C2H2-type domain-containing protein

Overview
NameC2H2-type domain-containing protein
Smed IDSMED30006125
Length (bp)2385
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of C2H2-type domain-containing protein (SMED30006125) t-SNE clustered cells

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30006125) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of C2H2-type domain-containing protein (SMED30006125) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for C2H2-type domain-containing protein (SMED30006125) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006125

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006125SMESG000020158.1 SmedASXL_015122SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006125SMESG000020158.1 SmedASXL_015122SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30006125SMESG000020158.1 Contig29330newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30006125SMESG000020158.1 Contig29330uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30006125SMESG000020158.1 dd_Smed_v4_14413_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZNF142 (zinc finger protein 142 [Source:HGNC Symbol;Acc:HGNC:12927])

HSP 1 Score: 51.6026 bits (122), Expect = 7.251e-6
Identity = 45/200 (22.50%), Postives = 80/200 (40.00%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQI--EKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +    +F+      HL            R  S+ +P +            C VC    RW + L  H +TH++   F C+ C+Y++K K+ V KH++R
Sbjct: 1473 IHTGEKPYHCHLCPYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHQETRHREARAFMCEQCGKAFKTRFL---LRTHL------------RKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCNYKAKQKFQVVKHVRR 1642          
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Match: ZNF142 (zinc finger protein 142 [Source:HGNC Symbol;Acc:HGNC:12927])

HSP 1 Score: 51.6026 bits (122), Expect = 7.251e-6
Identity = 45/200 (22.50%), Postives = 80/200 (40.00%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQI--EKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +    +F+      HL            R  S+ +P +            C VC    RW + L  H +TH++   F C+ C+Y++K K+ V KH++R
Sbjct: 1473 IHTGEKPYHCHLCPYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHQETRHREARAFMCEQCGKAFKTRFL---LRTHL------------RKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCNYKAKQKFQVVKHVRR 1642          
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Match: ztf-2 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:Q19418])

HSP 1 Score: 50.447 bits (119), Expect = 3.310e-6
Identity = 19/51 (37.25%), Postives = 28/51 (54.90%), Query Frame = 1
Query: 1618 TLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            T  C  C    +W SE+  H   H+  R F C++CS  SKWK D+ +H+ +
Sbjct:   86 TRTCSTCGYQGKWVSEMIRHKRVHTSERPFKCRYCSRTSKWKADLIRHVAK 136          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG9932 (gene:FBgn0262160 transcript:FBtr0089956)

HSP 1 Score: 57.3806 bits (137), Expect = 5.965e-8
Identity = 26/75 (34.67%), Postives = 38/75 (50.67%), Query Frame = 1
Query: 1543 SANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            +A  Y  +T K  P+   + S  +K  KC  C   A   S    H++ H   + F C  CSYRS W+WD+ KH++
Sbjct:  788 TAPGYGEVTKKMTPEEEAANSSLKKVYKCPHCSFWASTASRFHVHIVGHLNKKPFECSLCSYRSNWRWDITKHIR 862          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG9932 (gene:FBgn0262160 transcript:FBtr0310277)

HSP 1 Score: 57.3806 bits (137), Expect = 6.120e-8
Identity = 26/75 (34.67%), Postives = 38/75 (50.67%), Query Frame = 1
Query: 1543 SANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            +A  Y  +T K  P+   + S  +K  KC  C   A   S    H++ H   + F C  CSYRS W+WD+ KH++
Sbjct:  788 TAPGYGEVTKKMTPEEEAANSSLKKVYKCPHCSFWASTASRFHVHIVGHLNKKPFECSLCSYRSNWRWDITKHIR 862          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: kmg (gene:FBgn0032473 transcript:FBtr0080433)

HSP 1 Score: 55.0694 bits (131), Expect = 2.687e-7
Identity = 21/62 (33.87%), Postives = 33/62 (53.23%), Query Frame = 1
Query: 1582 PQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            P+ P+  +  +K  KC  C   A   S    H++ H   + F C  C+YRS W+WD+ KH++
Sbjct:  525 PEEPEDLAPLKKVFKCPHCSFWAATASRFHVHIVGHLNRKPFECSLCAYRSNWRWDITKHIR 586          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG9932 (gene:FBgn0262160 transcript:FBtr0336617)

HSP 1 Score: 50.8322 bits (120), Expect = 5.556e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 1
Query: 1543 SANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            +A  Y  +T ++E     + S  +K  KC  C   A   S    H++ H   + F C  CSYRS W+WD+ KH++
Sbjct:  788 TAPGYGEMTPEEEA----ANSSLKKVYKCPHCSFWASTASRFHVHIVGHLNKKPFECSLCSYRSNWRWDITKHIR 858          
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Match: CG9932 (gene:FBgn0262160 transcript:FBtr0336616)

HSP 1 Score: 50.8322 bits (120), Expect = 5.745e-6
Identity = 25/75 (33.33%), Postives = 38/75 (50.67%), Query Frame = 1
Query: 1543 SANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            +A  Y  +T ++E     + S  +K  KC  C   A   S    H++ H   + F C  CSYRS W+WD+ KH++
Sbjct:  788 TAPGYGEMTPEEEA----ANSSLKKVYKCPHCSFWASTASRFHVHIVGHLNKKPFECSLCSYRSNWRWDITKHIR 858          
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Match: ZNF142 (zinc finger protein 142 [Source:NCBI gene;Acc:100485110])

HSP 1 Score: 55.8398 bits (133), Expect = 3.401e-7
Identity = 47/191 (24.61%), Postives = 80/191 (41.88%), Query Frame = 1
Query: 1204 CNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISV--CSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ +    KP     C + +N+ + L       +            ++  FI        A  T      + R  S+++P +            C +C  + RW + L  H +TH+    F C++C+YR+K K+ V KHL+R
Sbjct: 1690 CHLCSYACADPSRLKYHM-RIHKDEKKYLCPECGYKCKWVNQLKYHMTKHTGL----KPYQCEECDYCTNRADALRVHRETRHR-----------EVRSFICEQCGK--AFKTRFLLKTHMRKHSEEKPYV------------CNLCQRSFRWPAGLRHHYLTHTNQHPFFCQYCTYRAKQKFQVVKHLQR 1850          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zfp142 (zinc finger protein 142 [Source:MGI Symbol;Acc:MGI:1924514])

HSP 1 Score: 54.299 bits (129), Expect = 7.105e-7
Identity = 45/198 (22.73%), Postives = 78/198 (39.39%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +             A  T      + R  S+ +P +            C VC    RW + L  H +TH++   F C+ CSY++K K+ V KH++R
Sbjct: 1526 IHTGEKPYHCHLCAYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHRETRHREARAFMCEQCGK-------------AFKTRFLLRTHLRKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRR 1695          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zfp142 (zinc finger protein 142 [Source:MGI Symbol;Acc:MGI:1924514])

HSP 1 Score: 54.299 bits (129), Expect = 7.542e-7
Identity = 45/198 (22.73%), Postives = 78/198 (39.39%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +             A  T      + R  S+ +P +            C VC    RW + L  H +TH++   F C+ CSY++K K+ V KH++R
Sbjct: 1428 IHTGEKPYHCHLCAYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHRETRHREARAFMCEQCGK-------------AFKTRFLLRTHLRKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRR 1597          
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Match: Zfp142 (zinc finger protein 142 [Source:MGI Symbol;Acc:MGI:1924514])

HSP 1 Score: 54.299 bits (129), Expect = 8.483e-7
Identity = 45/198 (22.73%), Postives = 78/198 (39.39%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +             A  T      + R  S+ +P +            C VC    RW + L  H +TH++   F C+ CSY++K K+ V KH++R
Sbjct: 1629 IHTGEKPYHCHLCAYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHRETRHREARAFMCEQCGK-------------AFKTRFLLRTHLRKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRR 1798          
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Match: sp|G5E869|ZN142_MOUSE (Zinc finger protein 142 OS=Mus musculus OX=10090 GN=Znf142 PE=2 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.884e-6
Identity = 45/198 (22.73%), Postives = 78/198 (39.39%), Query Frame = 1
Query: 1177 IESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            I +     +C+LC         +  H+  +H+ E  ++C  CGY C    QL +H   H+ ++    P   C + +N+ + L       +            +             A  T      + R  S+ +P +            C VC    RW + L  H +TH++   F C+ CSY++K K+ V KH++R
Sbjct: 1629 IHTGEKPYHCHLCAYACADPSRLKYHM-RIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCP--ECEYCTNRADALRVHRETRHREARAFMCEQCGK-------------AFKTRFLLRTHLRKHSEAKPYV------------CNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRR 1798          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A183SIE4 (C2H2-type domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3992 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 9.428e-22
Identity = 45/99 (45.45%), Postives = 63/99 (63.64%), Query Frame = 1
Query: 1612 EKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIG 1908
            +  + C VC    RW SEL  HM+ HSEHR FGC +CSYR+KWKWDV KH++RC   P +     +QN YL+ ++ ++ PP GDIL+ +  +Y    +G
Sbjct:  594 DTVIPCPVCTFVGRWFSELRAHMVNHSEHRMFGCCYCSYRAKWKWDVAKHMRRC---PLSRHVAHLQNEYLLRMVCYFPPPQGDILFAYFPQYGFPGVG 689          

HSP 2 Score: 69.707 bits (169), Expect = 2.140e-8
Identity = 30/44 (68.18%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  391 RRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKH 522
            RRPVESWKY   K E+    Y C  CS+VY+HKKSLNKHWKDKH
Sbjct:  159 RRPVESWKYTENKNEDGSLVYMCRFCSAVYKHKKSLNKHWKDKH 202          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A0V0J9Y6 (C2H2-type domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR151220 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 9.813e-22
Identity = 45/99 (45.45%), Postives = 63/99 (63.64%), Query Frame = 1
Query: 1612 EKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIG 1908
            +  + C VC    RW SEL  HM+ HSEHR FGC +CSYR+KWKWDV KH++RC   P +     +QN YL+ ++ ++ PP GDIL+ +  +Y    +G
Sbjct:  581 DTVIPCPVCTFVGRWFSELRAHMVNHSEHRMFGCCYCSYRAKWKWDVAKHMRRC---PLSRHVAHLQNEYLLRMVCYFPPPQGDILFAYFPQYGFPGVG 676          

HSP 2 Score: 69.707 bits (169), Expect = 2.219e-8
Identity = 30/44 (68.18%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  391 RRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKH 522
            RRPVESWKY   K E+    Y C  CS+VY+HKKSLNKHWKDKH
Sbjct:  146 RRPVESWKYTENKNEDGSLVYMCRFCSAVYKHKKSLNKHWKDKH 189          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A4S2L5S2 (C2H2-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010312 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.048e-20
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1612 EKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIG 1908
            E  + C VC   ARW SEL  HM+ HSEHR FGC +C YR+KWKWDV KH++RC   P       + N  L+ +++++ PP G+ILY +  +Y I  +G
Sbjct:  624 ECVISCPVCKFDARWFSELRAHMVNHSEHRMFGCCYCPYRAKWKWDVAKHMRRC---PLGRHVAHLSNEALLRIVRYHPPPVGNILYNYFPQYGIPGVG 719          

HSP 2 Score: 68.1662 bits (165), Expect = 7.795e-8
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  391 RRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHS 525
            RRPVESWK+L  + ++    Y C +C+S Y+HKKSLNKHWKDKHS
Sbjct:   92 RRPVESWKFLEARKQDGSILYLCRICNSSYKHKKSLNKHWKDKHS 136          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: G7YB30 (C2H2-type domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_104142 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.070e-20
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1612 EKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIG 1908
            E  + C VC   ARW SEL  HM+ HSEHR FGC +C YR+KWKWDV KH++RC   P       + N  L+ +++++ PP G+ILY +  +Y I  +G
Sbjct:  626 ECVISCPVCKFDARWFSELRAHMVNHSEHRMFGCCYCPYRAKWKWDVAKHMRRC---PLGRHVAHLSNEALLRIVRYHPPPVGNILYNYFPQYGIPGVG 721          

HSP 2 Score: 68.1662 bits (165), Expect = 7.475e-8
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  391 RRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHS 525
            RRPVESWK+L  + ++    Y C +C+S Y+HKKSLNKHWKDKHS
Sbjct:   92 RRPVESWKFLEARKQDGSILYLCRICNSSYKHKKSLNKHWKDKHS 136          
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Match: A0A075AH39 (C2H2-type domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13382 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.089e-20
Identity = 45/99 (45.45%), Postives = 62/99 (62.63%), Query Frame = 1
Query: 1612 EKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIG 1908
            E  + C VC   ARW SEL  HM+ HSEHR FGC +C YR+KWKWDV KH++RC   P       + N  L+ +++++ PP G+ILY +  +Y I  +G
Sbjct:  681 ECVISCPVCKFDARWFSELRAHMVNHSEHRMFGCCYCPYRAKWKWDVAKHMRRC---PLGRHVAHLSNEALLRIVRYHPPPVGNILYNYFPQYGIPGVG 776          

HSP 2 Score: 68.1662 bits (165), Expect = 7.131e-8
Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1
Query:  391 RRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHS 525
            RRPVESWK+L  + ++    Y C +C+S Y+HKKSLNKHWKDKHS
Sbjct:   92 RRPVESWKFLEARKQDGSILYLCRICNSSYKHKKSLNKHWKDKHS 136          
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Match: znf142 (zinc finger protein 142 [Source:NCBI gene;Acc:103025434])

HSP 1 Score: 50.447 bits (119), Expect = 9.344e-6
Identity = 41/169 (24.26%), Postives = 66/169 (39.05%), Query Frame = 1
Query: 1264 VHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            +H+ E  ++C  CGY C    QL +H   HS  +  S     C + +N+ + L       +             +  FI        A  T      +++  S + P +            C +C    RW + L  H ++H+    F C +C YR+K K+ V KHL R
Sbjct: 1366 IHQDERKYLCPECGYKCKWVNQLKYHMTKHSGTK--SYACEECEYRTNRADALRIHRETRHR-----------DVRSFICEKCGK--AFKTRFLLKTHQKRHSDERPYV------------CSICQKGFRWPAGLRHHYLSHTNQLPFRCLYCPYRAKQKFQVVKHLSR 1507          
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Match: znf142 (zinc finger protein 142 [Source:NCBI gene;Acc:101156291])

HSP 1 Score: 53.5286 bits (127), Expect = 8.778e-7
Identity = 42/174 (24.14%), Postives = 70/174 (40.23%), Query Frame = 1
Query: 1264 VHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISV--CSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQ---IEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKR 1770
            VH+ E  ++C  C Y C    QL +H   H+      KP +   C + +N+ + L                  DTQ      ++         +S  +  ++ K I  +                 C VC    RW + L  H ++H++ + F C+ CSYR+K ++ V KHL+R
Sbjct: 1286 VHQKEKKYLCPDCDYKCKWATQLKYHMTKHTG----EKPYACDQCDYRTNRADALRAHR--------------DTQHCDARSYVCEKCGKAFKTSFILKTHQRKHIAGR--------------PYTCGVCQKAFRWPAGLRHHYLSHTKQQPFRCRHCSYRAKQRFQVVKHLQR 1427          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020158.1 (SMESG000020158.1)

HSP 1 Score: 1341.64 bits (3471), Expect = 0.000e+0
Identity = 691/692 (99.86%), Postives = 692/692 (100.00%), Query Frame = 1
Query:  184 MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEIDSKYSKVNRKRMSLQLDSENKENVQSKRMSLMQPLSVNNLPLVLRSXXXXXXXXXXXXXXXXXXXXXXSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLPHESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS 2259
            MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEIDSKYSKVNRKRMSLQLDSENKENVQSKRMSLMQPLSVNNLPLVLRSNNNMVKFVNNVVVNSNFHNPVVSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLIPCNIPANSNINPNKNNDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLP+ESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS
Sbjct:    1 MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEIDSKYSKVNRKRMSLQLDSENKENVQSKRMSLMQPLSVNNLPLVLRSNNNMVKFVNNVVVNSNFHNPVVSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLIPCNIPANSNINPNKNNDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLPNESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS 692          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000020158.1 (SMESG000020158.1)

HSP 1 Score: 1299.65 bits (3362), Expect = 0.000e+0
Identity = 675/692 (97.54%), Postives = 677/692 (97.83%), Query Frame = 1
Query:  184 MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEIDSKYSKVNRKRMSLQLDSENKENVQSKRMSLMQPLSVNNLPLVLRSXXXXXXXXXXXXXXXXXXXXXXSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLXXXXXXXXXXXXXXXXXDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLPHESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS 2259
            MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEID               +SENKENVQSKRMSLMQPLSVNNLPLVLRSNNNMVKFVNNVVVNSNFHNPVVSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLIPCNIPANSNINPNKNNDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLP+ESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS
Sbjct:    1 MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKDSDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQHKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTDTGSFQLKNEPSVSLFTTNEEID---------------NSENKENVQSKRMSLMQPLSVNNLPLVLRSNNNMVKFVNNVVVNSNFHNPVVSESTENILDLRKPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQILLGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPTRYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPISVCSWPSNQINPLIPCNIPANSNINPNKNNDDTQIEKFIPPDFENHLASSTPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITLLQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSASVEIDGKLDRKLSEIDLPNESAYEAISDVSNDLDVDVGTDLVSTTKENSPNSETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS 677          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073676.1 (SMESG000073676.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.402e-6
Identity = 22/58 (37.93%), Postives = 32/58 (55.17%), Query Frame = 1
Query: 1594 DSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            D    +  + KC  C   A+++SEL  H   H   + FGC FC YRS WK D+ +H++
Sbjct:  165 DGAKTRAGSYKCSYCMYVAKYQSELKRHRRLHMGVKPFGCVFCKYRSAWKGDLKRHIE 222          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000073676.1 (SMESG000073676.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.417e-6
Identity = 22/58 (37.93%), Postives = 32/58 (55.17%), Query Frame = 1
Query: 1594 DSFSIKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLK 1767
            D    +  + KC  C   A+++SEL  H   H   + FGC FC YRS WK D+ +H++
Sbjct:  165 DGAKTRAGSYKCSYCMYVAKYQSELKRHRRLHMGVKPFGCVFCKYRSAWKGDLKRHIE 222          
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Match: SMESG000004948.1 (SMESG000004948.1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.552e-6
Identity = 23/71 (32.39%), Postives = 36/71 (50.70%), Query Frame = 1
Query: 1606 IKEKTLKCLVCDTTARWRSELFTHMITHSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNS 1818
            I+    +C  C+  A+W +EL  H++ HS+ R   C  C    KWKWD+ +H  +  L   N  K +  +S
Sbjct:  274 IETTGYQCPHCEYFAKWPTELQKHIMVHSKERPHQCIICGLTYKWKWDLGRHFDKSHLPAVNPYKKNPNSS 344          
The following BLAST results are available for this feature:
BLAST of C2H2-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZNF1427.251e-622.50zinc finger protein 142 [Source:HGNC Symbol;Acc:HG... [more]
ZNF1427.251e-622.50zinc finger protein 142 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ztf-23.310e-637.25Zinc finger putative Transcription Factor family ... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG99325.965e-834.67gene:FBgn0262160 transcript:FBtr0089956[more]
CG99326.120e-834.67gene:FBgn0262160 transcript:FBtr0310277[more]
kmg2.687e-733.87gene:FBgn0032473 transcript:FBtr0080433[more]
CG99325.556e-633.33gene:FBgn0262160 transcript:FBtr0336617[more]
CG99325.745e-633.33gene:FBgn0262160 transcript:FBtr0336616[more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ZNF1423.401e-724.61zinc finger protein 142 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zfp1427.105e-722.73zinc finger protein 142 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1427.542e-722.73zinc finger protein 142 [Source:MGI Symbol;Acc:MGI... [more]
Zfp1428.483e-722.73zinc finger protein 142 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|G5E869|ZN142_MOUSE5.884e-622.73Zinc finger protein 142 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183SIE49.428e-2245.45C2H2-type domain-containing protein OS=Schistoceph... [more]
A0A0V0J9Y69.813e-2245.45C2H2-type domain-containing protein (Fragment) OS=... [more]
A0A4S2L5S22.048e-2045.45C2H2-type domain-containing protein OS=Opisthorchi... [more]
G7YB302.070e-2045.45C2H2-type domain-containing protein OS=Clonorchis ... [more]
A0A075AH392.089e-2045.45C2H2-type domain-containing protein (Fragment) OS=... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf1429.344e-624.26zinc finger protein 142 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of C2H2-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
znf1428.778e-724.14zinc finger protein 142 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of C2H2-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020158.10.000e+099.86SMESG000020158.1[more]
SMESG000020158.10.000e+097.54SMESG000020158.1[more]
SMESG000073676.12.402e-637.93SMESG000073676.1[more]
SMESG000073676.12.417e-637.93SMESG000073676.1[more]
SMESG000004948.12.552e-632.39SMESG000004948.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006125 ID=SMED30006125|Name=C2H2-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2385bp
GTCGTGTGTGGGCTCTCGTAAAATTCGATGATAATGTAGCATAACTCGGT
GTAGCTAGGATGCAATCTCTAACAATGCTAACACACTCATATGATTTCTA
TTGGCTAAAATCTTTTGTGGAAAACCCGGTTAAATTCTGGTGCATTAGTT
TATCTCTTAATAAAGATTACCTAAACATTGTCAATGGAGATTTATCGTAT
TAGAGAAGAAATTGATTCCTTAGATTTACAGAATGTGGAAAATTTAACGA
ATAATATGAAAACGGCTTGTCCAACACTGGATAATACTGAACATAATAGT
TATATTGAATCCACTTCAGACTATTTAAAAGATAGTGATGATAAAGAAAA
TCATGATATTTCCAATGAAAATAGTTTTGATAGAATATCGAGACGACCTG
TTGAAAGCTGGAAATATTTACCGCTAAAAGCCGAAAATAACAGAACAAGT
TACAAATGCTCACTTTGTTCTTCGGTATATCAACACAAGAAATCTTTAAA
TAAACATTGGAAGGATAAACATTCTGCTAATAATTCAGTTAACTATCCTG
ATCGAATTGCTACTGGAATGAATGAAAATCCTCAAGCGATGCATGCGGGT
AATGATGTGGTAATGTGTCAGAATAAAACAGATACGGGTAGTTTCCAATT
AAAGAATGAACCAAGTGTTTCCCTATTTACAACTAATGAAGAAATAGATA
GTAAATATTCTAAAGTTAATAGAAAAAGAATGAGTTTACAATTAGATAGT
GAAAATAAAGAAAATGTTCAATCAAAAAGAATGTCTCTTATGCAGCCACT
ATCAGTGAATAATTTACCTTTAGTACTGAGATCGAATAACAACATGGTAA
AATTTGTCAATAATGTAGTTGTCAATAGCAACTTTCATAATCCTGTCGTA
TCTGAATCGACGGAAAATATTCTTGACTTACGTAAACCAAACAACGGAGC
TCTCGATTTACGAACCAACTCAAAACCAGTAGCTTTAAATCGAATGATAT
TTCGCTGTTTCCAATGTACATTTCGATCGGGAACTATGTTTGAGTTGAAT
GAACATTTTAAATTGTCGCATATGCAAATTCTACTCGGTGTGAAATCATT
TCAGGTTCCCGTCAACCTTTATCAGAAATTATTAACGAACCAATTCAATG
CTATTATTAGAACAGATTGCGAACCAATAGAAAGTTTTAATTCGCTAATT
AACTGCAATTTATGTGGCACAATTTTCCCCACTAGATATGACATGATACA
GCATATTGGCGCTGTACATGAAATGGAAATGGTTTGGATTTGTCTCGTTT
GTGGATATGGTTGTTGTCATCCTATTCAATTGAGTCATCATTTTCAATCT
CATTCAAACATTCAAATGTTATCGAAACCGATATCAGTTTGTTCTTGGCC
TAGCAATCAAATCAATCCCCTTATTCCCTGCAATATTCCTGCTAACAGTA
ATATCAATCCTAATAAAAATAATGATGATACACAAATTGAAAAGTTCATT
CCACCAGATTTTGAAAATCATTTAGCCTCATCAACCCCAATTTCTGCAAA
TAAGTACAAACGAATAACATCGAAAAAAGAGCCGCAAATTCCCGATTCAT
TCAGCATTAAAGAAAAAACTCTCAAGTGTTTGGTGTGCGACACAACAGCT
CGTTGGCGCAGTGAGCTTTTTACTCATATGATCACTCACAGTGAACACCG
ATCTTTTGGGTGCAAGTTCTGCAGTTATCGTAGCAAATGGAAATGGGATG
TCCCGAAACACTTGAAACGATGTCGATTGGCGCCGGCAAATGTTAGAAAA
CCCGATGTTCAGAATTCATATTTGATTACTCTGTTGCAGCACTATTCCCC
TCCACCGGGAGACATTTTATACCAATTTATGAAAGAATACAACATCAAAG
ATATCGGGTCTTTGAATAAGTCAATTTGTGTTAAAAATGAAAATGACGAA
AGTTTCCACAATCCCGAGCCGTCGTCTGCGAGTGTGGAAATTGATGGAAA
ACTTGATAGGAAATTATCAGAAATCGATTTGCCACATGAATCTGCATACG
AAGCCATTTCTGATGTTTCCAACGACCTCGATGTTGATGTCGGTACCGAT
TTGGTATCGACTACGAAAGAAAATTCCCCAAATTCTGAAACCGCATTAAA
ATATACTTTCAAACGTTGTCCTTGGTGTCAAGCATTTTTAACAAACAAAC
CATCAGAAATGAGCAATCATTTAGCACAATATCACGGCGACGTAGAGTCT
ACCCATTCGTGATTATTATTATGATTATAATTATCAAGATATTTAACAAC
TGCAAACGAGTTTATACATGTAATATTACAGATCATTTTAGTTTTCTACA
ACTGGTGCCAAGCTTTGTTTATTGCATTTTTAACG
back to top

protein sequence of SMED30006125-orf-1

>SMED30006125-orf-1 ID=SMED30006125-orf-1|Name=SMED30006125-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=693bp
MEIYRIREEIDSLDLQNVENLTNNMKTACPTLDNTEHNSYIESTSDYLKD
SDDKENHDISNENSFDRISRRPVESWKYLPLKAENNRTSYKCSLCSSVYQ
HKKSLNKHWKDKHSANNSVNYPDRIATGMNENPQAMHAGNDVVMCQNKTD
TGSFQLKNEPSVSLFTTNEEIDSKYSKVNRKRMSLQLDSENKENVQSKRM
SLMQPLSVNNLPLVLRSNNNMVKFVNNVVVNSNFHNPVVSESTENILDLR
KPNNGALDLRTNSKPVALNRMIFRCFQCTFRSGTMFELNEHFKLSHMQIL
LGVKSFQVPVNLYQKLLTNQFNAIIRTDCEPIESFNSLINCNLCGTIFPT
RYDMIQHIGAVHEMEMVWICLVCGYGCCHPIQLSHHFQSHSNIQMLSKPI
SVCSWPSNQINPLIPCNIPANSNINPNKNNDDTQIEKFIPPDFENHLASS
TPISANKYKRITSKKEPQIPDSFSIKEKTLKCLVCDTTARWRSELFTHMI
THSEHRSFGCKFCSYRSKWKWDVPKHLKRCRLAPANVRKPDVQNSYLITL
LQHYSPPPGDILYQFMKEYNIKDIGSLNKSICVKNENDESFHNPEPSSAS
VEIDGKLDRKLSEIDLPHESAYEAISDVSNDLDVDVGTDLVSTTKENSPN
SETALKYTFKRCPWCQAFLTNKPSEMSNHLAQYHGDVESTHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 368..390
e-value: 3.2
score: 16.7
coord: 273..296
e-value: 0.45
score: 19.6
coord: 480..502
e-value: 0.065
score: 22.4
coord: 508..528
e-value: 220.0
score: 1.4
coord: 90..113
e-value: 0.025
score: 23.7
coord: 660..684
e-value: 16.0
score: 11.5
coord: 339..362
e-value: 0.078
score: 22.1
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 92..113
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 341..362
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 370..390
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 339..367
score: 8.725
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 90..118
score: 10.284
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 475..539
e-value: 5.3E-8
score: 34.8
NoneNo IPR availablePANTHERPTHR24388FAMILY NOT NAMEDcoord: 315..552
coord: 72..390
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 86..115
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 478..528