X-box-binding protein 1

Overview
NameX-box-binding protein 1
Smed IDSMED30006119
Length (bp)894
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of X-box-binding protein 1 (SMED30006119) t-SNE clustered cells

Violin plots show distribution of expression levels for X-box-binding protein 1 (SMED30006119) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of X-box-binding protein 1 (SMED30006119) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for X-box-binding protein 1 (SMED30006119) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006119

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30006119SMESG000003891.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006119SMESG000003891.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30006119SMESG000003891.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006119SMESG000048111.1 PL030005A20F10ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30006119SMESG000048111.1 PL04014B1G09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30006119SMESG000048111.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30006119SMESG000048111.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30006119SMESG000048111.1 Contig1388GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006119SMESG000048111.1 dd_Smed_v4_415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006119SMESG000048111.1 Contig51009uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006119SMESG000048111.1 Contig51009newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30006119SMESG000048111.1 dd_Smed_v6_415_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of X-box-binding protein 1 vs. Ensembl Human
Match: XBP1 (X-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12801])

HSP 1 Score: 64.6994 bits (156), Expect = 1.608e-11
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLLLENQLLREKTHGL 126          
BLAST of X-box-binding protein 1 vs. Ensembl Human
Match: XBP1 (X-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12801])

HSP 1 Score: 65.4698 bits (158), Expect = 2.111e-11
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLLLENQLLREKTHGL 126          
BLAST of X-box-binding protein 1 vs. Ensembl Human
Match: XBP1 (X-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12801])

HSP 1 Score: 65.4698 bits (158), Expect = 2.111e-11
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLLLENQLLREKTHGL 126          
BLAST of X-box-binding protein 1 vs. Ensembl Human
Match: XBP1 (X-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:12801])

HSP 1 Score: 57.3806 bits (137), Expect = 5.413e-9
Identity = 28/41 (68.29%), Postives = 33/41 (80.49%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLE 293
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE 99          
BLAST of X-box-binding protein 1 vs. Ensembl Celegans
Match: xbp-1 (X-box Binding Protein homolog; X-box binding protein unprocessed isoform [Source:UniProtKB/TrEMBL;Acc:G5EE07])

HSP 1 Score: 63.5438 bits (153), Expect = 2.336e-11
Identity = 40/97 (41.24%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  138 VKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVI 428
            + DD+  +  PRKR++L+HLS+EEKM RRK+ NR AAQ ARDKKK R   +E       +++  L  EN  L++EN+ L+ + + L  + NE++  +
Sbjct:   40 LGDDMGPS-GPRKRERLNHLSQEEKMDRRKLKNRVAAQNARDKKKERSAKIE-------DVMRDLVEENRRLRAENERLRRQNKNLMNQQNESVMYM 128          
BLAST of X-box-binding protein 1 vs. Ensembl Celegans
Match: xbp-1 (X-box Binding Protein homolog; X-box binding protein unprocessed isoform [Source:UniProtKB/TrEMBL;Acc:G5EE07])

HSP 1 Score: 63.5438 bits (153), Expect = 3.165e-11
Identity = 40/97 (41.24%), Postives = 62/97 (63.92%), Query Frame = 3
Query:  138 VKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVI 428
            + DD+  +  PRKR++L+HLS+EEKM RRK+ NR AAQ ARDKKK R   +E       +++  L  EN  L++EN+ L+ + + L  + NE++  +
Sbjct:   40 LGDDMGPS-GPRKRERLNHLSQEEKMDRRKLKNRVAAQNARDKKKERSAKIE-------DVMRDLVEENRRLRAENERLRRQNKNLMNQQNESVMYM 128          
BLAST of X-box-binding protein 1 vs. Ensembl Celegans
Match: xbp-1 (X-box Binding Protein homolog; X-box binding protein unprocessed isoform [Source:UniProtKB/TrEMBL;Acc:G5EE07])

HSP 1 Score: 62.003 bits (149), Expect = 7.911e-11
Identity = 40/94 (42.55%), Postives = 61/94 (64.89%), Query Frame = 3
Query:  138 VKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENL 419
            + DD+  +  PRKR++L+HLS+EEKM RRK+ NR AAQ ARDKKK R   +E       +++  L  EN  L++EN+ L+ + + L  + NE++
Sbjct:   40 LGDDMGPS-GPRKRERLNHLSQEEKMDRRKLKNRVAAQNARDKKKERSAKIE-------DVMRDLVEENRRLRAENERLRRQNKNLMNQQNESV 125          
BLAST of X-box-binding protein 1 vs. Ensembl Fly
Match: Xbp1 (gene:FBgn0021872 transcript:FBtr0310044)

HSP 1 Score: 48.9062 bits (115), Expect = 2.578e-6
Identity = 35/111 (31.53%), Postives = 64/111 (57.66%), Query Frame = 3
Query:  144 DDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEI---------------CHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVIN 431
            D+++ +    K+++LDHL+ EEK+ R+K+ NR AAQ +RD+KK+R+E ++                C S Q  +  SL ++N  L SE ++L+ ++ +L+ +   N   I+
Sbjct:   61 DNMAASQPKAKKRRLDHLTWEEKVQRKKLKNRVAAQTSRDRKKARMEEMDYEIKELTDRTEILQNKCDSLQ-AINESLLAKNHKLDSELELLRQELAELKQQQQHNTRCIS 170          
BLAST of X-box-binding protein 1 vs. Ensembl Fly
Match: Xbp1 (gene:FBgn0021872 transcript:FBtr0310045)

HSP 1 Score: 47.3654 bits (111), Expect = 9.875e-6
Identity = 21/40 (52.50%), Postives = 34/40 (85.00%), Query Frame = 3
Query:  174 KRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLE 293
            K+++LDHL+ EEK+ R+K+ NR AAQ +RD+KK+R+E ++
Sbjct:   71 KKRRLDHLTWEEKVQRKKLKNRVAAQTSRDRKKARMEEMD 110          
BLAST of X-box-binding protein 1 vs. Ensembl Zebrafish
Match: xbp1 (X-box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-011210-2])

HSP 1 Score: 62.3882 bits (150), Expect = 7.725e-11
Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNEN 416
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+++  LE         +  L  EN  L  EN++L+DK   L   L+EN
Sbjct:   58 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKAKMGELE-------QQVLELELENQKLHVENRLLRDKTSDL---LSEN 129          
BLAST of X-box-binding protein 1 vs. Ensembl Xenopus
Match: dstn (destrin, actin depolymerizing factor [Source:Xenbase;Acc:XB-GENE-489289])

HSP 1 Score: 65.0846 bits (157), Expect = 1.094e-11
Identity = 41/83 (49.40%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  168 PRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNEN 416
            PRKRQ+L HL+ EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L   L EN
Sbjct:   45 PRKRQRLTHLTPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEMENEKLLLENQLLREKSHSL---LTEN 117          
BLAST of X-box-binding protein 1 vs. Ensembl Xenopus
Match: dstn (destrin, actin depolymerizing factor [Source:Xenbase;Acc:XB-GENE-489289])

HSP 1 Score: 65.4698 bits (158), Expect = 1.711e-11
Identity = 41/83 (49.40%), Postives = 51/83 (61.45%), Query Frame = 3
Query:  168 PRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNEN 416
            PRKRQ+L HL+ EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L   L EN
Sbjct:   45 PRKRQRLTHLTPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEMENEKLLLENQLLREKSHSL---LTEN 117          
BLAST of X-box-binding protein 1 vs. Ensembl Mouse
Match: Xbp1 (X-box binding protein 1 [Source:MGI Symbol;Acc:MGI:98970])

HSP 1 Score: 67.3958 bits (163), Expect = 1.612e-12
Identity = 44/118 (37.29%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  135 SVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL-----EMKLNENLTVIN----PQIERNESAV 461
            +   + S     RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L+ ENQ+L++K   L     E++    +  ++    P++E   S V
Sbjct:   40 AAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGV 150          
BLAST of X-box-binding protein 1 vs. Ensembl Mouse
Match: Xbp1 (X-box binding protein 1 [Source:MGI Symbol;Acc:MGI:98970])

HSP 1 Score: 67.0106 bits (162), Expect = 4.425e-12
Identity = 43/106 (40.57%), Postives = 60/106 (56.60%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL-----EMKLNENLTVIN----PQIERNESAV 461
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L+ ENQ+L++K   L     E++    +  ++    P++E   S V
Sbjct:   52 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGV 150          
BLAST of X-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|O35426|XBP1_MOUSE (X-box-binding protein 1 OS=Mus musculus OX=10090 GN=Xbp1 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 1.128e-11
Identity = 44/118 (37.29%), Postives = 63/118 (53.39%), Query Frame = 3
Query:  135 SVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL-----EMKLNENLTVIN----PQIERNESAV 461
            +   + S     RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L+ ENQ+L++K   L     E++    +  ++    P++E   S V
Sbjct:   40 AAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENHKLQLENQLLREKTHGLVVENQELRTRLGMDTLDPDEVPEVEAKGSGV 150          
BLAST of X-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9R1S4|XBP1_RAT (X-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Xbp1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.218e-11
Identity = 40/98 (40.82%), Postives = 53/98 (54.08%), Query Frame = 3
Query:  102 RLIDYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            R +        +   + S     RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L+ ENQ+L++K   L
Sbjct:   29 RALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLQLENQLLREKTHGL 119          
BLAST of X-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q3SZZ2|XBP1_BOVIN (X-box-binding protein 1 OS=Bos taurus OX=9913 GN=XBP1 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.874e-11
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLLLENQLLREKTHGL 126          
BLAST of X-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|P17861|XBP1_HUMAN (X-box-binding protein 1 OS=Homo sapiens OX=9606 GN=XBP1 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 7.724e-11
Identity = 38/75 (50.67%), Postives = 47/75 (62.67%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+R+  LE         +  L  EN  L  ENQ+L++K   L
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELE-------QQVVDLEEENQKLLLENQLLREKTHGL 126          
BLAST of X-box-binding protein 1 vs. TrEMBL
Match: A0A293MI90 (X-box binding protein 1 (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.646e-12
Identity = 53/141 (37.59%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  126 EDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLK-------SENQILKDKIRQLEMKLNENLTVINPQIERNESAVLSSQPWKM---FLWVFMILLIS 518
            ED SV D ++ +   RKRQ+LDHL+ EEK+LRRK+ NR AAQ ARD+KK+R++ LE+          +L  EN++LK       +EN+ LK++I        E+ ++I+  +++++  +L+   W M   FL + M L+ S
Sbjct:   30 EDVSVMDVVTTSPV-RKRQRLDHLTREEKILRRKMKNRVAAQCARDRKKARMDELEMVVMTLQAEKEALMDENSALKLRLEQSLAENERLKERIGSTSSGSIEHASLISEPLQKDQVLLLALSLWMMRSGFLHLMMSLMTS 169          
BLAST of X-box-binding protein 1 vs. TrEMBL
Match: A0A0R3VVB8 (BZIP domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1326 PE=4 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.553e-12
Identity = 52/127 (40.94%), Postives = 73/127 (57.48%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNE---NLTVI--------NPQIERNESAVLSSQPWKMFLWVFMILLIS 518
            RKR +LD+L+EEEK LRRK+LNR+AAQ ARD+KK  +  +E         I SL SEN SL+     LK K ++ E +LN     L ++        + QIE +E AVLS     + L V +++ +S
Sbjct:   56 RKRTRLDYLTEEEKALRRKLLNREAAQKARDRKKDSIRLME-------QSIRSLQSENQSLRQTIGFLKHKCQEQETRLNSMHYQLGLLTKGDKVGKSEQIEPSEPAVLSPPQQGLVLCVILLVCLS 175          
BLAST of X-box-binding protein 1 vs. TrEMBL
Match: A0A5B7FEG0 (X-box-binding protein 1 OS=Portunus trituberculatus OX=210409 GN=XBP1 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.196e-12
Identity = 42/90 (46.67%), Postives = 61/90 (67.78%), Query Frame = 3
Query:  144 DDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEIC------H-SNQNNLITSLSSENTSLKSENQILKDKIRQ 392
            DD + +  PRKRQ+LDHL++EEK++RRK+ NR AAQ ARD+KK R++ LE+       H S   NL   L+++NT L  +N  L++K+ Q
Sbjct:   45 DDRAGDKPPRKRQRLDHLTQEEKIMRRKLKNRVAAQTARDRKKLRMDQLELQLADLTEHVSELTNLAAILTNKNTELTEQNVALQEKLSQ 134          
BLAST of X-box-binding protein 1 vs. TrEMBL
Match: A0A4S2MFH0 (BZIP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000318 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.291e-11
Identity = 50/135 (37.04%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  147 DLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQ-------LEMKLNENLTVINP----QIERNESAVLSSQPWKMFLWVFMILLIS 518
            D  ++Y+PRKR +LD+L+EE+K++RRKILNR+AAQ ARDK++  +E +E      ++LI +L  EN  LK+ N  L+ K  +       L+ ++   ++ +      QIE  ESA L  Q   + LW+  +L++ 
Sbjct:   36 DQLESYSPRKRARLDYLTEEQKVIRRKILNREAAQKARDKRRDLMETME------HDLI-ALQRENDQLKASNLFLRRKFIEQEQKFLALKQRMQGMVSAVEERRSFQIEPLESAELLPQQKGVALWILKLLVLC 163          
BLAST of X-box-binding protein 1 vs. TrEMBL
Match: A0A2R5LAK6 (Putative transcription factor xbp-1 OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.382e-11
Identity = 42/96 (43.75%), Postives = 62/96 (64.58%), Query Frame = 3
Query:  111 DYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLE 398
            ++   E+ +V D ++     RKRQ+LDHL+ EEKMLRRK+ NR AAQ ARD+KK+R++ LEI       ++ +L +E  +L  EN  LK ++ Q E
Sbjct:   26 NWDRPEEVAVMDVVT-TAPVRKRQRLDHLTREEKMLRRKMKNRVAAQCARDRKKARMDELEI-------VVMTLQAEKEALAEENAALKQRLEQSE 113          
BLAST of X-box-binding protein 1 vs. Ensembl Cavefish
Match: xbp1 (X-box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-011210-2])

HSP 1 Score: 62.7734 bits (151), Expect = 3.844e-11
Identity = 41/92 (44.57%), Postives = 54/92 (58.70%), Query Frame = 3
Query:  144 DDLSDNYNP-RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNEN 416
             D S    P RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+++  LE         +  L  EN  L  EN++L+++   L   L+EN
Sbjct:   44 SDCSSTAPPLRKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKAKMGELE-------QQVLELEQENQKLHMENEVLRERASDL---LSEN 125          
BLAST of X-box-binding protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007577.1 (pep scaffold:Pmarinus_7.0:GL477734:38871:44203:1 gene:ENSPMAG00000006843.1 transcript:ENSPMAT00000007577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 4.240e-6
Identity = 31/76 (40.79%), Postives = 42/76 (55.26%), Query Frame = 3
Query:  168 PRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQL 395
            PRKRQ+L HLS EEK  RR   NR AAQ ARD+K +              L+  L  +   L+++N++L +K R L
Sbjct:    2 PRKRQRLVHLSTEEKASRRYGKNRVAAQSARDRKMA--------------LMCDLEKKAEELRAKNRLLVEKNRAL 63          
BLAST of X-box-binding protein 1 vs. Ensembl Nematostella
Match: EDO37681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF27])

HSP 1 Score: 58.9214 bits (141), Expect = 2.847e-10
Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = 3
Query:  168 PRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQIL 374
            PRKR++LD+L+ EE+ LRRK+ NR AAQ ARD+KK+R++ LE         + SL  EN  L+ EN+ L
Sbjct:   26 PRKRRRLDNLTVEERALRRKLKNRVAAQTARDRKKARMQDLE-------EAVESLERENKRLREENKRL 87          
BLAST of X-box-binding protein 1 vs. Ensembl Medaka
Match: xbp1 (X-box binding protein 1 [Source:NCBI gene;Acc:101157780])

HSP 1 Score: 60.4622 bits (145), Expect = 2.676e-10
Identity = 39/82 (47.56%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  171 RKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNEN 416
            RKRQ+L HLS EEK LRRK+ NR AAQ ARD+KK+++  LE         +  L  EN  L  EN++L++K   L   L EN
Sbjct:   59 RKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKAKMGELE-------QQVLELELENKKLHIENRLLREKTSGL---LTEN 130          
BLAST of X-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000048111.1 (SMESG000048111.1)

HSP 1 Score: 360.918 bits (925), Expect = 3.315e-127
Identity = 193/194 (99.48%), Postives = 193/194 (99.48%), Query Frame = 3
Query:   57 MPSXXXXXXXXXXXXRLIDYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVINPQIERNESAVLSSQPWKMFLWVFMILLISQKFQDKGKHQIKSHPKCQSLVVQKSNQTIMLIRKPIGAVT 638
            MPSIKIIGGNGMGKIRLIDYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVINPQIERNESAVLSSQ WKMFLWVFMILLISQKFQDKGKHQIKSHPKCQSLVVQKSNQTIMLIRKPIGAVT
Sbjct:    1 MPSIKIIGGNGMGKIRLIDYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEEEKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLKSENQILKDKIRQLEMKLNENLTVINPQIERNESAVLSSQQWKMFLWVFMILLISQKFQDKGKHQIKSHPKCQSLVVQKSNQTIMLIRKPIGAVT 194          
The following BLAST results are available for this feature:
BLAST of X-box-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
XBP11.608e-1150.67X-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
XBP12.111e-1150.67X-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
XBP12.111e-1150.67X-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
XBP15.413e-968.29X-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
xbp-12.336e-1141.24X-box Binding Protein homolog; X-box binding prote... [more]
xbp-13.165e-1141.24X-box Binding Protein homolog; X-box binding prote... [more]
xbp-17.911e-1142.55X-box Binding Protein homolog; X-box binding prote... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Xbp12.578e-631.53gene:FBgn0021872 transcript:FBtr0310044[more]
Xbp19.875e-652.50gene:FBgn0021872 transcript:FBtr0310045[more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xbp17.725e-1148.78X-box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dstn1.094e-1149.40destrin, actin depolymerizing factor [Source:Xenba... [more]
dstn1.711e-1149.40destrin, actin depolymerizing factor [Source:Xenba... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Xbp11.612e-1237.29X-box binding protein 1 [Source:MGI Symbol;Acc:MGI... [more]
Xbp14.425e-1240.57X-box binding protein 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of X-box-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O35426|XBP1_MOUSE1.128e-1137.29X-box-binding protein 1 OS=Mus musculus OX=10090 G... [more]
sp|Q9R1S4|XBP1_RAT1.218e-1140.82X-box-binding protein 1 OS=Rattus norvegicus OX=10... [more]
sp|Q3SZZ2|XBP1_BOVIN3.874e-1150.67X-box-binding protein 1 OS=Bos taurus OX=9913 GN=X... [more]
sp|P17861|XBP1_HUMAN7.724e-1150.67X-box-binding protein 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of X-box-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293MI903.646e-1237.59X-box binding protein 1 (Fragment) OS=Ornithodoros... [more]
A0A0R3VVB87.553e-1240.94BZIP domain-containing protein OS=Taenia asiatica ... [more]
A0A5B7FEG08.196e-1246.67X-box-binding protein 1 OS=Portunus trituberculatu... [more]
A0A4S2MFH02.291e-1137.04BZIP domain-containing protein OS=Opisthorchis fel... [more]
A0A2R5LAK62.382e-1143.75Putative transcription factor xbp-1 OS=Ornithodoro... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xbp13.844e-1144.57X-box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007577.14.240e-640.79pep scaffold:Pmarinus_7.0:GL477734:38871:44203:1 g... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376812.847e-1049.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of X-box-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xbp12.676e-1047.56X-box binding protein 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of X-box-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000048111.13.315e-12799.48SMESG000048111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006119 ID=SMED30006119|Name=X-box-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=894bp
TTTTAGTATTTGTTTTAAACAACTAATTCACAATTACGTGGAATTTCATC
ATCAAGATGCCTTCAATAAAAATAATAGGTGGGAATGGTATGGGAAAAAT
AAGATTAATTGATTACAAAAGCAGTGAAGATAGTTCAGTTAAAGATGATT
TATCTGATAATTATAATCCCAGAAAAAGGCAAAAGCTTGATCATCTTAGT
GAAGAAGAAAAAATGTTGCGAAGAAAAATACTAAATAGGCAAGCAGCCCA
AATGGCTCGTGATAAAAAGAAATCCAGACTGGAATATTTAGAAATTTGCC
ATTCAAATCAAAATAATCTAATAACTTCATTGTCATCAGAAAATACTTCA
TTAAAAAGTGAAAATCAGATATTAAAAGATAAAATCAGACAGCTTGAGAT
GAAATTAAATGAGAATTTAACAGTCATAAATCCCCAGATTGAGCGAAATG
AGTCAGCAGTACTCTCTTCTCAGCCGTGGAAGATGTTTCTCTGGGTATTT
ATGATACTGTTAATTTCACAAAAGTTTCAAGACAAAGGAAAACATCAAAT
AAAGTCACATCCGAAATGTCAGAGTTTGGTTGTTCAAAAGTCAAATCAAA
CTATCATGTTAATCAGGAAGCCAATTGGAGCAGTGACATAAATGATAAAG
ATTCCAATGGATTGGAAACTCCCATTTGTGACTATTTTGATAATTTAAGT
AATACGTCCAGTGATATGAGTTCAAATCTTCAAAATGACTTCGATATTTA
TCTTGACGAAATAAATAACTTTTTTAGCCAAAGTCAGCCAGATAATTCTG
ATTTACATGATCTTAAATTGGAATTTTGGTGATAAAAATAATTTTTAAAT
ACTGTAAATATATTTTAAAATGTAATGTGTATTTTGAAAAAAAA
back to top

protein sequence of SMED30006119-orf-1

>SMED30006119-orf-1 ID=SMED30006119-orf-1|Name=SMED30006119-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MPSIKIIGGNGMGKIRLIDYKSSEDSSVKDDLSDNYNPRKRQKLDHLSEE
EKMLRRKILNRQAAQMARDKKKSRLEYLEICHSNQNNLITSLSSENTSLK
SENQILKDKIRQLEMKLNENLTVINPQIERNESAVLSSQPWKMFLWVFMI
LLISQKFQDKGKHQIKSHPKCQSLVVQKSNQTIMLIRKPIGAVT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000019muscle progenitor cell
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR004827bZIP
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 89..116
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 52..114
e-value: 1.2E-7
score: 33.6
NoneNo IPR availablePANTHERPTHR46542FAMILY NOT NAMEDcoord: 21..127
NoneNo IPR availableSUPERFAMILYSSF57959Leucine zipper domaincoord: 53..110
IPR004827Basic-leucine zipper domainSMARTSM00338brlzneucoord: 48..119
e-value: 4.1E-5
score: 33.0
IPR004827Basic-leucine zipper domainPROSITEPS50217BZIPcoord: 50..113
score: 8.6