  V+F AR LQG GSAFADT+GLAMIADRFTEE+ R+ ALGIALAFISFG LVAPPFG  LYQ+ GKE PF  LA + LLDG +L+++MKPV+   ++ K   +  +  PI +L MDPYIA+CAG L ++NV+LAFLEPTI+ WM       +W+       IG++WLPAFFPHV GV +TVK+A KYPQ+QWLMA  GLALEG SC  IPFCS +  LM+PI ++CFGIAL+DTA+LPTLGYLVD R+VSVYGS+YAIADISYS+AYA+GPI+AG +V  IGFT+LN ++   ++AY PVL  +RNIY F   +   +   QDP    P+++ ++Y+M+        ++N
Sbjct:    2 ASFQIPVINLEVREVKDIVWEKIQEPVNQRRLILVIVSIALLLDNMLYMVIVPIIP---DYLREIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGILFASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMKQSKDVQD--QVIPIWRLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWK-------IGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFKPFENEANILMQDP----PNKEYQTYVMHDQKPVEGGVKN 485          
BLAST of slc18a-6 vs. UniProt/SwissProt
Match: sp|Q08C75|VACHA_DANRE (Probable vesicular acetylcholine transporter-A OS=Danio rerio OX=7955 GN=slc18a3a PE=2 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 9.734e-166
Identity = 239/419 (57.04%), Postives = 307/419 (73.27%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ----SNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNI 1522
            I  PE Q  ++L++V +ALLLDNMLYMVIVPIVP Y+ +++++ +      N S+++   E  + Q+G+LFA KAI+QLL+NPL+GT IDR+GYDIP++IGL I+FVST  FAF +    +F+AR LQG+GSAFADTSG+AMIAD++ EES R+ ALGIALAFISFGSL APPFG VLY++ GK FPF  LA + L DG L + ++KP     RE     N+P GTPI KL +DPYIA+ AG L   N+ LAFLEPTI +WM       S+  IG+ WLPAFFPH+ GV++TVKLAAKYP  QW    +G+ + G S   +P C NF  L+IP+  +CFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISY +AYA+GPIVAG IV  +GF  LN+ + + ++ Y P L L+RN+
Sbjct:   31 IQDPERQRRIILVIVCVALLLDNMLYMVIVPIVPDYLAHLESESEQAHVKGNSSINITQNENFDLQIGVLFASKAILQLLVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATLFMARSLQGLGSAFADTSGIAMIADKYAEESERSRALGIALAFISFGSLAAPPFGGVLYEFAGKRFPFIALACVCLADGILCLTVLKPFSSRTRE-----NMPVGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMNA-SQWQIGITWLPAFFPHILGVYLTVKLAAKYPHLQWFYGALGMVIIGASSCIVPACKNFEQLIIPLCGVCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYALGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNV 443          
BLAST of slc18a-6 vs. UniProt/SwissProt
Match: sp|P34711|UNC17_CAEEL (Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans OX=6239 GN=unc-17 PE=1 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 1.572e-164
Identity = 253/509 (49.71%), Postives = 339/509 (66.60%), Query Frame = 2
Query:  221 KVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKN-----KGQSNNESM----SMMHTEEGNT--------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIH-------YQNHIEPNSH 1675
             VP+ N D++ +K   ++ + + ++Q   VL++VS+ALLLDNMLYMVIVPI+P Y+  + N     +G  N  S     + +  E G          ++G LFA KA++Q+ +NP SG +IDR+GY+IPM++GL  +F ST+ FA G++  V+  AR LQG GSAFADTSGLAMIADRFTEE+ R+ ALGIALAFISFG LVAPPFG+VLY   GK  PF  L+F+ L D   + M++ P    RR   + G   +GTP+ +LFMDP+IA C+G L +ANVSLAFLEPTIT+WM    P      +G+IWLP FFPHV GV+VTVK+   +P + W +A +GLA+EGI+C  IP+ ++   L+IP+S +CFGIAL+DT++LP LG+LVDTRHVSVYGSVYAIADISYSLAYA GPI+AG IV+  GFT+LNII+F  ++ Y PVL+L+R ++ +       D        S   +   NG   EA   E+         YQN  +  +H
Sbjct:    4 NVPVINRDSEILKADAKKWLEQQDNQKKCVLVIVSIALLLDNMLYMVIVPIIPKYLRDIHNYQVTFEGYHNETSQLANGTYLVREVGGRINFLDEELELGWLFASKALLQIFVNPFSGYIIDRVGYEIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERSAALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINP---HRRGTDSHGEKVQGTPMWRLFMDPFIACCSGALIMANVSLAFLEPTITTWMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFAIPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYAFGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLRKVHSYDTLGAKGDTAEMTQLNSSAPAGGYNGKP-EATTAESYQGWEDQQSYQNQAQIPNH 508          
BLAST of slc18a-6 vs. UniProt/SwissProt
Match: sp|P81721|VACHT_TETCF (Vesicular acetylcholine transporter OS=Tetronarce californica OX=7787 PE=2 SV=2)

HSP 1 Score: 484.182 bits (1245), Expect = 9.959e-164
Identity = 244/438 (55.71%), Postives = 316/438 (72.15%), Query Frame = 2
Query:  266 VERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKN------KGQSNNESMSMMHTEEG-----------NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQ 1528
            +   +N P  +  ++L++V +A+LLDNMLYMVIVPI+P+Y++ ++          SN  + S++++ +            + Q+G+LFA KAI+QLL NP +GT IDR+GYDIP++IGL I+F ST  FAFG++  V+F AR LQG+GSAFADTSG+AMIAD++TEES RT ALGIALAFISFGSLVAPPFG VLYQ+ GK  PF  L+F+ LLDG LL+M++ P     RE     N+ +GTPI KL +DPYIA+ AG L   N+ LAFLEPTI++WM       SE  +G+ WLPAFFPH+ GV++TVKLAAKYP YQW    +GL + G S   IP C NF  L+IP+  LCFGIALVDTA+LPTL +LVD R+VSVYGSVYAIADISYS+AYA+GPI+AG IV  +GF  LN+ + +V+I Y P L  +RN+ Q
Sbjct:   28 ISGAMNEPRRKRKILLVIVCIAMLLDNMLYMVIVPIIPNYLETIRTYKLVYITTPSNGTNGSLLNSTQRAVLERNPNANEDIQIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAVLFAARSLQGLGSAFADTSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFLVLSFVCLLDGILLLMVVTPFASRTRE-----NMLQGTPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTISNWMKKTMNA-SEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWFYGAVGLVIIGASSCTIPACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALGPIMAGQIVHDLGFVQLNLGMGLVNILYAPALLFLRNVCQ 459          
BLAST of slc18a-6 vs. UniProt/SwissProt
Match: sp|Q91514|VACHT_TORTO (Vesicular acetylcholine transporter OS=Torpedo torpedo OX=30481 PE=2 SV=1)

HSP 1 Score: 484.182 bits (1245), Expect = 1.081e-163
Identity = 253/476 (53.15%), Postives = 330/476 (69.33%), Query Frame = 2
Query:  266 VERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKG------QSNNESMSMMHTEEG-----------NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGIT----KLATDQDPE-----IIRPSRKKSYLMNGTS 1615
            +   +N P  +  ++L++V +A+LLDNMLYMVIVPIVP+Y++ ++          SN  + S++++ +            + Q+G+LFA KAI+QLL NP +GT IDR+GYDIP++IGL I+F ST  FAFG++  ++F AR LQG+GSAFADTSG+AMIAD++TEES RT ALGIALAFISFGSLVAPPFG VLYQ+ GK  PF  L+F+ LLDG LL+M++ P     R     GN  +GTPI KL +DPYIA+ AG L   N+ LAFLEPTI++WM       SE  +G+ WLPAFFPH+ GV++TVKLAAKYP YQWL    GL + G+S   IP C NF  L+IP+  LCFGIALVDTA+LPTL +LVD R+VSVYGSVYAIADISYS+AYA+GPI+AG IV  +GF  LN+ + +V+I Y P L  +RN+ Q   +     +  +  P+     II   RK +   +GTS
Sbjct:   24 ISGAMNEPLRKRKILLVIVCIAMLLDNMLYMVIVPIVPNYLETIRTYKLVYITIPSNGTNGSLLNSTQRAVLERNPNANEDIQIGVLFASKAILQLLSNPFTGTFIDRVGYDIPLLIGLTIMFFSTITFAFGESYAILFAARSLQGLGSAFADTSGIAMIADKYTEESERTQALGIALAFISFGSLVAPPFGGVLYQFAGKWVPFLVLSFVCLLDGILLLMVVTPFASRTR-----GNTLQGTPIHKLMIDPYIAVVAGALTTCNIPLAFLEPTISNWMKKTMNA-SEWQMGITWLPAFFPHILGVYITVKLAAKYPNYQWLYGAFGLVIIGVSSCTIPACRNFEELIIPLCALCFGIALVDTALLPTLAFLVDIRYVSVYGSVYAIADISYSVAYALGPIMAGQIVHDLGFVQLNLGMGLVNILYAPALLFLRNVCQMKPSLSERNILLEDGPKGLYDTIIMEERKAAKEPHGTS 493          
BLAST of slc18a-6 vs. TrEMBL
Match: A0A0H3YJ31 (Slc18a-6 OS=Schmidtea mediterranea OX=79327 GN=slc18a-6 PE=2 SV=1)

HSP 1 Score: 1075.85 bits (2781), Expect = 0.000e+0
Identity = 535/535 (100.00%), Postives = 535/535 (100.00%), Query Frame = 2
Query:  218 MKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNSTATNSQIYXXXXXXXXXXXEEIRKNQYGY 1822
            MKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNSTATNSQIYSQNKSSSNFSSEEIRKNQYGY
Sbjct:    1 MKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNSTATNSQIYSQNKSSSNFSSEEIRKNQYGY 535          
BLAST of slc18a-6 vs. TrEMBL
Match: H2KNW1 (MFS transporter DHA1 family solute carrier family 18 (Vesicular acetylcholine transporter) member 3 OS=Clonorchis sinensis OX=79923 GN=slc18a3a PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 302/484 (62.40%), Postives = 363/484 (75.00%), Query Frame = 2
Query:  236 NFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ--------SNNESMSMMH---------------TEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIY-QFGITKLATDQDPEIIRPSRKKSYLMNGTS 1615
             FD D I      +I  PESQ  MVL VV +ALLLDNMLYMVIVPI+P Y+  M   G         ++++ +SM+                  E +T++G LFA KAIVQLL NP+SGT+IDRIGYD+PMM GL +IFVSTS FAFG +  V+FLARGLQGVGSAFADT+GLAMIADR+T E+ RT ALGIALAFISFGSLVAPPFG +LYQ+ GKE PF  LAF+AL DGFLLM+IM+PVR+ER  +KAEGNLPKGTPI +L +DPYIAICAG L IANVSLAFLEPTI++WM S     + +  GL+WLPAF PH+AGV  TVKLAAKYP+YQWLMA +GLA+EG+SC  IPFC+NF  LMIPIS+LC+GIALVDTAILPT+G+LVDTRHVSVYGSVYAIAD+SYS+AYA+GPIVAG +V  I F  LNI++ +V++ Y PVLYL+R  Y +  IT  + D        +  K Y M+ T+
Sbjct:    4 TFDFDKIVSGFSGRIQDPESQRRMVLCVVCVALLLDNMLYMVIVPIIPDYLQTMSGLGHEEVLWINATHSKRISMLSDNFTATSGQYQLRWLVHESDTKIGTLFAFKAIVQLLFNPISGTIIDRIGYDLPMMFGLCVIFVSTSMFAFGSSYGVLFLARGLQGVGSAFADTAGLAMIADRYTVEAERTKALGIALAFISFGSLVAPPFGGILYQFFGKELPFISLAFVALFDGFLLMIIMQPVRIERTVLKAEGNLPKGTPIHRLLLDPYIAICAGCLTIANVSLAFLEPTISNWM-SETMHATNAQEGLVWLPAFLPHLAGVITTVKLAAKYPKYQWLMAAVGLAIEGMSCFLIPFCTNFLALMIPISILCYGIALVDTAILPTMGFLVDTRHVSVYGSVYAIADLSYSVAYALGPIVAGELVQAIKFLGLNIVMTLVTLIYVPVLYLLRGCYLENEITAASRDLRRRSTFSADAKRYSMSATT 486          
BLAST of slc18a-6 vs. TrEMBL
Match: A0A074ZG82 (Transporter, major facilitator family protein OS=Opisthorchis viverrini OX=6198 GN=T265_06481 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 302/484 (62.40%), Postives = 362/484 (74.79%), Query Frame = 2
Query:  236 NFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ--------SNNESMSMMH---------------TEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIY-QFGITKLATDQDPEIIRPSRKKSYLMNGTS 1615
             FD D I      +I  PESQ  MVL VV +ALLLDNMLYMVIVPI+P Y+  M   G         ++++ +SM+                  E +T++G LFA KAIVQLL NP+SGT+IDRIGYD+PMM GL +IFVSTS FAFG +  V+FLARGLQGVGSAFADTSGLAMIADR+T E+ RT ALGIALAFISFGSLVAPPFG +LYQ+ GKE PF  LAF+AL DGFLLM+IM+PVR+ER  +KAEGNLPKGTPI +L +DPY+AICAG L IANVSLAFLEPTI++WM S     + +  GL+WLPAF PH+AGV  TVKLAAKYP+YQWLMA  GLA+EG+SC  IPFC+NF  LMIPIS+LC+GIALVDTAILPT+G+LVDTRHVSVYGSVYAIAD+SYS+AYA+GPIVAG +V  I F  LNI++ +V++ Y PVLYL+R  Y +  IT  + D        +  K Y M+ T+
Sbjct:   32 TFDFDKIVSGFSGRIQDPESQRRMVLCVVCVALLLDNMLYMVIVPIIPDYLQTMSGLGHEEVLWINATHSKRISMLSDNFTATSGQYQLRWLVHESDTKIGTLFAFKAIVQLLFNPISGTIIDRIGYDLPMMFGLCVIFVSTSMFAFGSSFGVLFLARGLQGVGSAFADTSGLAMIADRYTIEAERTKALGIALAFISFGSLVAPPFGGILYQFFGKELPFISLAFVALFDGFLLMIIMQPVRIERTVLKAEGNLPKGTPIHRLLLDPYVAICAGCLTIANVSLAFLEPTISNWM-SETMHATNAQEGLVWLPAFLPHLAGVITTVKLAAKYPKYQWLMAAAGLAIEGMSCFLIPFCTNFLALMIPISILCYGIALVDTAILPTMGFLVDTRHVSVYGSVYAIADLSYSVAYALGPIVAGELVQAIKFLGLNIVMTLVTLIYVPVLYLLRGCYLENEITAASRDLRRRSTFSADAKRYSMSATT 514          
BLAST of slc18a-6 vs. TrEMBL
Match: A0A4S2MFN4 (MFS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001267 PE=4 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 309/535 (57.76%), Postives = 379/535 (70.84%), Query Frame = 2
Query:  236 NFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ--------SNNESMSMMH---------------TEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIY-QFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENI-------HYQNHIEPNS--HDFPVEQASLIAKSHE--QSYNS 1735
             FD D I      +I  PESQ  MVL VV +ALLLDNMLYMVIVPI+P Y+  M   G         ++++ +SM+                  E +T++G LFA KAIVQLL NP+SGT+IDRIGYD+PMM GL +IFVSTS FAFG +  V+FLARGLQGVGSAFADT+GLAMIADR+T E+ RT ALGIALAFISFGSLVAPPFG +LYQ+ GKE PF  LAF+AL DGFLLM+IM+PVR+ER  +KAEGNLPKGTPI +L +DPYIAICAG L IANVSLAFLEPTI++WM S     + +  GL+WLPAF PH+AGV  TVKLAAKYP++QWLMA +GLA+EG+SC  IPFC+NF  LMIPIS+LC+GIALVDTAILPT+G+LVDTRHVSVYGSVYAIAD+SYS+AYA+GPIVAG +V  I F  LNI++ +V++ Y PVLYL+R  Y +  IT  + D        +  K Y ++ T+      E         + Q  +E  +  H  P +  +    SH+  + YN 
Sbjct:    4 TFDFDKIVSGFSGRIQDPESQRRMVLCVVCVALLLDNMLYMVIVPIIPDYLQTMSGLGHEEVLWINATHSKRISMLSDNFTATSGQYQLRWLVHESDTKIGTLFAFKAIVQLLFNPVSGTIIDRIGYDLPMMFGLCVIFVSTSMFAFGSSYGVLFLARGLQGVGSAFADTAGLAMIADRYTVEAERTKALGIALAFISFGSLVAPPFGGILYQFFGKELPFISLAFVALFDGFLLMIIMQPVRIERTVLKAEGNLPKGTPIHRLLLDPYIAICAGCLTIANVSLAFLEPTISNWM-SETMHATNAQEGLVWLPAFLPHLAGVITTVKLAAKYPKFQWLMAAVGLAIEGMSCFLIPFCTNFLALMIPISILCYGIALVDTAILPTMGFLVDTRHVSVYGSVYAIADLSYSVAYALGPIVAGELVQAIKFLGLNIVMTLVTLIYVPVLYLLRGCYLENEITAASRDLRRRSTFSADSKRYSVSATTDALGITEGTDQPIYPGYEQQELEDRTTKHMHPQKTVTFGRSSHDSYEGYND 537          
BLAST of slc18a-6 vs. TrEMBL
Match: A0A5J4NLF2 (MFS transporter, DHA1 family, solute carrier family 18, member 3 OS=Paragonimus westermani OX=34504 GN=DEA37_0006315 PE=4 SV=1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 308/549 (56.10%), Postives = 392/549 (71.40%), Query Frame = 2
Query:  248 DNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQ--------SNNESMSMMHTE---------------EGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFP-VEQASLIAKSHEQSYNSTATNSQIYXXXXXXXXXXXEEIRKNQYGY 1822
            + +K     +I  PESQ TMVL VV +ALLLDNMLYMVIVPI+P Y+  + + GQ        ++++ MS+ + E               E + ++G LFA KAI+QLL NP+SGT+IDRIGYD+PMM GL +IFVSTS FAFG +  +MFLARGLQG+GSAFADT+GLAMIADR+T E  RT ALGIALAFISFGSLVAPPFG +LYQ+ GKE PF  LAFIAL+DGFLLM+IM+P+R+ER  +KAEGNLPKGTPI +L  DPYIAICAG LA+ANVSLAFLEPTI++WM S     + +  GL+WLPAF PH+AGV  TVKLA KYP++QWLMA +GLA+EGISC FIPF SNF  LMIPIS+LC+GIALVDTAILPT+ +LVDTRHVSVYGSVYAIADISYSLAYAIGPIVAG +V  I F  LNI++ ++++ Y PVLYL+RN  +      A+ +    +R  R+ ++ ++G     ++L      +    +   +P  + +S +  S +   NS   N+Q+      S+      ++++ YGY
Sbjct:    8 ERLKNEFTSRIQNPESQRTMVLCVVCIALLLDNMLYMVIVPIIPDYLQTIWSLGQEEVVWTNGTHSQQMSLKNNEFNVTTGQYQLRWLVHESDAKIGTLFAFKAIIQLLFNPISGTIIDRIGYDVPMMFGLCVIFVSTSMFAFGYSFGLMFLARGLQGMGSAFADTAGLAMIADRYTSEQERTKALGIALAFISFGSLVAPPFGGILYQFFGKEIPFLSLAFIALIDGFLLMVIMQPIRIERTVLKAEGNLPKGTPIHRLLQDPYIAICAGCLAVANVSLAFLEPTISNWM-SQTMKATNAQEGLVWLPAFLPHLAGVVTTVKLAVKYPKHQWLMAAVGLAIEGISCFFIPFSSNFIALMIPISVLCYGIALVDTAILPTMAFLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGGLVQAINFYGLNIVITLLTLVYVPVLYLLRNCCKECEITAASRE----LR--RRSTFSVSGRKFAQESLNEAALLD--SEDKLIYPGYDPSSSVGTSDK---NSRTLNTQVCHGKYDSTADEFSIVKQDGYGY 544          
BLAST of slc18a-6 vs. Ensembl Cavefish
Match: slc18a3a (solute carrier family 18 member A3 [Source:NCBI gene;Acc:103044616])

HSP 1 Score: 471.47 bits (1212), Expect = 1.259e-159
Identity = 236/425 (55.53%), Postives = 303/425 (71.29%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNE----------SMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNI 1522
            I  PE Q  ++L++V +ALLLDNMLYMVIVPIVP Y+  ++++ + ++           S +    E  + Q+G+LFA KAI+QL++NPL+GT IDR+GYDIP++IGL I+FVST  FAF +    MF+AR +QG+GSAFADT+G+AMIAD +TEE+ R+ ALGIALAFISFGSL APPFG VLYQ+ GK  PF  LA + L DG L + ++KP     RE     N+P G PI KL +DPYIA+ AG L   N+ LAFLEPTI +WM       S+  IGL WLPAFFPHV GV++TVKLAA+YP  QW    +G+ + G S   +P C NF  L+IP+  +CFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISY +AYA+GPIVAG IV  +GF  LN+ + + ++ Y P L L+RN+
Sbjct:   31 IQDPERQRRIILVIVCVALLLDNMLYMVIVPIVPDYLARLESQSEQSHHVVLSNSTNSSSQTNFPAENLDLQVGVLFASKAILQLIVNPLTGTFIDRVGYDIPLLIGLSIMFVSTCIFAFAENYATMFVARSMQGLGSAFADTAGIAMIADTYTEEAERSRALGIALAFISFGSLAAPPFGGVLYQFAGKRVPFIALACVCLADGILCLTVLKPFSSRTRE-----NMPVGPPIYKLMIDPYIAVVAGALTTCNIPLAFLEPTIANWMEETMD-SSQWQIGLTWLPAFFPHVLGVYITVKLAAQYPHLQWFYGALGMVIIGASSCTVPACKNFEQLIIPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYCVAYAMGPIVAGKIVHDLGFVQLNLGMGLANVLYAPALLLLRNV 449          
BLAST of slc18a-6 vs. Ensembl Cavefish
Match: slc18a3b (solute carrier family 18 member 3b [Source:NCBI gene;Acc:394082])

HSP 1 Score: 446.047 bits (1146), Expect = 3.546e-150
Identity = 225/447 (50.34%), Postives = 304/447 (68.01%), Query Frame = 2
Query:  266 VERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRF-TEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLM 1603
            V   +  P+ Q T++L++V +ALLLDNMLYMVIVPI+P Y+       ++N +            ++G+LFA KAI+QL +NPLSG  IDR+GYD+P++IGL+++F+ST  FAF +T   +F AR LQG+GSAFADTSG+AMIADR+  EE+ R+ ALG+ALAFISFGSLVAPPFG +LY+  GK  PF  LA + L DG LL+ ++KP         A  N P G P+ +L MDPYIA+ AG L + N+ LAFLEPTI  WM +     ++  IGL WLP+FFPHV GV++TVKLA +YP  QW    +G+ + G S   +P C +F  LM+P+  +CFGIALVDTA+LPT+ +LVD R+ SVYGSVYAIADISYS+AYA+GP+ AG IV T+GF  LN+ + + ++ Y P L  +R++ Q              I+PSR +  ++
Sbjct:   12 VREAMRDPKRQRTVILVIVCVALLLDNMLYMVIVPIIPDYLAGASPVSKTNLD-----------VKIGVLFASKAILQLAVNPLSGPFIDRVGYDLPLLIGLMVMFMSTCVFAFAETYATLFAARSLQGLGSAFADTSGIAMIADRYGDEETERSRALGLALAFISFGSLVAPPFGGILYELAGKRVPFLVLACVCLADGCLLLAVVKPFS----NQGARQNQPAGVPLHRLIMDPYIAVVAGALTVCNIPLAFLEPTIAGWMENTMHA-TKWQIGLAWLPSFFPHVLGVYLTVKLAERYPSMQWFYGAVGMLIIGASSCVVPACKSFSQLMLPLCGICFGIALVDTALLPTMAFLVDVRYASVYGSVYAIADISYSVAYALGPVAAGHIVHTMGFAQLNLGMGLANVLYAPALLALRHVCQ--------------IKPSRSERRIL 428          
BLAST of slc18a-6 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 293.893 bits (751), Expect = 4.106e-91
Identity = 159/372 (42.74%), Postives = 233/372 (62.63%), Query Frame = 2
Query:  404 KGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            KG  ++        +E N ++GLLFA KA+VQLL+NP  G + +RIGY IPM  G II+FVST  FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T++  R  A+GIAL  ++ G L+  PFG+V+Y++ GK  PF  LAF+AL DG L + I++P ++    +       +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL + IG+ + GIS I +P  SN   L+ P   L F I +VD++++  +GYLVD RH SVYGSVYAIAD++  + +AIGP   G+IV  IGF  L +++ +V+I Y P+ Y ++N
Sbjct:  107 KGNKSDCKDDTEFLDEENVRVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSV-------EGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTM-CSQKWQLGVAFLPASVSYLIGTNLFGLLANK--MGRWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKN 468          
BLAST of slc18a-6 vs. Ensembl Cavefish
Match: slc18a2 (synaptic vesicular amine transporter [Source:NCBI gene;Acc:103032219])

HSP 1 Score: 292.352 bits (747), Expect = 2.048e-90
Identity = 176/494 (35.63%), Postives = 270/494 (54.66%), Query Frame = 2
Query:  305 MVLIVVSMALLLDNMLYMVIVPIVPHYM---DYMKNKGQSNNESMSMMHTEEG------------------------------------------------NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPS----RKKSYLMNGTSLE 1621
            ++L++V +ALLLDNML  V+VPI+P Y+   D   +     N S S   T +                                                 N ++GLLFA KA VQL+ NP  G + +RIGY IPM  G  I+F+ST  FAF  +  ++FLAR +QGVGS+ +  +G+ M+A  +T++  R  A+GIAL  ++ G LV PPFG+V+Y++ GK  PF  LA +A+LDG L + +++P ++E           KGT +  L  DPYI I AG++  AN+++A LEP +  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL A IG+ L GIS + +PF  +   L++P   + F I +VD++++P +GYLVD RH+SVYGSVYAIAD+++ + +A GP   G+I  +IGF  L  I+ +V I + P+ + +R       +  A ++   I+  S    R +SY   G+S +
Sbjct:   25 LILLIVFIALLLDNMLLTVVVPIIPSYLYTVDDAASNAVRKNSSSSPSGTFQTIVSLYDNTTRLTNISPQFNTPTMPPTTTVTSAPNASNCPKADDQLLNENVKVGLLFASKATVQLITNPFIGPLTNRIGYQIPMFAGFCIMFLSTIMFAFSSSYTLLFLARSMQGVGSSCSSVAGMGMLASVYTDDEERGNAIGIALGGLAMGVLVGPPFGSVMYEFVGKTAPFLILAVLAVLDGALQLFVLQPSKVEPESQ-------KGTSLMTLMKDPYILIAAGSICFANMAIAMLEPALPIWMMETM-CARKWQLGVAFLPASVSYLIGTNIFAVLANK--MGRWLCALIGMLLVGISILCVPFAKDIYGLILPNFGVGFAIGMVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMGFAFGPSAGGAIARSIGFPWLMTIIGIVDILFAPLCFFLR-------SPPANEEKMAILMDSNCSMRTRSYSTQGSSYQ 501          
BLAST of slc18a-6 vs. Ensembl Cavefish
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:103028146])

HSP 1 Score: 279.256 bits (713), Expect = 2.003e-85
Identity = 155/377 (41.11%), Postives = 230/377 (61.01%), Query Frame = 2
Query:  404 KGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIII-----FVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            KG  ++        +E N ++GLLFA KA+VQLL+NP  G + +RIGY IPM I   +I     F+    FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T++  R  A+GIAL  ++ G L+  PFG+V+Y++ GK  PF  LAF+AL DG L + I++P ++    ++       GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL + IG+ + GIS I +P  SN   L+ P   L F I +VD++++  +GYLVD RH SVYGSVYAIAD++  + +AIGP   G+IV  IGF  L +++ +V+I Y P+ Y ++N
Sbjct:  110 KGNKSDCKDDTEFLDEENVRVGLLFASKALVQLLVNPFVGPLTNRIGYHIPMFILATVIMIMFAFIYNILFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTDDEERGIAMGIALGGLAMGVLIGAPFGSVMYEFVGKSSPFLILAFLALFDGALQLCILQPSKISPGSVE-------GTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTM-CSQKWQLGVAFLPASVSYLIGTNLFGLLANK--MGRWLCSMIGMFIVGISLICVPLASNIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHSSVYGSVYAIADVALCMGFAIGPSTGGAIVRVIGFPYLMVMIGIVNILYAPLCYFLKN 476          
BLAST of slc18a-6 vs. Ensembl Sea Lamprey
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 465.307 bits (1196), Expect = 6.474e-158
Identity = 244/494 (49.39%), Postives = 319/494 (64.57%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMK--------------NKGQSNNESMSMMHT----------------------------------------EEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSY 1597
            +  P  Q  +VL +V +ALLLDNMLYMVIVPI+P Y++ M               ++ Q  +E  + + T                                         + + ++G+LFA KAIVQLL+NPL+GT IDR+GYD+P++IGL IIF+ST+ FAFG++   +F AR LQG+GSAFADT+ +AMIADRFTEE+ R+ ALGIALAFISFGSLVAPPFG  LY++ GK  PF  LA ++L DG LLM++ KP     RE     N+P+GTPI +L MDPYI + AG L +AN+ LAFLEPTI SWM       +E   G+ WLPAFFPHV GV++TVKLAAKYPQ QW   G+GL + G S   +P C  F  L+ P+  +CFGIALVDTA+LP L +LVD RH SVYGSVYAIADISYSLAYA+GPIVAG IV T+GF  L++ + + ++ Y P+L L+R++     +   T++   +   S K++Y
Sbjct:    1 MQNPRRQRGLVLFIVCVALLLDNMLYMVIVPIIPDYVEAMHRDTERAALAQEQRAHRSQHRHEVTTAVATYSEEGEEGVGGVYNFTSGTATTAAALATTVAATAHVADDDADEDIRIGILFASKAIVQLLVNPLTGTFIDRVGYDLPLLIGLSIIFLSTAVFAFGESYATLFAARSLQGLGSAFADTAAIAMIADRFTEEAERSRALGIALAFISFGSLVAPPFGGTLYEFVGKRVPFLVLACVSLFDGLLLMVVAKPFSSRSRE-----NMPQGTPIYRLMMDPYIVVVAGALTMANIPLAFLEPTIASWMKKTMGA-NEWQRGMTWLPAFFPHVLGVYITVKLAAKYPQLQWFYGGLGLVIIGSSSCLVPACRTFEELIAPLCGICFGIALVDTALLPLLAFLVDVRHASVYGSVYAIADISYSLAYAMGPIVAGQIVHTMGFVQLSLGMGLTNVLYAPMLLLLRHVCALRPSASFTERRALLPEDSCKEAY 488          
BLAST of slc18a-6 vs. Ensembl Sea Lamprey
Match: slc18a2 (solute carrier family 18 member 2 [Source:ZFIN;Acc:ZDB-GENE-080514-1])

HSP 1 Score: 282.337 bits (721), Expect = 5.826e-87
Identity = 152/374 (40.64%), Postives = 229/374 (61.23%), Query Frame = 2
Query:  407 GQSNNESMSMMHTE---EGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            G + N+S+  M        N ++GLLFA KA VQLL NP  G + +R+GY  PM  G II+F+ST  FAF Q+  ++FLAR LQG+GS+ +  +G+ M+A  + ++  R  A+G+AL  ++ G LV PPFG+++Y + GK  PF  LA +AL DG L M++++P + E            GTP+  L  DPYI I AG++ IAN+ +A LEP +  WM+     P +  +G+ ++PA   +  G  +   LA K    +WL A IG+ + GIS I +P       L++P   + F I +VD++++P +GYLVD RHVSVYGSVYAIAD+++ + +A+GP   G+I  TIGF  L  I+ ++ I + P+ Y +R+
Sbjct:  129 GSALNDSLCDMDVAALLNENVRVGLLFAAKATVQLLANPFIGPLTNRVGYHSPMFAGFIIMFLSTIMFAFAQSYPLLFLARALQGIGSSCSSVAGMGMLASLYPDDEERGNAMGVALGGLAMGVLVGPPFGSIMYDFVGKPAPFLVLAGLALFDGALQMLVLQPSKSEPESQ-------TGTPLLTLLRDPYILITAGSICIANMGIAMLEPALPIWMMETMCSP-KWQLGVAFIPASISYWIGTNIFGPLAHK--MGRWLCALIGMVVVGISIICVPLAKTIYGLIVPNFGVGFAIGMVDSSMMPLMGYLVDLRHVSVYGSVYAIADVAFCMGFALGPSAGGAIARTIGFPWLMTIIGIIDILFAPLCYFLRS 492          
BLAST of slc18a-6 vs. Ensembl Sea Lamprey
Match: slc18b1 (solute carrier family 18 member B1 [Source:ZFIN;Acc:ZDB-GENE-050417-386])

HSP 1 Score: 62.3882 bits (150), Expect = 1.304e-10
Identity = 80/310 (25.81%), Postives = 131/310 (42.26%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAF------GQTLEVM-FLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAA--------KYPQYQWLMAGIGLALEGIS-CIFIPFCSNFGYLMIPISLLCFGIAL------VDTAILPT 1318
            ++ +GL+F   A+  LL +PL G  I  IG     + G+++    T  F        G     M F+ R +  +G A + T+   ++A  F    S  T +G    F   G ++ PP G  LY+  G + PF       ++  F+L+MI  P+       + + ++P      +L M P I I +  +     SL F +PT  S  LS +       IGL++        AG+ ++  L++        K P  +  +  IG  + GI  C+  P      +L IP  L    + L      + TAI+PT
Sbjct:   60 DSIVGLIFGSFALTNLLSSPLFGKYIVHIGSKFMFLSGMLVTGTCTILFGLLDEAPSGSVYIAMCFVVRCMDALGCAASTTASFTILAGTFPH--SIATVMGFLEIFTGLGLVLGPPVGGFLYELWGFKLPFL------VIGTFVLLMI--PINFAILPPQGQNSVPSNGSFVRLVMLPPIVIVSLLICSLGSSLGFFDPTF-SLFLSEQFDLKPGKIGLVF--------AGLCISYALSSPFIGYISDKKPHLRRRIMAIGAFVSGICFCMLGP----VPFLHIPTQLWLLVMVLFVLGVSIGTAIVPT 346          
BLAST of slc18a-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008246.1 (pep scaffold:Pmarinus_7.0:GL480278:6713:20715:1 gene:ENSPMAG00000007448.1 transcript:ENSPMAT00000008246.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 6.830e-6
Identity = 41/148 (27.70%), Postives = 66/148 (44.59%), Query Frame = 2
Query:  380 HYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVST--SAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGK 817
            +YMD     G    ++   +  +  +++   +F C     +L+ P+ G + DR    + M +G+ +  V+T  S+F   +      L RGL G+G A   T    +IAD +T +  RT  L I    I  GS +    GA L Q  G 
Sbjct:   23 NYMDRFTVAGARQTKAQYCIVLQWSSSKSCAVFICS---YMLLAPIFGYLGDRFNRKMIMSVGIAVWSVTTLGSSFIPKENFWAFLLMRGLVGIGEASYSTIAPTVIADLYTRD-KRTRMLSIFYFAIPVGSGLGYILGANLAQLTGN 166          
BLAST of slc18a-6 vs. Ensembl Nematostella
Match: EDO35798 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKG1])

HSP 1 Score: 60.4622 bits (145), Expect = 1.472e-9
Identity = 56/223 (25.11%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  455 NTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAF-----GQTLEVMF--LARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWL 1102
            +  +G++F   ++V  L++PL G  + ++G    +  GL ++  + + F F       ++ ++F  L R +  +G + AD +  A++A  F       T  G    F   G +  PP G VL+   G   PF  +    LL   L+M ++ P+  E    +++G+L K   + K+   P I +    + ++ V L FL+PT+   +  ++  P++  IGL++L
Sbjct:   80 SASIGIIFGVYSLVTFLMSPLMGIWLPKVGPRFMITSGLFLMGGAETLFGFVADMPNGSVFIVFCILLRIVSALGGSMADVAIFAIVAGEFPNSIGAVT--GSMEVFSGLGFMAGPPLGGVLFTAGGFRLPFIVMGASILLSLPLVMFVL-PMPRETTSRESKGSLLK---VMKI---PGIIMLGSCIILSGVVLGFLDPTLAPHLKPFKLNPTQ--IGLMFL 291          
BLAST of slc18a-6 vs. Ensembl Medaka
Match: slc18a3a (solute carrier family 18 member 3a [Source:NCBI gene;Acc:559347])

HSP 1 Score: 485.723 bits (1249), Expect = 3.819e-165
Identity = 250/486 (51.44%), Postives = 328/486 (67.49%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNT------------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQ----FGITKLATDQDP-----EIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNS 1672
            I  PE Q  ++L++V +ALLLDNMLYMVIVPI+P Y++ ++ K   N +   + H+   N+            Q+G+LFA KAIVQLL+NP+SGT IDR+GYDIP+ IGL ++F+ST  FAF +    +FLAR +QG+GSAFADTSG+A+IADR+TEE+ R+ ALGIALAFISFGSLVAPP+G VLY++ GK  PF  LA I L+DG L + ++KP   + R     GN+P GTPI KL +DPYIA+ AG L I N+ LAFLEPTI +WM       +E  IG+ W PAFFPHV GV++TVKLAAK+P  QW    +G+   G S   +P C NFG LMIP+  +CFGIALVDTA+LPTLG+LVD RHVSVYGSVYAIADISY +AYA+GP+VAG IV  +GF  LN+ + + ++ Y P L L++N+ Q    F    +  +  P      I    R+K      T+L+   +E    +++ E  S
Sbjct:   35 IQDPERQKRIILVIVCVALLLDNMLYMVIVPIIPDYLEGLQ-KAADNAQHAIVRHSNSTNSSTPKAPTGNFDLQIGVLFASKAIVQLLVNPISGTFIDRVGYDIPLFIGLNVMFLSTLTFAFAENYATLFLARSIQGLGSAFADTSGIALIADRYTEETERSKALGIALAFISFGSLVAPPYGGVLYEFAGKRVPFLILACICLIDGVLCLTVLKPFSNQER-----GNMPVGTPIYKLMIDPYIAVVAGALIICNIPLAFLEPTIANWMEDTMQA-TEWEIGMTWFPAFFPHVLGVYLTVKLAAKHPHLQWFYGAMGMVFIGASSCTVPACKNFGQLMIPLCGVCFGIALVDTALLPTLGFLVDVRHVSVYGSVYAIADISYCVAYALGPVVAGQIVHNLGFVQLNLGMGLANVLYAPALLLLKNVSQMKPSFSERNMLLEDGPTGLYDTIKMEQREKKRKGLCTTLDENGIETFVQRSYSEEES 513          
BLAST of slc18a-6 vs. Ensembl Medaka
Match: slc18a3b (probable vesicular acetylcholine transporter-B [Source:NCBI gene;Acc:101163117])

HSP 1 Score: 485.337 bits (1248), Expect = 5.719e-165
Identity = 249/471 (52.87%), Postives = 322/471 (68.37%), Query Frame = 2
Query:  278 INRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNK------------GQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQ----FGITKLATDQDPEII--------RPSRKKSYLMNGTSL 1618
            +  P  Q  ++L++V +ALLLDNMLYMVIVPI+P Y+  ++N+               N+ S    +    + Q+G+LFA KAI+QLL+NPLSGT IDR+GYDIP++IGL ++F+ST  FAFG+    +F AR LQG+GSAFADTSG+AMIAD++TEE+ R+TALGIALAFISFGSLVAPPFG VLY++ GK  PF  LA I L DG L++ ++KP     RE     N+P GTPI KL +DPYIA+ AG L +AN+ LAFLEPTI +WM +     ++  +GL WLPAFFPHV GV++TVKLAAK P  QW    +G+ + G S   +P C  FG L+ P+  +CFGIALVDTA+LPTL +LVD RHVSVYGSVYAIADISYS+AYA+GPIVAG IV T+GF  LN+ + +V++ Y P L L+R + Q    F       D+ P+ +        R  +KK Y   G  L
Sbjct:   32 MRDPHQQRRIILVIVCVALLLDNMLYMVIVPIIPDYLADLENEQLEHVHVVMHPNTSGNSTSQDKSNKNNLDLQIGVLFASKAILQLLVNPLSGTFIDRVGYDIPLLIGLTVMFISTCIFAFGENYATLFAARSLQGLGSAFADTSGIAMIADKYTEEAERSTALGIALAFISFGSLVAPPFGGVLYEFAGKRVPFLVLASICLADGVLVLTVIKPFSNRTRE-----NMPVGTPIYKLMVDPYIAVVAGALTVANIPLAFLEPTIANWMETTMH-STQWEMGLTWLPAFFPHVLGVYITVKLAAKNPHLQWFYGALGMVIIGASSCTVPACKTFGQLIAPLCGICFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYAMGPIVAGQIVHTLGFVQLNLGMGLVNVLYAPALLLLRTVSQMKPSFSERDNLLDEAPQGLYDTIKMEERRVKKKGYSSAGNCL 496          
BLAST of slc18a-6 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 284.263 bits (726), Expect = 7.840e-88
Identity = 151/358 (42.18%), Postives = 228/358 (63.69%), Query Frame = 2
Query:  446 EEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            EE N  +GLLFA KA++QLL+NP  G + +R+GY IPM  G II+FVST  FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T +  R  A+GIAL  ++ G L+  PFG+V+Y + GK  PF  LA +A+ DG L + I++P ++        G++ +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+     P +  +G+ +LPA   ++ G  +   LA K    +WL + +G+ + GIS + +PF ++   L+ P   L F I +VD++++  +GYLVD RH SVYG+VYAIAD++  + +AIGP   G++V  +GF  L + + V++I Y P+  L+RN
Sbjct:   81 EEENVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTIMFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMGIALGGLAMGVLIGAPFGSVMYDFVGKRAPFLILALLAVFDGALQLCILQPSKI------CPGSV-EGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSP-KWQLGVAFLPASISYLIGTNLFGVLANK--MGRWLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVGFPCLMVFIGVINILYAPLCLLLRN 428          
BLAST of slc18a-6 vs. Ensembl Medaka
Match: SLC18A1 (solute carrier family 18 member A1 [Source:NCBI gene;Acc:101172172])

HSP 1 Score: 276.559 bits (706), Expect = 3.907e-84
Identity = 157/406 (38.67%), Postives = 239/406 (58.87%), Query Frame = 2
Query:  368 PIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVST----------------------SAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            P  P  ++   N  +S+    S+   EE N  +GLLFA KA++QLL+NP  G + +R+GY IPM  G II+FVST                      S FAF  T  ++F AR LQG+GS+F+  +GL M+A  +T +  R  A+GIAL  ++ G L+  PFG+V+Y + GK  PF  LA +A+ DG L + I++P ++        G++ +GTP+  L  DPYI I AG+L  AN+ +A LEPT+  WM+     P +  +G+ +LPA   ++ G  +   LA K    +WL + +G+ + GIS + +PF ++   L+ P   L F I +VD++++  +GYLVD RH SVYG+VYAIAD++  + +AIGP   G++V  +GF  L + + V++I Y P+  L+RN
Sbjct:  101 PTPPQLINETANASESSCLQDSVFLEEE-NVHVGLLFASKALIQLLVNPFVGPLTNRVGYHIPMFAGFIIMFVSTISKWVSSPGGWFRTGPCLTVFVSVFAFSGTYALLFFARSLQGIGSSFSSVAGLGMLASVYTNDEERGIAMGIALGGLAMGVLIGAPFGSVMYDFVGKRAPFLILALLAVFDGALQLCILQPSKI------CPGSV-EGTPLLTLLKDPYILISAGSLCFANMGVAILEPTLPIWMMQTMCSP-KWQLGVAFLPASISYLIGTNLFGVLANK--MGRWLCSMLGMVIVGISLLCVPFATSIYGLIGPNGGLGFAIGMVDSSMMAIMGYLVDIRHASVYGTVYAIADVALCMGFAIGPSTGGALVQAVGFPCLMVFIGVINILYAPLCLLLRN 495          
BLAST of slc18a-6 vs. Ensembl Medaka
Match: slc18a2 (solute carrier family 18 member A2 [Source:NCBI gene;Acc:101158793])

HSP 1 Score: 264.618 bits (675), Expect = 2.678e-80
Identity = 169/473 (35.73%), Postives = 250/473 (52.85%), Query Frame = 2
Query:  284 RPESQC-TMVLIVVSMALLLDNMLYMVIVPIVPHYM-------------DYMKNKG----------------------------------------QSNN----ESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDG---FLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            R E Q   ++L +V +ALLLDNML  V+VPI+P Y+             D +  KG                                        Q N+    +S S +  E  N ++G+LFA KA VQL+ NP  G + +RIGY +P+  G  I+F+ST  FAF  +  ++FLAR LQGVGS+ +  +G+ M+A  +T++  R  A+GIAL  ++ G LV PPFG+V+Y + GK  PF  LAF+A+ DG   FLL                     KGTP+  L  DPYI I AG +   N+++A +EPT+  WM+       +  +G+ +LPA   ++ G  +   LA K    +WL A IG+ L G S I +       ++M  ++       +VD++++P +GYLVD RH+SVYGSVYAIAD+++ + +A+GP + GSI   IGF  L  I+ +V I + P+   +RN
Sbjct:   17 REERQSRKLILFIVFVALLLDNMLLTVVVPIIPSYLYNLDESADVALRNDSLSQKGPEGSFHTIVSLYDNSIRLSSSNFTTRPADPVPPTLVVTKLQQNSSDCPQSSSRLLNE--NVKVGMLFASKATVQLVTNPFIGPLTNRIGYQLPIFAGFCIMFLSTIMFAFSSSYTLLFLARSLQGVGSSCSSVAGMGMLASVYTDDEERGHAIGIALGGLALGVLVGPPFGSVMYDFVGKTAPFLILAFLAVFDGGTVFLLFFFQS---------------QKGTPLLTLMKDPYILIAAGAICFGNMAIAMMEPTLPIWMME-TMCTRKWQLGIAFLPASISYLIGTNIFGTLAHK--MGRWLCALIGMVLVGFSVICV-----ISHVMSCVA------GMVDSSMMPIMGYLVDLRHISVYGSVYAIADVAFCMGFALGPSIGGSIAENIGFPWLMTIIGIVDIFFAPLCIFLRN 458          
BLAST of slc18a-6 vs. Planmine SMEST
Match: SMESG000051356.1 (SMESG000051356.1)

HSP 1 Score: 1082.4 bits (2798), Expect = 0.000e+0
Identity = 537/541 (99.26%), Postives = 538/541 (99.45%), Query Frame = 2
Query:  200 ND*NASMKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNSTATNSQIYXXXXXXXXXXXEEIRKNQYGY 1822
             D  ASMKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNST+TNSQIYSQNKSSSNFSSEEIRKNQYGY
Sbjct:   80 KDLQASMKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPEIIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSHEQSYNSTSTNSQIYSQNKSSSNFSSEEIRKNQYGY 620          
BLAST of slc18a-6 vs. Planmine SMEST
Match: SMESG000064025.1 (SMESG000064025.1)

HSP 1 Score: 288.115 bits (736), Expect = 9.478e-89
Identity = 158/456 (34.65%), Postives = 253/456 (55.48%), Query Frame = 2
Query:  290 ESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNN----------------------------------------------ESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            +   TMVLI+V +AL+LDNML  VIVPI+P Y+  + N+   N                                               ++ ++ H    N ++GL+FA K ++QLL NP+ G + +RIGY IPM  G +++F+ST  FA  ++  ++F+AR LQG+GSA +  SG+ M+A  + ++  R  A G AL+ ++ G L+ P FG ++YQY  K  PFF L  +AL+DGF+ ++++KP       +K E    KG  ++ L  DPYI I A ++   N+ +A LEP++  W+ +     +    GL++LP    ++ G  V   +  K    +WL   IG+ + GI  I IPF +   +L++P   + F I +VD++++P +GYLVD RHVSVYGSVYAIAD+++ + +AIGP ++  +V  +GF  +  I  ++ + Y P +  +RN
Sbjct:   32 KQHKTMVLIIVFIALVLDNMLLTVIVPIIPDYLWQLDNRDIINQNCTVLIKYQKPDWTDIIGRKHVAYDEFEGPEIIEKSVINNTCVEELKNRTIQHLSTENMKIGLMFASKPVIQLLTNPIVGPITNRIGYSIPMFFGFLVLFISTMTFALAESYHLLFIARSLQGLGSACSSVSGMGMLATYYVDDVERGKAFGFALSGLAMGVLIGPLFGGLMYQYTSKSVPFFILGSLALIDGFMQIVVLKP------SIKPEDQ--KGASLKTLLRDPYILIAAASITFGNLGIATLEPSLPLWIKTTMKA-TRLEQGLVFLPCSLSYLMGTNVFGPIGVKIG--RWLTTMIGMVIIGICLICIPFATTISHLIVPSFGMGFAIGMVDSSMMPIMGYLVDIRHVSVYGSVYAIADVAFCVGFAIGPSLSSGLVKAVGFRWMIWISAIICLIYTPFIIFLRN 476          
BLAST of slc18a-6 vs. Planmine SMEST
Match: SMESG000009088.1 (SMESG000009088.1)

HSP 1 Score: 278.87 bits (712), Expect = 2.273e-85
Identity = 165/469 (35.18%), Postives = 263/469 (56.08%), Query Frame = 2
Query:  245 TDNIKLYVERKI---NRPESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYM---------------------DYMKNKGQSN-----------NESMSMMHTEEGNT---------QMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRN 1519
            TDN    + RK    N    Q T+VL++V +ALLLDN+L  VIVPI+P Y+                     D+    G+ +           N+S+S +   + N+          +GL+FA K +VQL++NPL G + +R+GY +PM  G +++F+ST  FAF ++ +++F AR  QG+GSA +  SG+ M+A  + ++  R  A G AL+ ++ G L+ P FG ++Y+Y  K+ PF  L  +  LDG L M+++KP       +K E  L  G  ++ L MDPYI + A  + I N+ +A LEP++  W+ S     S    GL++LP    ++ G  V   +  K    +WL   IG+ L  I  + IP   + G L++P +++ F I +VD++ILP +GYLVD RHVSVYG+VYAIAD+++ + +A GP ++G+I+  IGF  +  +  +V   + P++  +RN
Sbjct:   13 TDNCFQKIGRKFFDFNFKVKQRTLVLMIVFVALLLDNVLLTVIVPIMPEYLWTINHNEKIKLFCPGEKVTNKDWTSMIGRKHFGSEILTSTRENDSISCIEELKSNSLSNISSESIAIGLMFASKPVVQLIVNPLVGPITNRMGYTVPMFTGFVVLFISTIVFAFAESYKLLFFARSFQGIGSACSSVSGMGMLATFYPDDKERGEAFGFALSGLAMGVLIGPSFGGIMYEYTDKQVPFIILGALVFLDGVLQMIVLKP------SIKPEPQL--GASLKSLLMDPYIVLAAACITIGNMGIAVLEPSLPIWIKSTMKA-SRLEQGLVFLPFSLSYLLGTNVFGYIGHKIG--RWLGTMIGMLLISIFLLIIPLAVDIGSLIVPGTIIGFAIGMVDSSILPIMGYLVDIRHVSVYGTVYAIADVAFCVGFATGPAISGAIIKAIGFQWMLTVAAIVCFLFTPLIVFLRN 470          
BLAST of slc18a-6 vs. Planmine SMEST
Match: SMESG000070401.1 (SMESG000070401.1)

HSP 1 Score: 113.235 bits (282), Expect = 2.065e-26
Identity = 102/424 (24.06%), Postives = 184/424 (43.40%), Query Frame = 2
Query:  356 MVIVPIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQ---YCGKEFPFFCLAFIALLDGFLLMMIMKP-----------------VRLERREMKAEG------------------------NLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYC 1495
            M+ V I P  + Y   K   NN ++  +     N ++  +   +++V L+  P+ G +I+  G      IGL           F  T  ++ + + ++G GS+    + L +I+ +F +   ++  +G+    I  G+ V+P    +LY+     G+   +  + F   ++  + ++I K                  +  +RR    +G                        ++ + TPI KL +DPYIAIC   +   ++    L  T++ W L  R   +E+  GL+W+P+F  ++    + + L    P   ++   I   + G S I +PF  ++  +MI +S     + LV   +LP +  + D RH SV+GSV AI + S  +  A     AGSIV+  GF  LN+ V   +  YC
Sbjct:    1 MIGVSIFPSLLQYEILKMDPNNTNVIYL----VNVRISFIMGSRSLVHLIFTPIWGILINIFGPIQFGYIGLTTEIFGCLMLGFANTYIMLIIGKCIEGFGSSLVTVAALTIISLKFHDYEEKSCIMGLTSISIVLGNYVSPFVAGILYENFKLDGQMAVYLSMVFCKFINILIYVVINKKSVEVEDFKDSIINRNNSIEPDRRSSSLKGTYHLLEKIGSGESLGMMMESEFITHVTETTPIYKLLIDPYIAICILGIIACHLPHYSLLTTLSIW-LHERFGVNETIQGLVWVPSFIFNIFTYLLGLVLVKYVPHQGYIFVIISFIISGASNIALPFLPSWWLVMIVLSNFALNLTLVKFLLLPLVVMISDLRHNSVHGSVAAIINESMHIGAAFSFFAAGSIVNRFGFLVLNLSVATTAFIYC 419          
BLAST of slc18a-6 vs. Planmine SMEST
Match: SMESG000069017.1 (SMESG000069017.1)

HSP 1 Score: 100.523 bits (249), Expect = 7.127e-22
Identity = 103/467 (22.06%), Postives = 198/467 (42.40%), Query Frame = 2
Query:  290 ESQCTMVLIVVSMALLLDNMLYMVIVPIVPHYMDYMKNKGQSNNES--------MSMMHTEEGNTQMGLLFACKAIVQLLINPLSGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAFADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGKEFPFFCLA---FIALLDGFLLMMIMKPVRLERR---------------------------------------------EMKAEGNLPKGTPIQKLFMDPYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFPHVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPISLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPIVAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNI 1522
             S   +V+IVV +   +  +    +  I+P Y+   +  G+ NN S        M  +  +     + ++F  K +  + INP+ G ++DR+   I ++   I+       +AF  ++ +  + R +    ++    +  ++I+  F E   R+   G           + P +GA + +  GK   F  L     I+LL  +LL   +K +   ++                                             E K  GN      I K+  DP +  C   + + N+ +  L PT+ SWM +++   SE   G++W   F  ++ GV + + + A  P+++ L    G  + GI  I IPF  ++ +L +PI  +   + +V+  ILP   YL D+ + S YG++ ++   S +L   I  + +G I    GFT+L I + ++++++ P+  + R I
Sbjct:   97 RSDYLLVIIVVGLNFFMMVIEESSLYTILPKYLS-NRTFGEINNYSRIYASNLSMKCVSKDPPYVIISMIFLSKNLATIFINPIIGMILDRMNNFIILIFAQILGVSVLLVYAFSNSILMYIIGRIIDAFVTSVIFLAVYSIISQMFLETRIRSKYYGFVNTLFFVSHSLGPVYGASVDEKFGKSAVFLLLIPIWSISLLFTYLLHRRIKTINKNKKGVPRFLEIMENHNWNDTRVDSPNNESKNLILSESSEKNETIKVKIENKQSGNHRTLFTIFKMLKDPKVLACLVQIFVVNLCMFSLPPTLPSWM-AFKLCSSELQQGIVWSFGFLGYILGVSLVIIIDAYAPRFRNLAPVAGQIIIGIQLIMIPFTRDWRFLFLPIIGMYISVGVVEQIILPLTTYLSDSLYNSNYGTMSSLTSQSLNLCSVISSLCSGPIAEKYGFTTLAIALGIINLSFSPISLIHRKI 561          
The following BLAST results are available for this feature:
BLAST of slc18a-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC18A35.551e-14851.49solute carrier family 18 member A3 [Source:HGNC Sy... [more]
SLC18A23.656e-8241.41solute carrier family 18 member A2 [Source:HGNC Sy... [more]
SLC18A12.066e-7641.89solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A12.066e-7641.89solute carrier family 18 member A1 [Source:HGNC Sy... [more]
SLC18A12.519e-6641.92solute carrier family 18 member A1 [Source:HGNC Sy... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-171.236e-16549.71Vesicular acetylcholine transporter unc-17 [Sourc... [more]
cat-15.737e-8241.62pep chromosome:WBcel235:X:5705719:5710585:-1 gene:... [more]
cat-11.647e-8141.62pep chromosome:WBcel235:X:5705719:5710625:-1 gene:... [more]
vpat-12.423e-1125.35Vesicular PolyAmine Transporter [Source:UniProtKB... [more]
vpat-11.363e-1025.35Vesicular PolyAmine Transporter [Source:UniProtKB... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAChT1.318e-17353.60gene:FBgn0270928 transcript:FBtr0083671[more]
Vmat9.941e-9137.69gene:FBgn0260964 transcript:FBtr0310062[more]
Vmat9.941e-9137.69gene:FBgn0260964 transcript:FBtr0091491[more]
Vmat9.941e-9137.69gene:FBgn0260964 transcript:FBtr0091493[more]
Vmat1.817e-9037.69gene:FBgn0260964 transcript:FBtr0091492[more]
back to top
BLAST of slc18a-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a3a1.289e-16657.04solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18a3b1.360e-10244.60solute carrier family 18 member 3b [Source:NCBI ge... [more]
SLC18A11.585e-9635.69solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A11.424e-9238.53solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A18.714e-9239.23solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a33.394e-15756.05solute carrier family 18 (vesicular acetylcholine ... [more]
ddx428.557e-7637.60DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
gtf2e1.25.879e-7536.08general transcription factor IIE, polypeptide 1, a... [more]
ddx421.327e-7333.78DEAD-box helicase 42 [Source:Xenbase;Acc:XB-GENE-9... [more]
kansl31.661e-7336.44KAT8 regulatory NSL complex subunit 3 [Source:Xenb... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc18a36.557e-14952.17solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a24.552e-8442.25solute carrier family 18 (vesicular monoamine), me... [more]
Slc18a15.564e-7642.28solute carrier family 18 (vesicular monoamine), me... [more]
Slc18b17.291e-922.87solute carrier family 18, subfamily B, member 1 [S... [more]
Slc18b12.935e-722.63solute carrier family 18, subfamily B, member 1 [S... [more]
back to top
BLAST of slc18a-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O17444|VACHT_DROME1.321e-17253.60Vesicular acetylcholine transporter OS=Drosophila ... [more]
sp|Q08C75|VACHA_DANRE9.734e-16657.04Probable vesicular acetylcholine transporter-A OS=... [more]
sp|P34711|UNC17_CAEEL1.572e-16449.71Vesicular acetylcholine transporter unc-17 OS=Caen... [more]
sp|P81721|VACHT_TETCF9.959e-16455.71Vesicular acetylcholine transporter OS=Tetronarce ... [more]
sp|Q91514|VACHT_TORTO1.081e-16353.15Vesicular acetylcholine transporter OS=Torpedo tor... [more]
back to top
BLAST of slc18a-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ310.000e+0100.00Slc18a-6 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
H2KNW10.000e+062.40MFS transporter DHA1 family solute carrier family ... [more]
A0A074ZG820.000e+062.40Transporter, major facilitator family protein OS=O... [more]
A0A4S2MFN40.000e+057.76MFS domain-containing protein OS=Opisthorchis feli... [more]
A0A5J4NLF20.000e+056.10MFS transporter, DHA1 family, solute carrier famil... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a3a1.259e-15955.53solute carrier family 18 member A3 [Source:NCBI ge... [more]
slc18a3b3.546e-15050.34solute carrier family 18 member 3b [Source:NCBI ge... [more]
SLC18A14.106e-9142.74solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a22.048e-9035.63synaptic vesicular amine transporter [Source:NCBI ... [more]
SLC18A12.003e-8541.11solute carrier family 18 member A1 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc18a3a6.474e-15849.39solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18a25.826e-8740.64solute carrier family 18 member 2 [Source:ZFIN;Acc... [more]
slc18b11.304e-1025.81solute carrier family 18 member B1 [Source:ZFIN;Ac... [more]
ENSPMAT00000008246.16.830e-627.70pep scaffold:Pmarinus_7.0:GL480278:6713:20715:1 ge... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc18a-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO357981.472e-925.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc18a-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc18a3a3.819e-16551.44solute carrier family 18 member 3a [Source:NCBI ge... [more]
slc18a3b5.719e-16552.87probable vesicular acetylcholine transporter-B [So... [more]
SLC18A17.840e-8842.18solute carrier family 18 member A1 [Source:NCBI ge... [more]
SLC18A13.907e-8438.67solute carrier family 18 member A1 [Source:NCBI ge... [more]
slc18a22.678e-8035.73solute carrier family 18 member A2 [Source:NCBI ge... [more]
back to top
BLAST of slc18a-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051356.10.000e+099.26SMESG000051356.1[more]
SMESG000064025.19.478e-8934.65SMESG000064025.1[more]
SMESG000009088.12.273e-8535.18SMESG000009088.1[more]
SMESG000070401.12.065e-2624.06SMESG000070401.1[more]
SMESG000069017.17.127e-2222.06SMESG000069017.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30006145
GenBankAKN21541.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006145 ID=SMED30006145|Name=slc18a-6|organism=Schmidtea mediterranea sexual|type=transcript|length=2107bp
GAAAAAAATCGCAGACAATCAGTTTTTTTTTCTATTTACTATTTTAGCCA
TTTTTATTTTCAAGTTCTCTCAAAAAAAAATTAAAGGATTTACAGAAAGT
AAAAGAGGAAATAATTAGTTTCAAATAAACGTACAAGTTTTTTTTCGAGC
CGTGTCGAGGTAGTTCTTTTTGAAATTTCACAAGTATAGAGTCCATGGAA
ACGATTGAAACGCCAGCATGAAAGTTCCATTGACTAACTTCGATACAGAC
AACATCAAACTCTATGTAGAAAGAAAGATCAACCGGCCGGAATCCCAATG
TACCATGGTGTTGATTGTTGTGTCCATGGCATTATTGTTAGACAATATGC
TTTATATGGTCATTGTACCTATTGTTCCTCATTATATGGATTACATGAAG
AACAAGGGTCAGTCAAATAATGAGTCTATGAGTATGATGCATACTGAAGA
AGGAAACACCCAAATGGGTTTGTTATTTGCTTGCAAAGCTATTGTGCAGT
TACTAATAAACCCTCTCAGTGGTACAGTGATAGATCGAATCGGATATGAC
ATCCCTATGATGATAGGTTTGATTATAATTTTTGTTTCGACTTCTGCATT
TGCATTCGGTCAAACTCTTGAAGTTATGTTTCTTGCTCGAGGATTGCAAG
GTGTTGGTTCAGCATTTGCTGACACTTCCGGACTGGCAATGATAGCTGAC
AGATTTACAGAGGAATCCAGTAGAACGACAGCATTAGGGATAGCATTGGC
ATTTATTTCATTTGGATCACTAGTAGCTCCACCTTTCGGAGCGGTTTTGT
ATCAATATTGTGGCAAAGAATTTCCATTTTTCTGTTTGGCATTTATCGCT
TTGTTAGATGGATTTTTATTAATGATGATAATGAAACCGGTGAGACTCGA
ACGACGTGAAATGAAAGCCGAAGGAAATTTACCAAAAGGGACACCAATTC
AAAAGCTCTTTATGGATCCTTACATTGCTATTTGCGCCGGTACATTGGCG
ATTGCAAATGTGTCTTTGGCGTTTTTAGAGCCGACAATTACGTCATGGAT
GCTGTCGTGGAGACCGGTTCCGTCCGAATCGGCAATCGGTTTGATTTGGT
TGCCGGCGTTTTTCCCTCATGTTGCCGGAGTTTTTGTCACAGTTAAATTA
GCTGCCAAATATCCTCAATATCAATGGTTAATGGCTGGGATTGGGTTGGC
TTTAGAAGGGATCAGTTGTATTTTTATACCGTTTTGCAGTAATTTCGGTT
ACTTAATGATTCCAATTTCGCTATTGTGCTTTGGGATAGCGCTTGTTGAC
ACTGCAATTCTGCCAACATTGGGATATCTAGTTGACACTCGACATGTGTC
CGTTTACGGTTCCGTTTACGCTATTGCAGACATTTCATACTCATTAGCCT
ATGCTATAGGACCAATAGTAGCCGGTTCAATTGTTTCAACAATTGGATTT
ACCAGCCTCAATATAATCGTATTCGTCGTGTCAATTGCTTACTGTCCAGT
TCTATATTTAATGAGAAACATCTACCAATTTGGTATTACTAAACTCGCCA
CAGATCAAGATCCAGAAATCATTCGACCAAGCAGAAAAAAGAGCTACCTA
ATGAATGGAACGAGTCTCGAAGCGAAAAATCTGGAGAATATTCACTATCA
GAATCATATTGAACCCAATTCTCACGATTTCCCAGTCGAGCAGGCATCGC
TAATAGCTAAAAGTCACGAACAATCCTACAATTCCACAGCAACAAATTCT
CAGATTTACTCACAGAACAAGTCGTCCTCGAATTTCAGCTCGGAAGAAAT
TAGGAAAAATCAGTACGGATACTGACTGGTTTCAATGCCCCCTCTTCAGT
TATTATAGATGAATTTTTATTTTCATTTTTTTTTGAATTTTTAATTTTAC
GATTTTTTTATTAATTGAAAAAAAAGATAATTTTTCTGCTGTGTAAATAA
GAGGTGTATAAAATAGAGAGTTTTGAATCCTTCGTTCATTCATCGGTTGT
GATCTTATAAAGTTGATAGATTTGTTTTTTTTTGTTTAGATTTAGAGTTG
CATCTTGTGTATATTTGTGTTACGTGCTATGACGCTAATGATGATGATGG
AGATCGG
back to top

protein sequence of SMED30006145-orf-1

>SMED30006145-orf-1 ID=SMED30006145-orf-1|Name=SMED30006145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MKVPLTNFDTDNIKLYVERKINRPESQCTMVLIVVSMALLLDNMLYMVIV
PIVPHYMDYMKNKGQSNNESMSMMHTEEGNTQMGLLFACKAIVQLLINPL
SGTVIDRIGYDIPMMIGLIIIFVSTSAFAFGQTLEVMFLARGLQGVGSAF
ADTSGLAMIADRFTEESSRTTALGIALAFISFGSLVAPPFGAVLYQYCGK
EFPFFCLAFIALLDGFLLMMIMKPVRLERREMKAEGNLPKGTPIQKLFMD
PYIAICAGTLAIANVSLAFLEPTITSWMLSWRPVPSESAIGLIWLPAFFP
HVAGVFVTVKLAAKYPQYQWLMAGIGLALEGISCIFIPFCSNFGYLMIPI
SLLCFGIALVDTAILPTLGYLVDTRHVSVYGSVYAIADISYSLAYAIGPI
VAGSIVSTIGFTSLNIIVFVVSIAYCPVLYLMRNIYQFGITKLATDQDPE
IIRPSRKKSYLMNGTSLEAKNLENIHYQNHIEPNSHDFPVEQASLIAKSH
EQSYNSTATNSQIYSQNKSSSNFSSEEIRKNQYGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 37..385
e-value: 2.0E-31
score: 109.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 25..435
e-value: 1.8E-45
score: 157.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 504..535
NoneNo IPR availablePANTHERPTHR23506FAMILY NOT NAMEDcoord: 3..460
NoneNo IPR availablePANTHERPTHR23506:SF13VESICULAR ACETYLCHOLINE TRANSPORTERcoord: 3..460
NoneNo IPR availableCDDcd17383MFS_SLC18A3_VAChTcoord: 32..433
e-value: 0.0
score: 646.292
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 83..105
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 31..53
NoneNo IPR availableTMHMMTMhelixcoord: 409..431
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 31..436
score: 17.545
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 30..434