Tyrosine-protein phosphatase non-receptor type

Overview
NameTyrosine-protein phosphatase non-receptor type
Smed IDSMED30006117
Length (bp)1670
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein phosphatase non-receptor type (SMED30006117) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type (SMED30006117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein phosphatase non-receptor type (SMED30006117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein phosphatase non-receptor type (SMED30006117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30006117SMESG000018862.1 dd_Smed_v4_6996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30006117SMESG000018862.1 dd_Smed_v4_6996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006117SMESG000018862.1 dd_Smed_v4_6996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006117SMESG000018862.1 dd_Smed_v4_6996_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Match: PTPN2 (protein tyrosine phosphatase non-receptor type 2 [Source:HGNC Symbol;Acc:HGNC:9650])

HSP 1 Score: 181.415 bits (459), Expect = 1.690e-51
Identity = 109/299 (36.45%), Postives = 168/299 (56.19%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQ 1053
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ +     + HF +  WPD   P+   SFL  L  VR+   L+    PA+IHCSAG GRSGTF L+D  ++ MEK    D++ I  ++  +R  RMG++ +  QL+FSY AIIE  K  K   + Q
Sbjct:    3 TTIEREFEELDTQRRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAE---NDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG-----FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQ 286          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Match: PTPN1 (protein tyrosine phosphatase non-receptor type 1 [Source:HGNC Symbol;Acc:HGNC:9642])

HSP 1 Score: 183.726 bits (465), Expect = 1.866e-51
Identity = 103/288 (35.76%), Postives = 166/288 (57.64%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++++  +  W  ++Q I++ AS    +  C++++  +N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P+ E    I    N K+     L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 MEKEFEQIDKSGSWAAIYQDIRHEAS----DFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLT----LISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Match: PTPN2 (protein tyrosine phosphatase non-receptor type 2 [Source:HGNC Symbol;Acc:HGNC:9650])

HSP 1 Score: 181.8 bits (460), Expect = 3.226e-51
Identity = 109/299 (36.45%), Postives = 168/299 (56.19%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQ 1053
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ +     + HF +  WPD   P+   SFL  L  VR+   L+    PA+IHCSAG GRSGTF L+D  ++ MEK    D++ I  ++  +R  RMG++ +  QL+FSY AIIE  K  K   + Q
Sbjct:    3 TTIEREFEELDTQRRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAE---NDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG-----FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQ 286          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Match: PTPN2 (protein tyrosine phosphatase non-receptor type 2 [Source:HGNC Symbol;Acc:HGNC:9650])

HSP 1 Score: 182.185 bits (461), Expect = 4.763e-51
Identity = 135/457 (29.54%), Postives = 220/457 (48.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFXXXXXXXXXXDTVYYQISDEYDESDLSDTSHSDNYFSN---FYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRKMKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEI--NNNYHWSLFIVGGAI 1512
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ +     + HF +  WPD   P+   SFL  L  VR+   L+    PA+IHCSAG GRSGTF L+D  ++ MEK    D++ I  ++  +R  RMG++ +  QL+FSY AIIE  K  K   + Q     L  +D                           +S  +D S   +   ++ Y  N     ++ + G++    S+  + +  +N   + R +I   RK    Q + ++ + L E   KR R +   P  + +     I       W+LF    A+
Sbjct:    3 TTIEREFEELDTQRRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAE---NDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG-----FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKED---------------------------LSPAFDHS--PNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL 415          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Match: PTPN2 (protein tyrosine phosphatase non-receptor type 2 [Source:HGNC Symbol;Acc:HGNC:9650])

HSP 1 Score: 170.629 bits (431), Expect = 7.408e-47
Identity = 109/317 (34.38%), Postives = 173/317 (54.57%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRST--------DNQKIIFSIKLLEMHTSN-------GFYQRKLRL---FNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQ 1053
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T        ++ K  +++ LL++   N         Y + L L    +L++     + HF +  WPD   P+   SFL  L  VR+   L+    PA+IHCSAG GRSGTF L+D  ++ MEK    D++ I  ++  +R  RMG++ +  QL+FSY AIIE  K  K   + Q
Sbjct:    3 TTIEREFEELDTQRRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAE---NDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINYIENLWITLYLKLLMLDVKRSLKSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQ 309          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 124.79 bits (312), Expect = 1.327e-29
Identity = 94/292 (32.19%), Postives = 144/292 (49.32%), Query Frame = 1
Query:  175 SNLEREYDELCMNN--GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLV-KIDK-RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAF 1023
            + L    + L MNN  G+   F+ I+    F   +     S ++ N+ KN+Y  +  YD++R++L     Y   DYINA+ V   DK RSYI TQ P   T   FW MVW  +S+ I++L N EE    + + Y+P        R T     I    L  +H ++ +  R +RL  +      ++ H ++  WPDH  P     FL  L  V+  N  D    P I HCSAG GR+G F +ID ++ ++   +++D   I G +  LR QR  MV +  Q  F ++A+++A 
Sbjct:  646 AELANHIERLRMNNNAGFQSEFESIETGQHFTWEH-----SSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS-------RGTATYGDIEVTLLESVHLAH-YTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPND--AGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVD---IYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAV 919          

HSP 2 Score: 100.908 bits (250), Expect = 5.447e-22
Identity = 72/265 (27.17%), Postives = 116/265 (43.77%), Query Frame = 1
Query:  256 SFKMMNNECKISRSEENRFKNKYREIVPYDYNRI---LLPRSSYFNSDYINASLVKI--DKRSYIVTQYPS-RTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            + K  +N C ++    NR KN+    VPYD NR+   LLP +    SDYINAS +    ++ +YI TQ P+  T   FW  +W   S  I +L    E   E       +D +   T  Q  +  ++ +  +    ++ R+ R+ ++ T     +  F F  WPD   P     FL  +  V           P  +HC +GAGR+  F  + +++ +M   H +D   +   ++ LR +R  M+    Q  F Y A  E    +
Sbjct:  958 TLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGAD--GSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQC-----SDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVD---VFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1212          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 124.405 bits (311), Expect = 1.598e-29
Identity = 94/292 (32.19%), Postives = 144/292 (49.32%), Query Frame = 1
Query:  175 SNLEREYDELCMNN--GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLV-KIDK-RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAF 1023
            + L    + L MNN  G+   F+ I+    F   +     S ++ N+ KN+Y  +  YD++R++L     Y   DYINA+ V   DK RSYI TQ P   T   FW MVW  +S+ I++L N EE    + + Y+P        R T     I    L  +H ++ +  R +RL  +      ++ H ++  WPDH  P     FL  L  V+  N  D    P I HCSAG GR+G F +ID ++ ++   +++D   I G +  LR QR  MV +  Q  F ++A+++A 
Sbjct:  513 AELANHIERLRMNNNAGFQSEFESIETGQHFTWEH-----SSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS-------RGTATYGDIEVTLLESVHLAH-YTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPND--AGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVD---IYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAV 786          

HSP 2 Score: 100.908 bits (250), Expect = 6.364e-22
Identity = 72/265 (27.17%), Postives = 116/265 (43.77%), Query Frame = 1
Query:  256 SFKMMNNECKISRSEENRFKNKYREIVPYDYNRI---LLPRSSYFNSDYINASLVKI--DKRSYIVTQYPS-RTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            + K  +N C ++    NR KN+    VPYD NR+   LLP +    SDYINAS +    ++ +YI TQ P+  T   FW  +W   S  I +L    E   E       +D +   T  Q  +  ++ +  +    ++ R+ R+ ++ T     +  F F  WPD   P     FL  +  V           P  +HC +GAGR+  F  + +++ +M   H +D   +   ++ LR +R  M+    Q  F Y A  E    +
Sbjct:  825 TLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGAD--GSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQC-----SDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVD---VFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1079          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 124.79 bits (312), Expect = 1.634e-29
Identity = 95/291 (32.65%), Postives = 143/291 (49.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNN--GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLVK-IDK-RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            + L    + L MNN  G+   F+ I+    F   +     S ++ N+ KN+Y  +  YD++R++L     Y   DYINA+ V   DK RSYI TQ P   T   FW MVW  +S+ I++L N EE    + + Y+P        R T     I  + LLE      +  R +RL  +      ++ H ++  WPDH  P     FL  L  V+  N  D    P I HCSAG GR+G F +ID ++ ++   +++D   I G +  LR QR  MV +  Q  F ++A+++A
Sbjct: 1610 AELANHIERLRMNNNAGFQSEFESIETGQHFTWEH-----SSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS-------RGTATYGDI-EVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPND--AGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVD---IYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA 1882          

HSP 2 Score: 98.2117 bits (243), Expect = 4.999e-21
Identity = 72/265 (27.17%), Postives = 116/265 (43.77%), Query Frame = 1
Query:  256 SFKMMNNECKISRSEENRFKNKYREIVPYDYNRI---LLPRSSYFNSDYINASLVK--IDKRSYIVTQYPS-RTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            + K  +N C ++    NR KN+    VPYD NR+   LLP +    SDYINAS +    ++ +YI TQ P+  T   FW  +W   S  I +L    E   E       +D +   T  Q  +  ++ +  +    ++ R+ R+ ++ T     +  F F  WPD   P     FL  +  V           P  +HC +GAGR+  F  + +++ +M   H +D   +   ++ LR +R  M+    Q  F Y A  E    +
Sbjct: 1922 TLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGAD--GSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQC-----SDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVD---VFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 2176          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 124.79 bits (312), Expect = 1.656e-29
Identity = 95/291 (32.65%), Postives = 143/291 (49.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNN--GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLVK-IDK-RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            + L    + L MNN  G+   F+ I+    F   +     S ++ N+ KN+Y  +  YD++R++L     Y   DYINA+ V   DK RSYI TQ P   T   FW MVW  +S+ I++L N EE    + + Y+P        R T     I  + LLE      +  R +RL  +      ++ H ++  WPDH  P     FL  L  V+  N  D    P I HCSAG GR+G F +ID ++ ++   +++D   I G +  LR QR  MV +  Q  F ++A+++A
Sbjct: 1654 AELANHIERLRMNNNAGFQSEFESIETGQHFTWEH-----SSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPS-------RGTATYGDI-EVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPND--AGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVD---IYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA 1926          

HSP 2 Score: 98.2117 bits (243), Expect = 5.244e-21
Identity = 72/265 (27.17%), Postives = 116/265 (43.77%), Query Frame = 1
Query:  256 SFKMMNNECKISRSEENRFKNKYREIVPYDYNRI---LLPRSSYFNSDYINASLVK--IDKRSYIVTQYPS-RTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            + K  +N C ++    NR KN+    VPYD NR+   LLP +    SDYINAS +    ++ +YI TQ P+  T   FW  +W   S  I +L    E   E       +D +   T  Q  +  ++ +  +    ++ R+ R+ ++ T     +  F F  WPD   P     FL  +  V           P  +HC +GAGR+  F  + +++ +M   H +D   +   ++ LR +R  M+    Q  F Y A  E    +
Sbjct: 1966 TLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGAD--GSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQC-----SDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVD---VFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 2220          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 124.405 bits (311), Expect = 1.669e-29
Identity = 93/291 (31.96%), Postives = 141/291 (48.45%), Query Frame = 1
Query:  175 SNLEREYDELCMNN--GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLV-KIDK-RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            + L    + L MNN  G+   F+ I+    F   +     S ++ N+ KN+Y  +  YD++R++L     Y   DYINA+ V   DK RSYI TQ P   T   FW MVW  +S+ I++L N EE    + + Y+P      Y            + LLE      +  R +RL  +      ++ H ++  WPDH  P     FL  L  V+  N  D    P I HCSAG GR+G F +ID ++ ++   +++D   I G +  LR QR  MV +  Q  F ++A+++A
Sbjct:  677 AELANHIERLRMNNNAGFQSEFESIETGQHFTWEH-----SSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGD--------IEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPND--AGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVD---IYGCVTALRAQRSYMVQTEEQYIFIHDAVLDA 949          

HSP 2 Score: 100.523 bits (249), Expect = 6.986e-22
Identity = 72/265 (27.17%), Postives = 116/265 (43.77%), Query Frame = 1
Query:  256 SFKMMNNECKISRSEENRFKNKYREIVPYDYNRI---LLPRSSYFNSDYINASLVKI--DKRSYIVTQYPS-RTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            + K  +N C ++    NR KN+    VPYD NR+   LLP +    SDYINAS +    ++ +YI TQ P+  T   FW  +W   S  I +L    E   E       +D +   T  Q  +  ++ +  +    ++ R+ R+ ++ T     +  F F  WPD   P     FL  +  V           P  +HC +GAGR+  F  + +++ +M   H +D   +   ++ LR +R  M+    Q  F Y A  E    +
Sbjct:  989 TLKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGAD--GSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQC-----SDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVD---VFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1243          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Match: Ptp61F (gene:FBgn0267487 transcript:FBtr0072717)

HSP 1 Score: 169.474 bits (428), Expect = 8.418e-46
Identity = 99/280 (35.36%), Postives = 155/280 (55.36%), Query Frame = 1
Query:  220 WNVLFQKIKNNASFKMMNNECKISRSEE--NRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYI-RSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            W+  +++I      +    +   S SE   NR  N+YR++ PYD++RI+L R S    DYINA+LV++++  R YI+TQ P   T   FWLMVW  KS  +++L    E +      Y+P   N++   ++     +  +++L+ + T   F +R  +L +LET    ++  F +  WPD   P    +FL  L  VR    L     PA++HCSAG GRSGTFCL+D  ++ ++KY   +   +S ++ ELR  RMG++ +  QL FSY+AIIE  K+ 
Sbjct:   30 WHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSV---DYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWP---NEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECN---VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKL 300          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Match: Ptp61F (gene:FBgn0267487 transcript:FBtr0072718)

HSP 1 Score: 169.474 bits (428), Expect = 9.808e-46
Identity = 99/280 (35.36%), Postives = 155/280 (55.36%), Query Frame = 1
Query:  220 WNVLFQKIKNNASFKMMNNECKISRSEE--NRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESE---SESYFPKTENDLYI-RSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            W+  +++I      +    +   S SE   NR  N+YR++ PYD++RI+L R S    DYINA+LV++++  R YI+TQ P   T   FWLMVW  KS  +++L    E +      Y+P   N++   ++     +  +++L+ + T   F +R  +L +LET    ++  F +  WPD   P    +FL  L  VR    L     PA++HCSAG GRSGTFCL+D  ++ ++KY   +   +S ++ ELR  RMG++ +  QL FSY+AIIE  K+ 
Sbjct:   30 WHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGSV---DYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWP---NEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECN---VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKL 300          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Match: Ptp61F (gene:FBgn0267487 transcript:FBtr0072716)

HSP 1 Score: 167.933 bits (424), Expect = 2.630e-45
Identity = 95/255 (37.25%), Postives = 145/255 (56.86%), Query Frame = 1
Query:  289 SRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESE---SESYFPKTENDLYI-RSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            S    NR  N+YR++ PYD++RI+L R S    DYINA+LV++++  R YI+TQ P   T   FWLMVW  KS  +++L    E +      Y+P   N++   ++     +  +++L+ + T   F +R  +L +LET    ++  F +  WPD   P    +FL  L  VR    L     PA++HCSAG GRSGTFCL+D  ++ ++KY   +   +S ++ ELR  RMG++ +  QL FSY+AIIE  K+ 
Sbjct:   50 SERHTNRGLNRYRDVNPYDHSRIVLKRGSV---DYINANLVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWP---NEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECN---VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKL 295          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Match: Ptp61F (gene:FBgn0267487 transcript:FBtr0072719)

HSP 1 Score: 118.242 bits (295), Expect = 2.037e-28
Identity = 64/189 (33.86%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  478 MVWHFKSLGIILLGNFEESE---SESYFPKTENDLYI-RSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            MVW  KS  +++L    E +      Y+P   N++   ++     +  +++L+ + T   F +R  +L +LET    ++  F +  WPD   P    +FL  L  VR    L     PA++HCSAG GRSGTFCL+D  ++ ++KY   +   +S ++ ELR  RMG++ +  QL FSY+AIIE  K+ 
Sbjct:    1 MVWEQKSRAVLMLNKLMEKKQIKCHLYWP---NEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECN---VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKL 183          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Match: Ptp61F (gene:FBgn0267487 transcript:FBtr0310161)

HSP 1 Score: 118.242 bits (295), Expect = 2.037e-28
Identity = 64/189 (33.86%), Postives = 102/189 (53.97%), Query Frame = 1
Query:  478 MVWHFKSLGIILLGNFEESE---SESYFPKTENDLYI-RSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            MVW  KS  +++L    E +      Y+P   N++   ++     +  +++L+ + T   F +R  +L +LET    ++  F +  WPD   P    +FL  L  VR    L     PA++HCSAG GRSGTFCL+D  ++ ++KY   +   +S ++ ELR  RMG++ +  QL FSY+AIIE  K+ 
Sbjct:    1 MVWEQKSRAVLMLNKLMEKKQIKCHLYWP---NEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDSGCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECN---VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGIKKL 183          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Match: ptpn2b (protein tyrosine phosphatase non-receptor type 2b [Source:ZFIN;Acc:ZDB-GENE-030909-8])

HSP 1 Score: 173.326 bits (438), Expect = 3.575e-48
Identity = 100/291 (34.36%), Postives = 166/291 (57.04%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFP-KTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++++     W  ++ +I+N +      +EC  K+++  ENR +N+YR++ P+D++R+ L  +    +DYINASLV ++  +R YI+TQ P R T   FWLM+W  K+  +I+L    E  SE    Y+P + E ++  R T      F + L+     + +  R L L N  T    +++HF +  WPD   P+   SFL  L  VR+   L   + PA++HCSAG GRSGTF L+D  ++ M+K      ++I  ++ ++R  RMG++ +  QL+FSY A++E  K
Sbjct:    1 MEQEFEDIDSEGRWQNIYLEIRNQS------HECAFKVAKYPENRIRNRYRDVSPFDHSRVKLENT---ENDYINASLVVMEEAQRRYILTQGPLRNTCGHFWLMIWEQKTKAVIMLNRVIEKGSEKCAQYWPTQEEREMSFRDTR-----FVVTLVSEDVKSYYTTRVLELQNANTGETREIYHFHYTTWPDFGVPESPASFLNFLFKVRESGSLGMEQGPAVVHCSAGIGRSGTFSLVDTCLVLMDKRKDPLLVDIKKILLDMRKYRMGLIQTPDQLRFSYMAVLEGAK 277          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Match: ptpn2a (protein tyrosine phosphatase non-receptor type 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1196])

HSP 1 Score: 157.147 bits (396), Expect = 2.434e-42
Identity = 95/289 (32.87%), Postives = 158/289 (54.67%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFP-KTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +++E+  +  +  W  L+ ++ N +  +      K+++  EN  +N+YR++ PYD++R+ L  S    +DYINASL+ ++  +R YI+TQ P + T   FWLMVW   S  +I+L    E  +E    Y+P K E D+    T      F + L+       +  R L L N +T    D++HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSG+F L+D  ++ M++ +    ++I  ++ ++R  RMG++ +  QL+FSY A++E  K
Sbjct:    1 MDQEFKNIDSSGEWQNLYNELHNQSQERSY----KVAKFPENCNRNRYRDVSPYDHSRVKLENS---ENDYINASLITMEEAQRRYILTQGPLKNTCGHFWLMVWEQGSKAVIMLNRVIEKGTEKCAQYWPSKEEQDMNFSDTG-----FMVTLVCEDVKPNYTIRLLELQNGKTGETRDIYHFHYTAWPDFGVPESPASFLDFLFKVRESGSLGPENGPVVVHCSAGIGRSGSFSLVDTCLVLMDQRNDFLAVDIQKVLLDMREYRMGLIQTPDQLRFSYMAVMEGAK 277          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Match: ptpn2a (protein tyrosine phosphatase non-receptor type 2a [Source:ZFIN;Acc:ZDB-GENE-040426-1196])

HSP 1 Score: 153.68 bits (387), Expect = 2.525e-42
Identity = 93/284 (32.75%), Postives = 155/284 (54.58%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESE---SYFP-KTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAI 1011
            +++E+  +  +  W  L+ ++ N +  +      K+++  EN  +N+YR++ PYD++R+ L  S    +DYINASL+ ++  +R YI+TQ P + T   FWLMVW   S  +I+L    E  +E    Y+P K E D+    T      F + L+       +  R L L N +T    D++HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSG+F L+D  ++ M++ +    ++I  ++ ++R  RMG++ +  QL+FSY A+
Sbjct:    1 MDQEFKNIDSSGEWQNLYNELHNQSQERSY----KVAKFPENCNRNRYRDVSPYDHSRVKLENSE---NDYINASLITMEEAQRRYILTQGPLKNTCGHFWLMVWEQGSKAVIMLNRVIEKGTEKCAQYWPSKEEQDMNFSDTG-----FMVTLVCEDVKPNYTIRLLELQNGKTGETRDIYHFHYTAWPDFGVPESPASFLDFLFKVRESGSLGPENGPVVVHCSAGIGRSGSFSLVDTCLVLMDQRNDFLAVDIQKVLLDMREYRMGLIQTPDQLRFSYMAV 272          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Match: ptpn1 (protein tyrosine phosphatase non-receptor type 1 [Source:ZFIN;Acc:ZDB-GENE-980605-23])

HSP 1 Score: 121.324 bits (303), Expect = 6.893e-30
Identity = 67/189 (35.45%), Postives = 98/189 (51.85%), Query Frame = 1
Query:  469 FWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            FW MVW  +S G+++L    E  S     Y+P+ E    +    N    F + L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL+D  +L M +     ++ I  ++ E+R  RMG++ +  QL+FSY A IE  K
Sbjct:   10 FWEMVWEQRSRGVVMLNRVIEKGSVKCAQYWPQREEREAVFEDTN----FRLTLISEDVKSYYTVRQLELENLSTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGCLSPELGPVVVHCSAGIGRSGTFCLVDTCLLLMSQRKDPSSVRIQEVLLEMRRYRMGLIQTADQLRFSYLAFIEGAK 194          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 125.561 bits (314), Expect = 7.984e-30
Identity = 87/316 (27.53%), Postives = 151/316 (47.78%), Query Frame = 1
Query:  130 IFYFLNMIDNLEFHESNLEREYDELCMNN--------GWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLP-RSSYFNSDYINASLVKI--DKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAI---IEAFKQF 1032
            +F F  ++++  + ++ LE    E  MN         G   L  + K   S K+ N++ +      N  KN+  +I+PY++NR+++P +    N+DYINAS +     K SY+  Q P   T + +W M+W ++S  I++L   EE   E        D  +   D      SI+L     S  +  R L + N   +    +  F F  WP+   P      + ++  V++Q       +P  +HCSAGAGR+GTFC +  ++ +++    LD  +    ++ LR+QR  MV ++ Q +F Y+ +   I+AF  +
Sbjct:  513 VFIFQALLEHYLYGDTELEVTSLETHMNKLYAPLPGAGCGGLEAEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYINASFIDGYRQKDSYMACQGPLQHTIEDYWRMIWEWRSCSIVMLTELEERGQEKCAQYWPTDGVMVCGD-----MSIELKREEESESYTVRDLLVTNNRENKSRAVRQFHFHGWPEVGIPSDGKGMINIIAAVQKQQ-QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQT---VKSLRLQRPHMVQTLEQYEFCYKVVQEYIDAFSDY 819          

HSP 2 Score: 99.3673 bits (246), Expect = 2.344e-21
Identity = 74/281 (26.33%), Postives = 125/281 (44.48%), Query Frame = 1
Query:  223 NVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILL------PRSSYFNSDYINASLVKIDKRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESESYFPK----TENDLYIRSTDNQKII-FSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPE--NPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAF 1023
            N LF++  N      +   C  +  EEN+ KN+Y  I+PYD++R+ L      P S Y N+ YIN      +K  +I  Q P   T + +W M+W   ++           +   Y+P     T  ++ +   D   ++ ++I+   +        +K +           +  F F  WPD   P      L  L  V+  N    P+   P ++HCSAG GR+GTF +ID ++  M     +D   + G +  +R QR  MV + +Q  F ++A++E +
Sbjct:  267 NKLFREEFNALPVCPIQASCDAASKEENKEKNRYVNILPYDHSRVHLTSLEGVPDSDYINASYINGYQ---EKNKFIAAQGPKEETVNDYWRMIWEQNTVNAAT-----NCKCAQYWPDQGCWTYGNIRVSVEDTMILVDYTIRKFCIQQVGDVSGKKPQRL---------VTQFHFTSWPDFGVPFTPIGMLKFLKKVKNCN----PQYAGPIVVHCSAGVGRTGTFIVIDAMLDMMGAERKVD---VFGFVTRIRAQRCQMVQTDMQYVFIFQALLEHY 523          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Match: cybrd1 (cytochrome b reductase 1 [Source:Xenbase;Acc:XB-GENE-1011687])

HSP 1 Score: 188.348 bits (477), Expect = 2.262e-53
Identity = 107/277 (38.63%), Postives = 163/277 (58.84%), Query Frame = 1
Query:  214 NGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            N W   +Q+I+N AS    +  CK++R +EN+ +N+YR++ P+D++RI L R    ++DYINASL+K++  +RSYI+TQ P   T   FW M+W  KS+G+++L    E  S     Y+PK E++  +    N K+     LL     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    4 NSWGSNYQEIRNQAS----DFPCKVARLQENKARNRYRDVSPFDHSRIKLHRE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMIWEQKSIGVVMLNRVIEKGSIKCAQYWPKKEDNSMVFDDSNLKLT----LLSEDIKSYYTIRQLMLENLITQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAK 269          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:Xenbase;Acc:XB-GENE-961854])

HSP 1 Score: 183.341 bits (464), Expect = 4.426e-51
Identity = 120/366 (32.79%), Postives = 194/366 (53.01%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTEND-LYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFXXXXXXXXXXDTVYYQISDEYDESDLSDTSHSDNYFSNFYKDSVDGN 1257
            +E+E+ E+   NGWN  +  I+N +   ++ N  KI+++ EN+ +N+YR++ PYD++R+ L       +DYINASLV ++  +RSYI+TQ P   T   FWLMVW  KS  I++L    E ++     Y+P  E + L+ + T        +KL+     + +  R L+L +++T    D++HF +  WPD   P+   SFL  L  VR+   L     PA++HCSAG GRSGTF L+D  ++ MEK     +++I  ++  +R  RMG++ +  QL+FSY A+IE  K      + Q +   L  +D+   I++               +   Q  +  + + LSD  H +N   +  K   DGN
Sbjct:    1 MEKEFREIDEENGWNSSYGDIRNKSP--VLPN--KIAKNPENKNRNRYRDVNPYDHSRVKL---QNVENDYINASLVVVEEAQRSYILTQGPLPNTCCHFWLMVWQQKSKAIVMLNRIIEKDAVKCAQYWPTPEEEALFYKETG-----LCVKLVSEDIKSYYTVRVLQLQDIKTGEARDIFHFHYTTWPDFGVPQSPASFLNFLFKVRESGSLSLQNGPAVVHCSAGIGRSGTFSLVDTCLVLMEKREDPCSVDIKQVLLNMRNYRMGLIQTPGQLRFSYMAVIEGSKYIMGDSSLQDHWKELSQEDQCPKIDRL--------------SFQRQCVERCNGNRLSD--HGENTLESCSKPQDDGN 338          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Match: cybrd1 (cytochrome b reductase 1 [Source:Xenbase;Acc:XB-GENE-1011687])

HSP 1 Score: 181.03 bits (458), Expect = 1.916e-50
Identity = 104/270 (38.52%), Postives = 160/270 (59.26%), Query Frame = 1
Query:  235 QKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            ++I+N AS    +  CK++R +EN+ +N+YR++ P+D++RI L R    ++DYINASL+K++  +RSYI+TQ P   T   FW M+W  KS+G+++L    E  S     Y+PK E++  +    N K+     LL     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:   39 REIRNQAS----DFPCKVARLQENKARNRYRDVSPFDHSRIKLHRE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMIWEQKSIGVVMLNRVIEKGSIKCAQYWPKKEDNSMVFDDSNLKLT----LLSEDIKSYYTIRQLMLENLITQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAK 297          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Match: psmd8 (proteasome 26S subunit, non-ATPase 8 [Source:Xenbase;Acc:XB-GENE-961854])

HSP 1 Score: 169.474 bits (428), Expect = 9.384e-46
Identity = 110/332 (33.13%), Postives = 175/332 (52.71%), Query Frame = 1
Query:  283 KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTEND-LYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFXXXXXXXXXXDTVYYQISDEYDESDLSDTSHSDNYFSNFYKDSVDGN 1257
            KI+++ EN+ +N+YR++ PYD++R+ L       +DYINASLV ++  +RSYI+TQ P   T   FWLMVW  KS  I++L    E ++     Y+P  E + L+ + T        +KL+     + +  R L+L +++T    D++HF +  WPD   P+   SFL  L  VR+   L     PA++HCSAG GRSGTF L+D  ++ MEK     +++I  ++  +R  RMG++ +  QL+FSY A+IE  K      + Q +   L  +D+   I++               +   Q  +  + + LSD  H +N   +  K   DGN
Sbjct:   40 KIAKNPENKNRNRYRDVNPYDHSRVKL---QNVENDYINASLVVVEEAQRSYILTQGPLPNTCCHFWLMVWQQKSKAIVMLNRIIEKDAVKCAQYWPTPEEEALFYKETG-----LCVKLVSEDIKSYYTVRVLQLQDIKTGEARDIFHFHYTTWPDFGVPQSPASFLNFLFKVRESGSLSLQNGPAVVHCSAGIGRSGTFSLVDTCLVLMEKREDPCSVDIKQVLLNMRNYRMGLIQTPGQLRFSYMAVIEGSKYIMGDSSLQDHWKELSQEDQCPKIDRL--------------SFQRQCVERCNGNRLSD--HGENTLESCSKPQDDGN 347          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Match: cfap161 (cilia and flagella associated protein 161 [Source:Xenbase;Acc:XB-GENE-963875])

HSP 1 Score: 124.79 bits (312), Expect = 1.324e-29
Identity = 83/294 (28.23%), Postives = 147/294 (50.00%), Query Frame = 1
Query:  172 ESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLP-RSSYFNSDYINASLVKI--DKRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            E++L++ Y ++   N    L ++ K   S K+ N++ +      N  KN+  +I+PY++NR+++P +    N+DY+NAS +     K SYI +Q P R + + FW M+W +KS  +++L   EE   E    Y+P +E  L            +I+L +      +  R L + N   +    +  F F  WP+   P      + ++  V++Q       +P  +HCSAGAGR+GTFC +  +   +E+  +   L++   ++ LR+QR  MV ++ Q +F Y  + E    F
Sbjct:  312 ETHLQKLYSKIPGTNSTG-LEEEFKKLTSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLRHSLEDFWRMIWEWKSCSLVMLTELEERGQEKCAQYWP-SEGTLSFGD-------ITIELKKEEECESYTVRDLFVTNTRENKSRQIRQFHFHGWPEVGIPTDGKGMINIIAAVQKQQ-QQSGNHPITVHCSAGAGRTGTFCALSTV---LERVKAEGILDVFQTVKSLRLQRPHMVQTLEQYEFCYRVVQEYIDAF 592          

HSP 2 Score: 109.383 bits (272), Expect = 1.392e-24
Identity = 78/279 (27.96%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  223 NVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRI-LLPRSSYFNSDYINASLVKIDKRSYIVTQYPSRTRDLFWLMVWHFKSLGIILLGNFEESESES--------YFPKTENDLYIRSTDNQKI-IFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPE--NPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAF 1023
            N LF++  N      +   C+ +  EEN+ KN+Y  I+PYD++R+ LLP     +SDYIN+S + +  +   V          FW M+W   +  I+++ N +E +  S        Y+P    D    +  N ++ +  + +L  +T        +R F ++      +  F F  WPD   P      L  L  V+  N    P+     ++HCSAG GR+GTF +ID ++  M   +S   +++ G +  +R QR  MV + +Q  F Y+A++E +
Sbjct:   48 NKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLLPIEGVPDSDYINSSFINVSPKEETVND--------FWRMIWEQNTATIVMVTNLKERKEASGANYTGYWYWP----DQGCWTYGNIRVSVEDMTVLVDYT--------VRKFCIQQKPQRLVTQFHFTSWPDFGVPFTPIGMLKFLKKVKTCN----PQYAGAIVVHCSAGVGRTGTFIVIDAMLDMM---NSEKKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHY 299          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Match: Ptpn1 (protein tyrosine phosphatase, non-receptor type 1 [Source:MGI Symbol;Acc:MGI:97805])

HSP 1 Score: 182.185 bits (461), Expect = 3.786e-51
Identity = 103/288 (35.76%), Postives = 164/288 (56.94%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++E+     W  ++Q I++ AS    +  CK+++  +N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P+ E    +      K+     L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 MEKEFEEIDKAGNWAAIYQDIRHEAS----DFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLHQE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQQEEKEMVFDDTGLKLT----LISEDVKSYYTVRQLELENLTTKETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Match: Ptpn2 (protein tyrosine phosphatase, non-receptor type 2 [Source:MGI Symbol;Acc:MGI:97806])

HSP 1 Score: 178.718 bits (452), Expect = 1.804e-50
Identity = 107/293 (36.52%), Postives = 165/293 (56.31%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ T     + HF +  WPD   P+   SFL  L  VR+   L     PA+IHCSAG GRSGTF L+D  ++ MEK    +++ +  ++  +R  RMG++ +  QL+FSY AIIE  K  K
Sbjct:    3 ATIEREFEELDAQCRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQST---ENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKESVKCAQYWPTDDREMVFKETG-----FSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---EDVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTK 280          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Match: Ptpn2 (protein tyrosine phosphatase, non-receptor type 2 [Source:MGI Symbol;Acc:MGI:97806])

HSP 1 Score: 178.718 bits (452), Expect = 2.309e-50
Identity = 107/293 (36.52%), Postives = 165/293 (56.31%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ T     + HF +  WPD   P+   SFL  L  VR+   L     PA+IHCSAG GRSGTF L+D  ++ MEK    +++ +  ++  +R  RMG++ +  QL+FSY AIIE  K  K
Sbjct:    3 ATIEREFEELDAQCRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQST---ENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKESVKCAQYWPTDDREMVFKETG-----FSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---EDVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTK 280          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Match: Ptpn2 (protein tyrosine phosphatase, non-receptor type 2 [Source:MGI Symbol;Acc:MGI:97806])

HSP 1 Score: 177.948 bits (450), Expect = 9.226e-50
Identity = 107/293 (36.52%), Postives = 165/293 (56.31%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ T     + HF +  WPD   P+   SFL  L  VR+   L     PA+IHCSAG GRSGTF L+D  ++ MEK    +++ +  ++  +R  RMG++ +  QL+FSY AIIE  K  K
Sbjct:    3 ATIEREFEELDAQCRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQST---ENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKESVKCAQYWPTDDREMVFKETG-----FSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---EDVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTK 280          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 129.413 bits (324), Expect = 8.103e-31
Identity = 88/284 (30.99%), Postives = 143/284 (50.35%), Query Frame = 1
Query:  235 QKIKNNASFKMMNNECKI----------SRSEENRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKIDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPK--TENDLYIRST--DNQKI-IFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            +++K N S K+      I          S  E N+ KN+Y  ++ YD++R++L P      SDYINA+ V   +R  +YI TQ P   T   FW MVW  +S  ++++   EE    + + Y+P   TE   +I+ T  D  ++  F ++   +H +    +R++R             HF+F  WPDH  P+    FL  L  V+  N  D    P ++HCSAG GR+G F +ID ++ +++   ++D   + G +  +R QR  MV +  Q  F +EA++EA
Sbjct: 1342 ERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVR-------------HFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPD--AGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVD---VYGHVTLMRSQRNYMVQTEDQYGFIHEALLEA 1607          

HSP 2 Score: 105.145 bits (261), Expect = 6.327e-23
Identity = 71/255 (27.84%), Postives = 122/255 (47.84%), Query Frame = 1
Query:  304 NRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVK--IDKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESE---SYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPT 1047
            N+FKN+   I+PY+ +R+ L P      SDYINAS +     +++YI TQ P + T + FW  +W   S  +++L    E   E    Y+P        RS   Q   F +  +  +    +  R+ ++ +        +  F+F  WP+  APK    F+  +G V +       + P  +HCSAG GR+G F  + +++ +M +Y  +  ++I   ++ LR QR  MV +  + +F ++A +E    F    T
Sbjct: 1664 NKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAE------RSARYQ--YFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM-RYEGV--VDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFDHYAT 1907          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Match: sp|O13016|PTN1_CHICK (Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus OX=9031 GN=PTPN1 PE=1 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.505e-51
Identity = 103/289 (35.64%), Postives = 166/289 (57.44%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFP-KTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E+  L     W  ++Q I++ AS    +  CK+++   N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P K E +++   T+       + L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL+D  +L M+K     ++++  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 IEKEFHRLDQAASWAAIYQDIRHEAS----DFPCKVAKHPRNKNRNRYRDVSPFDHSRIKLNQG---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSIKCAQYWPRKEEKEMFFEDTN-----LKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEYGPVVVHCSAGIGRSGTFCLVDTCLLLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Match: sp|P18031|PTN1_HUMAN (Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 8.960e-51
Identity = 103/288 (35.76%), Postives = 166/288 (57.64%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++++  +  W  ++Q I++ AS    +  C++++  +N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P+ E    I    N K+     L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 MEKEFEQIDKSGSWAAIYQDIRHEAS----DFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLT----LISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Match: sp|P20417|PTN1_RAT (Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ptpn1 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.521e-50
Identity = 103/288 (35.76%), Postives = 165/288 (57.29%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++++     W  ++Q I++ AS    +  C+I++  +N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P+ E    +    N K+     L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 MEKEFEQIDKAGNWAAIYQDIRHEAS----DFPCRIAKLPKNKNRNRYRDVSPFDHSRIKLHQE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQKEEKEMVFDDTNLKLT----LISEDVKSYYTVRQLELENLATQEAREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Match: sp|P17706|PTN2_HUMAN (Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.287e-50
Identity = 135/457 (29.54%), Postives = 220/457 (48.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFXXXXXXXXXXDTVYYQISDEYDESDLSDTSHSDNYFSN---FYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRKMKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEI--NNNYHWSLFIVGGAI 1512
            + +ERE++EL     W  L+ +I+N +     +   ++++  ENR +N+YR++ PYD++R+ L  +    +DYINASLV I+  +RSYI+TQ P   T   FWLMVW  K+  +++L    E ES     Y+P  + ++  + T      FS+KLL     + +    L+L N+ +     + HF +  WPD   P+   SFL  L  VR+   L+    PA+IHCSAG GRSGTF L+D  ++ MEK    D++ I  ++  +R  RMG++ +  QL+FSY AIIE  K  K   + Q     L  +D                           +S  +D S   +   ++ Y  N     ++ + G++    S+  + +  +N   + R +I   RK    Q + ++ + L E   KR R +   P  + +     I       W+LF    A+
Sbjct:    3 TTIEREFEELDTQRRWQPLYLEIRNESH----DYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAE---NDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG-----FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG---DDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKED---------------------------LSPAFDHS--PNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL 415          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Match: sp|P35821|PTN1_MOUSE (Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus OX=10090 GN=Ptpn1 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.648e-50
Identity = 103/288 (35.76%), Postives = 164/288 (56.94%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E+E++E+     W  ++Q I++ AS    +  CK+++  +N+ +N+YR++ P+D++RI L +    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS G+++L    E  S     Y+P+ E    +      K+     L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    3 MEKEFEEIDKAGNWAAIYQDIRHEAS----DFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLHQE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLKCAQYWPQQEEKEMVFDDTGLKLT----LISEDVKSYYTVRQLELENLTTKETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Match: Q6GMA0 (Tyrosine-protein phosphatase non-receptor type OS=Xenopus laevis OX=8355 GN=ptpn1 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 4.251e-54
Identity = 111/289 (38.41%), Postives = 172/289 (59.52%), Query Frame = 1
Query:  178 NLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            ++E+E+ E   N+GW  ++Q+I+N AS    +  CK++R +EN+ +N+YR++ P+D++RI L R    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS+G+++L    E  S     Y+PK E++  +    + K+     LL     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTF L D  +L M+K     ++EI  ++ E+R  RMG++ +  QL+FSY A+IE  K
Sbjct:    4 DMEKEFHEADRNSGWGSIYQEIRNQAS----DFPCKVARLQENKARNRYRDVSPFDHSRIKLHRE---DNDYINASLIKVEEAQRSYILTQGPLPNTCGHFWEMVWEQKSIGVVMLNRVIEKGSIKCAQYWPKKEDNPMVFDDSDLKLT----LLSEDIKSYYTIRQLMLENLSTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEHGPIVVHCSAGIGRSGTFSLADTCLLLMDKRKDPSSVEIKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAK 281          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Match: A0A139WLR4 (Tyrosine-protein phosphatase non-receptor type 61F-like Protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC003328 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.429e-53
Identity = 110/313 (35.14%), Postives = 182/313 (58.15%), Query Frame = 1
Query:  178 NLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRS--EENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAH 1092
            N+E EY +L   N W+ +FQKI++ +    + N    + +   +N+  N+YR++ PYD++RI+L R S   +DYINA+L+K++K  R YI+TQ P   T   FWLMVW   S  +++L    E + E    Y+P      YI + ++  +  +++ +E    + + QR LRL ++ T    D+  F +  WPD   P    +FL  L  VR   +L+    PA++HCSAG GRSGTFCL+D  ++ MEK+  L+++++  ++ E+R  RMG++ +  QL+FSY+AIIE  KQ    P +    ++++ D++  
Sbjct:    6 NIESEYSKLNSKNEWSAIFQKIRSES----VKNSSPYTEALKPQNKNLNRYRDVSPYDHSRIVLKRGS---TDYINANLIKVEKANRQYILTQGPLCNTVSHFWLMVWEQHSKAVLMLNKLVEKKQEKCYQYWPSKVGPDYIMTMED--VGLTLEYVEQQDHSYYLQRVLRLTDISTKESRDILQFHYTTWPDFGVPSSPTAFLEFLRKVRDAGVLEPTVGPAVVHCSAGIGRSGTFCLVDSCLVLMEKF-GLNSVDVKEILCEMRSYRMGLIQTPEQLRFSYQAIIEGAKQL-LNPDSSPTENHIIVDNEPE 307          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Match: K7IW23 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.174e-53
Identity = 112/294 (38.10%), Postives = 168/294 (57.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKF 1038
            SN+E EY E+   N W +L Q I++  S    N  C+ S+  ENR  N+YR++ PYD+ RI+L R      DYINA+LV++D+  R YI+TQ P   T   FWLMVW   S  II+L    E    +   Y+P  + +L  ++     +   ++ +   +S+ +  R LRL ++ET+   D+ HF +  WPD   P+   +FL  L  VR    LD    P I+HCSAG GRSGTFCL+D  ++ +E+ + L+++ +  ++ E+R  RMG++ +  QL+FSY AIIE  KQ   
Sbjct:   12 SNVETEYLEINSKNAWGILDQYIRDECS--NYNYSCEESKKPENRTFNRYRDVSPYDHTRIILKRGP---CDYINANLVRMDRANRQYILTQGPLPNTAGHFWLMVWEQNSKAIIMLNKVIEKNRLKCHQYWP--QENLSDQTMMYPDVDLKVEYISKTSSSDYTTRTLRLTDVETNESRDILHFHYTTWPDFGVPQSPTAFLRFLADVRHSGALDQNVGPPIVHCSAGIGRSGTFCLVDTCLVLVEE-NGLNSVNVREVLLEMRKSRMGLIQTPDQLRFSYAAIIEGSKQLPL 297          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Match: A0A232FPK1 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_007063 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.219e-53
Identity = 112/294 (38.10%), Postives = 168/294 (57.14%), Query Frame = 1
Query:  175 SNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKF 1038
            SN+E EY E+   N W +L Q I++  S    N  C+ S+  ENR  N+YR++ PYD+ RI+L R      DYINA+LV++D+  R YI+TQ P   T   FWLMVW   S  II+L    E    +   Y+P  + +L  ++     +   ++ +   +S+ +  R LRL ++ET+   D+ HF +  WPD   P+   +FL  L  VR    LD    P I+HCSAG GRSGTFCL+D  ++ +E+ + L+++ +  ++ E+R  RMG++ +  QL+FSY AIIE  KQ   
Sbjct:   12 SNVETEYLEINSKNAWGILDQYIRDECS--NYNYSCEESKKPENRTFNRYRDVSPYDHTRIILKRGP---CDYINANLVRMDRANRQYILTQGPLPNTAGHFWLMVWEQNSKAIIMLNKVIEKNRLKCHQYWP--QENLSDQTMMYPDVDLKVEYISKTSSSDYTTRTLRLTDVETNESRDILHFHYTTWPDFGVPQSPTAFLRFLADVRHSGALDQNVGPPIVHCSAGIGRSGTFCLVDTCLVLVEE-NGLNSVNVREVLLEMRKSRMGLIQTPDQLRFSYAAIIEGSKQLPL 297          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Match: A0A1L8ELE6 (Tyrosine-protein phosphatase non-receptor type OS=Xenopus laevis OX=8355 GN=ptpn1 PE=3 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.251e-53
Identity = 110/289 (38.06%), Postives = 171/289 (59.17%), Query Frame = 1
Query:  178 NLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            ++E+E+ E   N+ W   +Q+I+N AS    +  CK++R +EN+ +N+YR++ P+D++RI L R    ++DYINASL+K++  +RSYI+TQ P   T   FW MVW  KS+G+++L    E  S     Y+PK E++  +    + K+     LL     + +  R+LRL NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL D  +L M+K     +++I  ++ E+R  RMG++ +  QL+FSY A+ E  K
Sbjct:    2 DMEKEFHEADRNSSWGSKYQEIRNQAS----DFPCKVARLQENKARNRYRDVSPFDHSRIKLHRE---DNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSIGVVMLNRVIEKGSIKCAQYWPKKEDNSMVFDDSDLKLT----LLSEDIKSYYTIRQLRLENLSTQETREILHFHYTTWPDFGVPESPASFLNFLLKVRESGSLNPEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKQVLLEMRNYRMGLIQTADQLRFSYLAVTEGAK 279          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Match: ptpn2b (tyrosine-protein phosphatase non-receptor type 2 [Source:NCBI gene;Acc:103047208])

HSP 1 Score: 180.644 bits (457), Expect = 5.402e-51
Identity = 107/314 (34.08%), Postives = 171/314 (54.46%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVI 1098
            ++ E+ ++     W+ L+ +I+N +       EC  K+++  ENR +N+YR++ P+D++R+ L  S    +DYINASLV+++  +RSYI+TQ P R T   FWLM+W   +  +I+L    E  SE    Y+P  E  +  R T      F ++LL     + +  R L L N  T    D++HF +  WPD   P+   SFL  L  VR+   L     PA++HCSAG GRSGTF L+D  ++ M+K     +++I  ++ ++R  RMG++ +  QL+FSY A++E  K      + Q     L  +D+  V 
Sbjct:    1 MDHEFQDIDSEGRWHNLYMEIRNQS------QECPFKVAKYPENRNRNRYRDVSPFDHSRVKLGSS---ENDYINASLVEMEEAQRSYILTQGPLRNTCGHFWLMIWEQNTKAVIMLNRVIEKGSEKCAQYWPTQEEQMSFRDTR-----FVVRLLSEDVKSYYTIRLLELQNANTGETRDVYHFHYTTWPDFGVPESPASFLNFLFKVRESGSLGADNGPAVVHCSAGIGRSGTFSLVDTCLVLMDKRKDPSSVDIKKVLLDMRKYRMGLIQTPDQLRFSYMAVLEGAKYIMGDSSVQKQWQELSKEDQERVC 300          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Match: ptpn2b (tyrosine-protein phosphatase non-receptor type 2 [Source:NCBI gene;Acc:103047208])

HSP 1 Score: 179.874 bits (455), Expect = 8.857e-51
Identity = 107/314 (34.08%), Postives = 171/314 (54.46%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVI 1098
            ++ E+ ++     W+ L+ +I+N +       EC  K+++  ENR +N+YR++ P+D++R+ L  S    +DYINASLV+++  +RSYI+TQ P R T   FWLM+W   +  +I+L    E  SE    Y+P  E  +  R T      F ++LL     + +  R L L N  T    D++HF +  WPD   P+   SFL  L  VR+   L     PA++HCSAG GRSGTF L+D  ++ M+K     +++I  ++ ++R  RMG++ +  QL+FSY A++E  K      + Q     L  +D+  V 
Sbjct:    1 MDHEFQDIDSEGRWHNLYMEIRNQS------QECPFKVAKYPENRNRNRYRDVSPFDHSRVKLGSS---ENDYINASLVEMEEAQRSYILTQGPLRNTCGHFWLMIWEQNTKAVIMLNRVIEKGSEKCAQYWPTQEEQMSFRDTR-----FVVRLLSEDVKSYYTIRLLELQNANTGETRDVYHFHYTTWPDFGVPESPASFLNFLFKVRESGSLGADNGPAVVHCSAGIGRSGTFSLVDTCLVLMDKRKDPSSVDIKKVLLDMRKYRMGLIQTPDQLRFSYMAVLEGAKYIMGDSSVQKQWQELSKEDQERVC 300          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Match: ptpn2a (tyrosine-protein phosphatase non-receptor type 2-like [Source:NCBI gene;Acc:103041465])

HSP 1 Score: 180.259 bits (456), Expect = 1.056e-50
Identity = 105/289 (36.33%), Postives = 163/289 (56.40%), Query Frame = 1
Query:  184 EREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            + E++++     W  L+ +I+N +       EC  K+++  ENR +N+YR++ PYD++R+ L  S    +DYINASL+ +D  +RSYI+TQ P R T   FWLM+W  +S  +I+L    E  +E    Y+P  E     R  D     F + L+     + +  R L+L N +T    D++HF +  WPD   P+   SFL  L  VR+   L+    PA++HCSAG GRSGTF L+D  ++ MEK     +++I  ++ ++R  RMG++ +  QL+FSY AI E  K
Sbjct:    3 QEEFEDIDSPGQWQNLYNEIRNQS------QECSFKVAKFPENRNRNRYRDVSPYDHSRVRLENS---ENDYINASLINVDDAQRSYILTQGPLRNTCGHFWLMIWEQRSKAVIMLNRVVEKGAEKCAQYWPSNEE----RQMDFSDTGFVVTLVSEDDKSYYTIRVLKLQNSKTGEIRDIYHFHYTTWPDFGVPESPASFLNFLFKVRESGSLEPENGPAVVHCSAGIGRSGTFSLVDTCLVLMEKKKDPSSVDIQKILLDMREYRMGLIQTPDQLRFSYMAINEGAK 278          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Match: ptpn1 (protein tyrosine phosphatase non-receptor type 1 [Source:NCBI gene;Acc:103032056])

HSP 1 Score: 179.489 bits (454), Expect = 5.588e-50
Identity = 103/288 (35.76%), Postives = 159/288 (55.21%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E E+ E+  +  WN ++Q+I+  +S       C+I++  ENR +N+YR++ P+D++RI L   S   +DYINASL+ ++  +RSYI+TQ P   T   FW MVW   + G+++L    E  S     Y+P+ E     R    Q   F + L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL D  +L M       ++ I  ++ ++R  RMG++ +  QL+FSY A+IE  K
Sbjct:    1 MEAEFREIDESGNWNAIYQEIRQQSS----ELPCRIAKLPENRSRNRYRDVSPFDHSRIPLQLGS---NDYINASLISMEEAQRSYILTQGPLPNTCGHFWEMVWEQGTRGVVMLNRVIEKGSVKCAQYWPQKEE----REAIFQDTNFKLTLISEDVKSYYTVRQLELENLSTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGCLNSEHGPVVVHCSAGIGRSGTFCLADTCLLLMSLRKDPSSVRIKDVLLDMRRYRMGLIQTADQLRFSYLAVIEGAK 277          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Match: ptpn1 (protein tyrosine phosphatase non-receptor type 1 [Source:NCBI gene;Acc:103032056])

HSP 1 Score: 140.969 bits (354), Expect = 6.598e-35
Identity = 86/236 (36.44%), Postives = 125/236 (52.97%), Query Frame = 1
Query:  343 DYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            D++RI L   S   +DYINASL+ ++  +RSYI+TQ P   T   FW MVW   + G+++L    E  S     Y+P+ E     R    Q   F + L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+    P ++HCSAG GRSGTFCL D  +L M       ++ I  ++ ++R  RMG++ +  QL+FSY A+IE  K  
Sbjct:  403 DHSRIPLQLGS---NDYINASLISMEEAQRSYILTQGPLPNTCGHFWEMVWEQGTRGVVMLNRVIEKGSVKCAQYWPQKEE----REAIFQDTNFKLTLISEDVKSYYTVRQLELENLSTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGCLNSEHGPVVVHCSAGIGRSGTFCLADTCLLLMSLRKDPSSVRIKDVLLDMRRYRMGLIQTADQLRFSYLAVIEGAKSI 631          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Match: ptpn2b (protein tyrosine phosphatase non-receptor type 2b [Source:ZFIN;Acc:ZDB-GENE-030909-8])

HSP 1 Score: 142.124 bits (357), Expect = 7.884e-39
Identity = 92/259 (35.52%), Postives = 135/259 (52.12%), Query Frame = 1
Query:  268 MNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEE---SESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVY----HDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYH-SLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAI 1011
            M   CK ++  EN  +N+YR++ P+D++R+ L R    + DYINASLV++ +  RSYI+ Q P   T   FW MVW  KS  I++L    E    + E Y+PK   D      D+     S+ LL    +  F  R+L+L  L           + HF +  WPD   P+    FL  L  VR    L     P ++HCSAG GRSGTFCL+D  +  +E+    L   ++  ++ ++R  RMG++ +  QL+FSY AI
Sbjct:   21 MEKTCKAAKRPENSRRNRYRDVSPFDHSRVRLQRG---DGDYINASLVQVPQAQRSYILAQAPLPNTCGHFWQMVWEQKSRAIVMLNRTVENNVKKCEKYWPK-RRDAPKSFRDS-----SVTLLGEERTPFFTVRELQLHFLPVRACAGETRKVLHFHYTMWPDFGVPESPTHFLDFLFRVRASASLSPELGPLVVHCSAGIGRSGTFCLVDTCLALVERTREGLVPPDVRQVLLQMRHARMGLIQTPEQLRFSYLAI 270          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 122.479 bits (306), Expect = 1.413e-29
Identity = 88/298 (29.53%), Postives = 145/298 (48.66%), Query Frame = 1
Query:  172 ESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLP--RSSYFNSDYINASLVKI--DKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAI---IEAFKQF 1032
            ES+L++ Y++     G   L  + K   + K+ N + +      N  KN+  +I+PYD+NR+++P  R   F +DYIN S +     K +++  Q P  +T + FW MVW ++S  I++L   EE   E    Y+P      Y        II  +K    H S  +  R   + N   +    +  F F  WP+   P+     ++L+  V++Q       +P  +HCSAGAGR+GTFC    L   +E+  +   L++   ++ LR QR  MV ++ Q +F Y+ +   IEAF  +
Sbjct:  463 ESHLQKLYNK-NTPTGCTGLEDEFKKLTTVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEF-TDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITY------GDIIIELKQENSHDS--YTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQ-QHTGNHPITVHCSAGAGRTGTFC---ALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAFSDY 746          

HSP 2 Score: 103.99 bits (258), Expect = 1.180e-23
Identity = 83/294 (28.23%), Postives = 137/294 (46.60%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRI-LLPRSSYFNSDYINASLVKI--DKRSYIVTQYPS---RTRDLFWLMVWHFKSLGIILLGNFEE---SESESYFPK----TENDLYIRSTDNQKII-FSIKLLEMHTSNGFYQRKL-RLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            LE E++    ++  N LF++  N+     +   C+ +  EEN+ KN+Y  I+PYD  R+ L       +SDYINAS V    +K  +I  Q       T + +W M+W   +  I+++ N +E    +   Y+P     T  +L +   D   ++ ++I+   +        +K  RL             F F  WPD   P      L  L  V+  N   Y   P ++HCSAG GR+GTF +ID ++  ++    +D   + G +  +R QR  MV + +Q  F Y+A++E
Sbjct:  172 LEEEFNRRSADD--NKLFREEFNSLPSCPIQATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLIT----------QFHFTSWPDFGVPFAPIGMLKFLKKVKTCN-PPY-AGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVD---VFGFVTRIRAQRCQMVQTDMQYVFIYQALLE 448          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009934.1 (pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene:ENSPMAG00000008984.1 transcript:ENSPMAT00000009934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.094 bits (305), Expect = 2.736e-29
Identity = 88/317 (27.76%), Postives = 144/317 (45.43%), Query Frame = 1
Query:  115 DRFYNIFYFLNMIDNLEFH--ESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKR----SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLG---NFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            D  Y        I+ L+ H  +   E+E+  LC              N + +   + C ++ + ENR +N+YR ++P+D  R+ L   S    DYINAS V +       +Y+  Q P   T   FW MVW  ++  + +L        ++   Y+P++      RS   +   + + L +  T   F  R + +  LET +   +   +F  WPDH AP      +  L   R+   L  P  P + HCSAG GRSG    +D ++  ++  H L+   I+ ++ E+R QR GMV ++ Q  F Y+A +E  +  K
Sbjct:  765 DSIYTGAKLEAFINKLQEHIAQQGPEKEFQRLC--------------NLTPR---DGCLVASAVENRDRNRYRNVLPFDATRVAL---SGREDDYINASHVALRAGDAALAYVACQGPLPHTAAHFWQMVWEQRARVLAMLTLETELGRAKCHRYWPES------RSRATEVGPYRLVLEQQQTLKSFCIRVIMITKLETGIRQRVTQLQFTQWPDHGAPASAGPLVRFLRFARR---LQEP-GPLVTHCSAGVGRSGALICLDAVLAHID--HGLE-FNIADIVREMRTQRYGMVQTLEQYIFCYKAALETLQYLK 1048          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006520.1 (pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 gene:ENSPMAG00000005841.1 transcript:ENSPMAT00000006520.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 1.901e-28
Identity = 91/306 (29.74%), Postives = 152/306 (49.67%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASF--------KMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKI----DKRSYIVTQ--YPSRTRDLFWLMVWHFKSLGIILLGNFEE----SESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRK-LRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLL---GTVRQQ--NILDY--PENPA-IIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            ++ E  ++ M+    +L ++++    F        K    +C  +   EN  +N+++++VPY+ NRI L  S    + Y+NAS +++    ++  YI TQ   PS  +D FW MVW  + + +I +   EE    S+S  Y+PK  +     +    K+    +     T  G Y    L+L +L       +WH ++  WPDH  P  +  FL  L    +VR+   N+L+   P NP  ++HCSAG GR+G   L +++I  +E    LD   +  ++  LR QRM MV +I Q  F Y+A+I+
Sbjct:  879 VKEEPPKVPMDERCKMLQERLEQGMVFTEYERVLKKRAQADCSTATLSENHDRNRFKDVVPYEENRIELLPSKDNPTGYVNASRIQVTVSGEEWHYIATQGPLPSTCQD-FWQMVWE-EGVNVIAMVTQEEEGGKSKSHRYWPKLGSRHSAVTYGKFKVTTKFR-----TDFGCYATTGLKLKHLLDGHERTVWHLQYTDWPDHGCPDHVQGFLGYLEEIKSVRRHTNNMLEASKPANPPVVVHCSAGVGRTGVVILTEMMIACLEHNEKLD---VPDVLAILRTQRMLMVQTITQYTFVYQALIQ 1174          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 117.087 bits (292), Expect = 1.107e-27
Identity = 85/262 (32.44%), Postives = 134/262 (51.15%), Query Frame = 1
Query:  259 FKMMNNECKISRSEENRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKIDKRS--YIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYP-ENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            F+  +    +++ +ENR KN+Y  I+ YD++R++L       NSDYINA+ V    R+  YI TQ P   T   FW M+W  +S  II++ N  E    +   Y+P   +D+Y        I  ++   EM +   +  R  R+     +   ++  F F  WPDH  P   Y    LL  +R+   LD P   P ++HCSAGAGR+G + +ID+++   E    +D   I   + ELR +R+ MV +  Q  F ++A++EA
Sbjct:  926 FEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDG-SDVY------GDIKVTLADTEMLSE--YIIRTFRVERAGQEDIREVRQFHFTGWPDHGVP---YHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVID---IYNCVRELRTRRVNMVQTEEQYVFIHDAMLEA 1172          

HSP 2 Score: 48.9062 bits (115), Expect = 2.970e-6
Identity = 51/212 (24.06%), Postives = 93/212 (43.87%), Query Frame = 1
Query:  232 FQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPK--TENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNL--ETDVYHDLWHFEFWPWPDHR-APKCLYSFLTLLGTV---RQQNILDYPENPAIIHC 834
            FQ + N  +  +   +C I+    N  KN+Y +++P D     L   +  +S+YINA+L+   ++  ++IVTQ+P   T   FW +V+ +    I++L    E +S  Y P+   E  +             ++ +  +       R  R+ N+    D    +  F +  WP  R  P   +SFL L+      R++  +D      ++HC
Sbjct: 1208 FQTL-NMVTPPLRVEDCSIALLPRNHEKNRYHDVLPPDRCLPFLITINGDSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVML---NELDSNKYCPQYWPEEGMLCHGP------IQVEFVAFNMEGDIITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMD---GRTVVHC 1406          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 86.6557 bits (213), Expect = 5.424e-19
Identity = 84/284 (29.58%), Postives = 122/284 (42.96%), Query Frame = 1
Query:  286 ISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVK-------IDKRSYIVTQYPSR-TRDLFWLMVWH---FKSLGIILLGNFEESESES---YFPKTENDLYIR--------STDNQKIIFS----IKLLEMHTSNGFYQR---KLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLI--------LKMEKYHSLDNLE------ISGMIEELRVQRMGMVHSIVQLKFSYEA 1008
            +S    N  +N+Y  I+PY+ NR+ L   S   +DYINAS VK       I+   YI TQ P+R T D FW M +H     ++ I+++    E   E    Y+P+   D  +R           N    F     I+ + +H    +Y     KL   +        + HF F  W D   P+ +   + L       + L+   NP I+HCSAG GR+GTF  +D L+        +     HS    E      I  ++ +LR QRM MV +  Q  F Y A
Sbjct:   46 VSIEPRNDARNRYVNIMPYERNRVHLKTLS--GNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCA---HSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 54.299 bits (129), Expect = 3.909e-8
Identity = 32/86 (37.21%), Postives = 46/86 (53.49%), Query Frame = 1
Query:  817 PAIIHCSAGAGRSGTFCLIDLL--ILKMEKYHSLDNLEISGM--------IEELRVQRMGMVHSIVQLKFSYEAIIEAF---KQFK 1035
            P ++HCSAG GR+G F  +D L  IL     HS + +++  M        + ELR QR+ MV ++ Q    YEA++  F   KQ K
Sbjct:  661 PLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHS-NKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYFALQKQIK 745          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 50.8322 bits (120), Expect = 4.444e-7
Identity = 43/147 (29.25%), Postives = 68/147 (46.26%), Query Frame = 1
Query:  655 RKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQN-ILD------YPEN---PAI-IHCSAGAGRSGTFCLIDLLILKMEKYHSLDNL------------EISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            RK+ L   + +  ++L   +   WPD      L + +++L  +  +N I+D      Y +N   P I +HCSAG GR+GT C ID ++   E +  L                IS  I   R QR+ MV +I Q  F Y+ ++  F+
Sbjct:  737 RKILLTYHDQEKPYELLQIQVKNWPDLGT---LLNPISILQAINVKNHIIDTLFARNYYQNDQLPTILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLLFYFR 880          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Match: EDO41632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S419])

HSP 1 Score: 134.035 bits (336), Expect = 5.975e-36
Identity = 84/250 (33.60%), Postives = 135/250 (54.00%), Query Frame = 1
Query:  289 SRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDK--RSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            ++   NR  N+YR+++PYD++RI+L  S+   +DYINA+LV+  +  + YI+ Q P   T D FW MVW   S  +I+L    E    +   Y+P  E   ++   +     F IK +  + S  F  R L L N +T     ++H+ +  WPD   PK    FL+ L   R   +L     PA+IHCSAG GRSGTF +ID ++ ++    +L+ +++   +   R  R+G++ +  QL+F+  AI+E 
Sbjct:    1 AKLPANRPLNRYRDVLPYDHSRIIL-ESTQNGTDYINANLVEFPELGKRYILAQGPLPHTADHFWQMVWENNSKAVIMLNKVMEKNQIKCFQYWPCGERYAHVNCLELDS--FQIKYITENRSEEFTVRILELENKKTKETRVVYHYHYLTWPDFGVPKAPGYFLSFLFECRNAGVLSSDVGPAVIHCSAGIGRSGTFVMIDSILAEVST-GNLNAVDLGERLLAARQYRVGLIQTPDQLRFTSIAILEG 246          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 120.168 bits (300), Expect = 2.186e-30
Identity = 76/264 (28.79%), Postives = 129/264 (48.86%), Query Frame = 1
Query:  271 NNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKI----DKRSYIVTQ--YPSRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKII----FSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
             + C   +++ N  KN+YR ++PY+  R+ L  SS    DYINA+ +++    D   YI TQ   P+ T+D FW M+W  + + ++ +   ++        K +   Y     NQ +     F + LL+    + F QR + + +L++    ++ H  F  WPDH  P+     +  +  +R    L   + P ++HCSAG GR+G    +D+ +  ME+    D   I+  I +LR QR GM+ +  Q  F Y+A +E  K  
Sbjct:   45 TDGCDSGKNQANTDKNRYRNVLPYEATRVRLSGSS--GEDYINANHIRVLVDDDTYHYIATQGPLPNTTKD-FWQMIWE-QGVEVVAMVTLDKEGG-----KVKCHRYWPDNTNQPLKLGGRFEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPRSPVEMVQFVAYMRS---LATSQAPVVVHCSAGIGRTGALIAVDVALGLMERDKPFD---INQTIRDLREQRQGMIQTKDQYIFCYKACLEVLKSL 293          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Match: EDO48358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD7])

HSP 1 Score: 116.316 bits (290), Expect = 1.168e-28
Identity = 84/292 (28.77%), Postives = 147/292 (50.34%), Query Frame = 1
Query:  169 HESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEE--NRFKNKYREIVPYDYNRILLPR-SSYFNSDYINASLVKIDKRS--YIVTQYP-SRTRDLFW-LMVWHFKSLGIILLGNFE--ESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            H+S+LE   +     NG+   FQ++KN +S +  +     +  E+  NR KN+Y++I+PYDY+RI+LP       SDYIN + +K   ++  Y+  Q P  +T D FW +M+ H   + ++    +E  + + + Y+P++  +    +    KI       E    +GF  R L +   +T   H++  F +  WPDH  P+     + L  + R    +   + P ++HCSAG GR+GT C +D     ++   + + L +  ++  LR QR+ MV +  Q    Y+A+ E
Sbjct:    7 HKSSLEPRNNPQG-ENGFAKEFQELKNISSRQKRDKAFSTNHGEKEYNRTKNRYKDILPYDYSRIVLPEIKGVDGSDYINGNYIKGPTKNIMYLAAQGPLPKTVDDFWRMMISHNIQVVVMACREYELGKLKCKRYWPESMEETLTFA--GMKISLES---EEAMGDGFTVRTLAVQAGKTK--HNVTQFHYTAWPDHDVPRSATPLIELTRSFR--TFVGSQDTPVLVHCSAGCGRTGTICALDYARTLLQTGRT-EELSVFDIVANLRRQRVAMVQTKEQYTLVYKAVEE 287          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 119.783 bits (299), Expect = 3.045e-28
Identity = 86/259 (33.20%), Postives = 130/259 (50.19%), Query Frame = 1
Query:  289 SRSEENRFKNKYREIVPYDYNRILLPRSSYFN----SDYINASLVK--IDKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLY----IRSTDNQKII-FSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEA 1020
            S+ E N+ KN+Y  I  YD++R+   R SY N    SDYINA+       +R+YI TQ P   T   FW MVW  ++  I++L   EE    + + Y+P    D+Y    +   D  ++  ++I  L++        R+++             HF+F  WPDH  P     FL  L  V+  N  D    P ++HCSAG GR+G F +ID ++ ++    ++D   I G +  LR QR  MV +  Q  FS++AI+EA
Sbjct: 1338 SQMECNKGKNRYPNIHAYDHSRV---RLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTISTLQICKEGASQPREVK-------------HFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPD--AGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVD---IYGHVTVLRTQRNYMVQTQEQYIFSHDAILEA 1575          

HSP 2 Score: 101.293 bits (251), Expect = 2.565e-22
Identity = 74/247 (29.96%), Postives = 114/247 (46.15%), Query Frame = 1
Query:  304 NRFKNKYREIVPYDYNRI-LLPRSSYFNSDYINASLVKIDKRS--YIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQF 1032
            NR KN+   I+PY+  R+ + P      SDYINAS +   ++   +I TQ P + T D FW M+    S  I++L    E E E  +     D   RS  +Q  I  +  +  H    F  R  ++ +  +D   ++  F F  WP+   PK     + L+G V++       E P  +HCS G GR+G F     L + +E+  S   +++   ++ LR QR  MV S  Q  F Y+  +E    F
Sbjct: 1631 NRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTD---RSARHQYYI--VDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFT---ALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYLGSF 1869          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 111.694 bits (278), Expect = 1.934e-27
Identity = 85/295 (28.81%), Postives = 137/295 (46.44%), Query Frame = 1
Query:  160 LEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSS-YFNSDYINASLVK-IDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEE---SESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHT-SNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            +E H SN  R      +N  W  L        +++   +   + + ++N  KN+Y +++PYD+NR+ L  ++    SDYINAS +   D R  +YI TQ P + T   FW MVW    + I+ L    +    +   Y+P+  ++ Y         I+ + L+  H   + +  R   L NL+T     +  F F  WPD   P      L     V +         P ++HCS G GR+G + LIDL++ KM +      ++I+  +E LR QR  MV +  Q +F+  A+ E
Sbjct:   21 MEDHLSNKNR------LNKEWEAL-------CNYEAEPSVADLGKQDKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFITDHDPRNPAYIATQGPLAHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHETYH--------IYEVHLVSEHIWCDDYLVRSFYLKNLQTSETRTVTQFHFLSWPDLNVPTTPKPLLEFRRKVNK--CFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMR--GAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAVAE 290          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Match: ptpn1 (protein tyrosine phosphatase non-receptor type 1 [Source:NCBI gene;Acc:101171745])

HSP 1 Score: 182.185 bits (461), Expect = 2.807e-51
Identity = 105/292 (35.96%), Postives = 163/292 (55.82%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFP-KTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            +E E+ E+  N  WN ++Q+I+  +        CKI++  EN+ +N+YR++ P+D++RI L   +   +DYINASL+ ++  +R+YI+TQ P   T   FW MVW  +S G+++L    E  S     Y+P K E D     T+     F + L+     + +  R+L L NL T    ++ HF +  WPD   P+   SFL  L  VR+   L+  + P ++HCSAG GRSGTFCL+D  +L M       ++ I  ++ E+R  RMG++ +  QL+FSY A+IE  K  K
Sbjct:    1 MEAEFLEIDENGSWNAIYQEIRQQSC----ELPCKIAKLPENKNRNRYRDVSPFDHSRICLQLGA---NDYINASLITVEEAQRNYILTQGPLPSTCGHFWEMVWEQRSRGVVMLNRVIEKGSIKCAQYWPYKEEKDAIFEDTN-----FKLTLVSEDVKSYYTIRQLELENLSTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGCLNSDQGPVVVHCSAGIGRSGTFCLVDTCLLLMSLRKDPSSVRIRDVLLEMRRYRMGLIQTADQLRFSYLAVIEGAKYIK 280          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Match: ptpn2b (tyrosine-protein phosphatase non-receptor type 2 [Source:NCBI gene;Acc:101158780])

HSP 1 Score: 178.333 bits (451), Expect = 4.158e-50
Identity = 104/310 (33.55%), Postives = 173/310 (55.81%), Query Frame = 1
Query:  151 IDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESE---SYFPKTE-NDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQ 1053
            +++ E     +++++D++     W  L+ +I+N +      +EC  K+++  ENR +N+YR++ P+D++R+ L  +    +DYINASLV ++  +RSYI+TQ P R T   FWLM+W  K+  +I+L    E  SE    Y+P  E  ++  + T      F + L+     + +  R L L NL T     ++HF +  WPD   P+   SFL  L  VR+   L+    PA++HCSAG GRSGTF L+D  ++ MEK     +++I  ++  +R  RMG++ +  QL+FSY A++E  K  +   + Q
Sbjct:    1 MEHTEVASVKMDKDFDDIDSEGRWRKLYSEIRNQS------HECSYKVAKYPENRNRNRYRDVSPFDHSRVKLENT---ENDYINASLVVMEEAQRSYILTQGPLRNTCGHFWLMIWEQKTKAVIMLNRVIEKGSEKCAPYWPTAEEKEMAFKDT-----CFLVTLISEDIKSYYTTRILELQNLSTGEKRKIYHFHYTTWPDFGVPESPASFLNFLFKVRESGALEVDHGPAVVHCSAGIGRSGTFSLVDTCLVLMEKRKEPFSVDIKSILLNMREYRMGLIQTPDQLRFSYMAVLEGAKLIRGDASIQ 296          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Match: ptpn2b (tyrosine-protein phosphatase non-receptor type 2 [Source:NCBI gene;Acc:101158780])

HSP 1 Score: 178.333 bits (451), Expect = 4.168e-50
Identity = 104/310 (33.55%), Postives = 173/310 (55.81%), Query Frame = 1
Query:  151 IDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNEC--KISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYPSR-TRDLFWLMVWHFKSLGIILLGNFEESESE---SYFPKTE-NDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQ 1053
            +++ E     +++++D++     W  L+ +I+N +      +EC  K+++  ENR +N+YR++ P+D++R+ L  +    +DYINASLV ++  +RSYI+TQ P R T   FWLM+W  K+  +I+L    E  SE    Y+P  E  ++  + T      F + L+     + +  R L L NL T     ++HF +  WPD   P+   SFL  L  VR+   L+    PA++HCSAG GRSGTF L+D  ++ MEK     +++I  ++  +R  RMG++ +  QL+FSY A++E  K  +   + Q
Sbjct:    1 MEHTEVASVKMDKDFDDIDSEGRWRKLYSEIRNQS------HECSYKVAKYPENRNRNRYRDVSPFDHSRVKLENT---ENDYINASLVVMEEAQRSYILTQGPLRNTCGHFWLMIWEQKTKAVIMLNRVIEKGSEKCAPYWPTAEEKEMAFKDT-----CFLVTLISEDIKSYYTTRILELQNLSTGEKRKIYHFHYTTWPDFGVPESPASFLNFLFKVRESGALEVDHGPAVVHCSAGIGRSGTFSLVDTCLVLMEKRKEPFSVDIKSILLNMREYRMGLIQTPDQLRFSYMAVLEGAKLIRGDASIQ 296          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Match: ptpn2a (tyrosine-protein phosphatase non-receptor type 2 [Source:NCBI gene;Acc:101161671])

HSP 1 Score: 176.022 bits (445), Expect = 3.618e-49
Identity = 105/288 (36.46%), Postives = 165/288 (57.29%), Query Frame = 1
Query:  181 LEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID--KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESES---YFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +E E+ ++  + GW  L+ +I+N AS     +  K+++  EN+  N+YR++ PYD++R+ L  S    +DYINASLV  +  +RSYI++Q P   T   FWLM+W  +S  +I+L    E  SE    Y+P T+ +  +  TD     F +KLL     + F  R L L N +T    +++HF +  WPD   P+   SFL  L  VR+   L     P ++HCSAG GRSGTF L+D  ++ M+K  +  +++I  ++ ++R  RMG++ +  QL+FSY A+IE  K
Sbjct:    1 MEEEFQDIDSSAGWQNLYNEIRNLAS----EHPYKVAKLPENKNLNRYRDVSPYDHSRVTLKDS---ENDYINASLVTEEEAQRSYILSQGPLCYTCGHFWLMIWEQRSKAVIMLNRVIEKGSEKCAQYWP-TKEESQMSFTDTG---FVVKLLSEEDQSYFTVRVLELHNTKTMERREIYHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSTDHGPPVVHCSAGIGRSGTFALVDTCLVLMDKRKNPSSVDIQKVLLDMRKYRMGLIQTADQLRFSYMAVIEGAK 277          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Match: ptprn2 (protein tyrosine phosphatase receptor type N2 [Source:NCBI gene;Acc:101159780])

HSP 1 Score: 125.946 bits (315), Expect = 6.773e-30
Identity = 97/300 (32.33%), Postives = 150/300 (50.00%), Query Frame = 1
Query:  148 MIDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILL-PRSSYFNSDYINAS-LVKIDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEE---SESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHT-SNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPEN-PAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            M D+L+ +++ LERE++ LC                S++   + C + + E+N  +N+   +V YD++RI L   +++ NSDYINAS ++  D R  +YI  Q P + T   FW MVW    + I++L    E    +   Y+P   +D+Y         I+ + L+  H     F  R   L NL+T+    +  F F  W D   P    S  TLL   R+ N      + P I+HCS GAGRSGT+ LID+++ +M K      ++I+  +E LR QR GMV    Q +F+  A+ E
Sbjct:  785 MEDHLK-NKNRLEREWEALC----------------SYQAEPSACSVGQGEQNSKRNRSDGVVAYDHSRITLKAENNHGNSDYINASPIMDHDPRNPTYIAAQGPLASTVADFWQMVWESGCVVIVMLTPLSENGVKQCHHYWPDEGSDVYH--------IYEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWMDRGIP---TSARTLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYILIDMVLNRMAK--GAKEIDIAATLEHLRDQRAGMVQIKEQFEFALTAVAE 1054          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Match: SMESG000018862.1 (SMESG000018862.1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 468/470 (99.57%), Postives = 468/470 (99.57%), Query Frame = 1
Query:  148 MIDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKRSYIVTQYPSRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFXXXXXXXXXXDTVYYQISDEYDESDLSDTSHSDNYFSNFYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRKMKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEINNNYHWSLFIVGGAIFVMGACLLIKYNPFK 1557
            MIDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKRSYIVTQYPSRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFSSSSSESAASDTVYYQISDEYDESDLSDTSHSDN FSNFYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRKMKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEINNNYHWSLFIVGGAIFVMGACL IKYNPFK
Sbjct:    1 MIDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKRSYIVTQYPSRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHVINKYELFSSSSSESAASDTVYYQISDEYDESDLSDTSHSDNLFSNFYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRKMKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEINNNYHWSLFIVGGAIFVMGACLWIKYNPFK 470          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Match: SMESG000002519.1 (SMESG000002519.1)

HSP 1 Score: 158.688 bits (400), Expect = 1.610e-43
Identity = 96/297 (32.32%), Postives = 156/297 (52.53%), Query Frame = 1
Query:  172 ESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID----KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTE----NDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +SN+E++YD++     W ++   ++  +     +   + +R+ +N+ +N+YR+++PYD  R++L  +   +SDYINAS V +      R YI+TQ P   T   FW MVW   S  I++L    E ++     YFP TE    N LY        +  S+ L+E   +  + +R   L N +T     +  F +  WPD   P     FL  L  VR    L+    PAI+HCSAG GRSGTF LIDL +L++ + ++   L +   + +LR  R+G++ +  QL+F+Y ++I   K
Sbjct:    7 KSNVEQQYDDIENKKLWKIVLMSLREESDKLTKSETFEHARNNQNKSRNRYRDVLPYDSTRVILTETG--SSDYINASYVNLANNKFGRKYILTQGPLGSTVSHFWYMVWQENSNCIVMLNKVLEKDTIKCAQYFPTTESENENHLY------SDVELSVSLIESTVNKSYIKRVFNLQNFKTQENRKIIQFHYQSWPDFGVPISSELFLQFLWDVRASGGLNDTNKPAIVHCSAGIGRSGTFVLIDLSLLQIAEENTTKFLNLQQTLIQLRQCRIGLIQTAEQLRFAYYSVIIGAK 295          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Match: SMESG000002519.1 (SMESG000002519.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.085e-42
Identity = 96/297 (32.32%), Postives = 156/297 (52.53%), Query Frame = 1
Query:  172 ESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRSEENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKID----KRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESES---ESYFPKTE----NDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFK 1026
            +SN+E++YD++     W ++   ++  +     +   + +R+ +N+ +N+YR+++PYD  R++L  +   +SDYINAS V +      R YI+TQ P   T   FW MVW   S  I++L    E ++     YFP TE    N LY        +  S+ L+E   +  + +R   L N +T     +  F +  WPD   P     FL  L  VR    L+    PAI+HCSAG GRSGTF LIDL +L++ + ++   L +   + +LR  R+G++ +  QL+F+Y ++I   K
Sbjct:    7 KSNVEQQYDDIENKKLWKIVLMSLREESDKLTKSETFEHARNNQNKSRNRYRDVLPYDSTRVILTETG--SSDYINASYVNLANNKFGRKYILTQGPLGSTVSHFWYMVWQENSNCIVMLNKVLEKDTIKCAQYFPTTESENENHLY------SDVELSVSLIESTVNKSYIKRVFNLQNFKTQENRKIIQFHYQSWPDFGVPISSELFLQFLWDVRASGGLNDTNKPAIVHCSAGIGRSGTFVLIDLSLLQIAEENTTKFLNLQQTLIQLRQCRIGLIQTAEQLRFAYYSVIIGAK 295          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 122.094 bits (305), Expect = 9.859e-29
Identity = 86/276 (31.16%), Postives = 132/276 (47.83%), Query Frame = 1
Query:  298 EENRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKIDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVY---HDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHV 1095
            + N+ KN+Y  +V YD+  +LL P      SDYINA+ +   +R  +YI TQ P   T D FW MVW  +S  I+++   EE    +   Y+P      Y      Q I+  I    +     +Y   +RLF +    Y    ++ HF+F  WPDH  PK     L  +  VR  +I      P I+HCSAG GR+G F ++D    ++E+     N+++   + ++R QR  MV +  Q +F  E ++EA +          N   + C+  AHV
Sbjct:  809 DSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICY-----GQMIVSHIDTFVL----AYYT--IRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVR--SIGKIESCPKIVHCSAGVGRTGAFIVVD---AQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDG--------NTEVMACNFHAHV 1060          

HSP 2 Score: 103.605 bits (257), Expect = 8.968e-23
Identity = 74/278 (26.62%), Postives = 138/278 (49.64%), Query Frame = 1
Query:  214 NGWNVLFQKIKNNASFK-----MMNNECKISRSEE-NRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKI--DKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIE 1017
            +G+ + F K+ + AS +     M+ +  K + ++  N  KN+ R I+PY++NR++L        SDYINAS +    D+R+YI  Q P   T + FW M+W      +I+L    E +S  Y+P  ++  Y          F +  +  +    +  R+ ++ +     +  L  F+F  WP+H  PK   S L  +  V +         P +IHC+ G+GR+G F  + +++ ++++   +D  +    ++ L  QR+G+V +  Q +F Y A+++
Sbjct: 1075 SGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQ--------FFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQ---TVKLLHKQRIGLVQTEEQYEFCYMAVLD 1341          
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 121.709 bits (304), Expect = 1.664e-28
Identity = 87/279 (31.18%), Postives = 133/279 (47.67%), Query Frame = 1
Query:  289 SRSEENRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKIDKR--SYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEES---ESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVY---HDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPTAQLNGSYLLCDDKAHV 1095
            S  + N+ KN+Y  +V YD+  +LL P      SDYINA+ +   +R  +YI TQ P   T D FW MVW  +S  I+++   EE    +   Y+P      Y      Q I+  I    +     +Y   +RLF +    Y    ++ HF+F  WPDH  PK     L  +  VR  +I      P I+HCSAG GR+G F ++D    ++E+     N+++   + ++R QR  MV +  Q +F  E ++EA +          N   + C+  AHV
Sbjct: 1301 SNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICY-----GQMIVSHIDTFVL----AYYT--IRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVR--SIGKIESCPKIVHCSAGVGRTGAFIVVD---AQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDG--------NTEVMACNFHAHV 1555          

HSP 2 Score: 103.219 bits (256), Expect = 1.485e-22
Identity = 74/284 (26.06%), Postives = 140/284 (49.30%), Query Frame = 1
Query:  214 NGWNVLFQKIKNNASFK-----MMNNECKISRSEE-NRFKNKYREIVPYDYNRILL-PRSSYFNSDYINASLVKI--DKRSYIVTQYP-SRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQKIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPKCLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKMEKYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFK 1035
            +G+ + F K+ + AS +     M+ +  K + ++  N  KN+ R I+PY++NR++L        SDYINAS +    D+R+YI  Q P   T + FW M+W      +I+L    E +S  Y+P  ++  Y          F +  +  +    +  R+ ++ +     +  L  F+F  WP+H  PK   S L  +  V +         P +IHC+ G+GR+G F  + +++ ++++   +D  +    ++ L  QR+G+V +  Q +F Y A+++    ++
Sbjct: 1570 SGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQ--------FFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQ---TVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 1842          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPN21.690e-5136.45protein tyrosine phosphatase non-receptor type 2 [... [more]
PTPN11.866e-5135.76protein tyrosine phosphatase non-receptor type 1 [... [more]
PTPN23.226e-5136.45protein tyrosine phosphatase non-receptor type 2 [... [more]
PTPN24.763e-5129.54protein tyrosine phosphatase non-receptor type 2 [... [more]
PTPN27.408e-4734.38protein tyrosine phosphatase non-receptor type 2 [... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-31.327e-2932.19Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.598e-2932.19Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.634e-2932.65Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.656e-2932.65Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.669e-2931.96Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp61F8.418e-4635.36gene:FBgn0267487 transcript:FBtr0072717[more]
Ptp61F9.808e-4635.36gene:FBgn0267487 transcript:FBtr0072718[more]
Ptp61F2.630e-4537.25gene:FBgn0267487 transcript:FBtr0072716[more]
Ptp61F2.037e-2833.86gene:FBgn0267487 transcript:FBtr0072719[more]
Ptp61F2.037e-2833.86gene:FBgn0267487 transcript:FBtr0310161[more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn2b3.575e-4834.36protein tyrosine phosphatase non-receptor type 2b ... [more]
ptpn2a2.434e-4232.87protein tyrosine phosphatase non-receptor type 2a ... [more]
ptpn2a2.525e-4232.75protein tyrosine phosphatase non-receptor type 2a ... [more]
ptpn16.893e-3035.45protein tyrosine phosphatase non-receptor type 1 [... [more]
ptpra7.984e-3027.53protein tyrosine phosphatase receptor type A [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cybrd12.262e-5338.63cytochrome b reductase 1 [Source:Xenbase;Acc:XB-GE... [more]
psmd84.426e-5132.79proteasome 26S subunit, non-ATPase 8 [Source:Xenba... [more]
cybrd11.916e-5038.52cytochrome b reductase 1 [Source:Xenbase;Acc:XB-GE... [more]
psmd89.384e-4633.13proteasome 26S subunit, non-ATPase 8 [Source:Xenba... [more]
cfap1611.324e-2928.23cilia and flagella associated protein 161 [Source:... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptpn13.786e-5135.76protein tyrosine phosphatase, non-receptor type 1 ... [more]
Ptpn21.804e-5036.52protein tyrosine phosphatase, non-receptor type 2 ... [more]
Ptpn22.309e-5036.52protein tyrosine phosphatase, non-receptor type 2 ... [more]
Ptpn29.226e-5036.52protein tyrosine phosphatase, non-receptor type 2 ... [more]
Ptprs8.103e-3130.99protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13016|PTN1_CHICK6.505e-5135.64Tyrosine-protein phosphatase non-receptor type 1 O... [more]
sp|P18031|PTN1_HUMAN8.960e-5135.76Tyrosine-protein phosphatase non-receptor type 1 O... [more]
sp|P20417|PTN1_RAT1.521e-5035.76Tyrosine-protein phosphatase non-receptor type 1 O... [more]
sp|P17706|PTN2_HUMAN2.287e-5029.54Tyrosine-protein phosphatase non-receptor type 2 O... [more]
sp|P35821|PTN1_MOUSE2.648e-5035.76Tyrosine-protein phosphatase non-receptor type 1 O... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q6GMA04.251e-5438.41Tyrosine-protein phosphatase non-receptor type OS=... [more]
A0A139WLR41.429e-5335.14Tyrosine-protein phosphatase non-receptor type 61F... [more]
K7IW232.174e-5338.10Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
A0A232FPK12.219e-5338.10Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A1L8ELE62.251e-5338.06Tyrosine-protein phosphatase non-receptor type OS=... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn2b5.402e-5134.08tyrosine-protein phosphatase non-receptor type 2 [... [more]
ptpn2b8.857e-5134.08tyrosine-protein phosphatase non-receptor type 2 [... [more]
ptpn2a1.056e-5036.33tyrosine-protein phosphatase non-receptor type 2-l... [more]
ptpn15.588e-5035.76protein tyrosine phosphatase non-receptor type 1 [... [more]
ptpn16.598e-3536.44protein tyrosine phosphatase non-receptor type 1 [... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn2b7.884e-3935.52protein tyrosine phosphatase non-receptor type 2b ... [more]
ptpra1.413e-2929.53protein tyrosine phosphatase receptor type A [Sour... [more]
ENSPMAT00000009934.12.736e-2927.76pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene... [more]
ENSPMAT00000006520.11.901e-2829.74pep scaffold:Pmarinus_7.0:GL476919:12935:65469:-1 ... [more]
ptprk1.107e-2732.44protein tyrosine phosphatase receptor type K [Sour... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP15.424e-1929.58Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP23.909e-837.21Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP34.444e-729.25Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO416325.975e-3633.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383042.186e-3028.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483581.168e-2828.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469613.045e-2833.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489491.934e-2728.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpn12.807e-5135.96protein tyrosine phosphatase non-receptor type 1 [... [more]
ptpn2b4.158e-5033.55tyrosine-protein phosphatase non-receptor type 2 [... [more]
ptpn2b4.168e-5033.55tyrosine-protein phosphatase non-receptor type 2 [... [more]
ptpn2a3.618e-4936.46tyrosine-protein phosphatase non-receptor type 2 [... [more]
ptprn26.773e-3032.33protein tyrosine phosphatase receptor type N2 [Sou... [more]
back to top
BLAST of Tyrosine-protein phosphatase non-receptor type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018862.10.000e+099.57SMESG000018862.1[more]
SMESG000002519.11.610e-4332.32SMESG000002519.1[more]
SMESG000002519.11.085e-4232.32SMESG000002519.1[more]
SMESG000053906.19.859e-2931.16SMESG000053906.1[more]
SMESG000053906.11.664e-2831.18SMESG000053906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006117 ID=SMED30006117|Name=Tyrosine-protein phosphatase non-receptor type|organism=Schmidtea mediterranea sexual|type=transcript|length=1670bp
AAGAATTTGAATTTACTAATTTACATAATATGAATATGATTTCTATAAAT
TTCTAATTAATTTTTATCCCAAAATTTGCACAAATAACGAATTTTTAATT
GTATATAAAGAATTGATCGCTTCTATAATATTTTCTATTTTTTAAATATG
ATTGACAACTTAGAATTTCATGAATCTAATCTAGAAAGAGAGTATGATGA
ATTATGCATGAATAACGGATGGAATGTTTTATTTCAAAAAATTAAAAACA
ATGCATCATTCAAAATGATGAATAACGAATGCAAAATTTCTCGATCGGAA
GAAAATCGATTTAAAAATAAATACCGGGAAATTGTACCATATGATTATAA
TAGAATTTTATTGCCCAGATCATCTTATTTTAATTCTGACTATATAAACG
CCTCTTTAGTTAAAATTGATAAACGAAGTTACATTGTAACTCAATATCCT
TCAAGAACTCGAGACCTTTTTTGGTTGATGGTTTGGCATTTTAAATCTCT
CGGTATTATATTATTGGGAAATTTTGAAGAATCGGAATCTGAATCATATT
TCCCAAAGACCGAAAACGACCTATATATTAGATCGACTGATAATCAAAAA
ATAATATTTTCAATAAAACTTTTAGAAATGCACACATCTAATGGATTTTA
TCAAAGAAAATTAAGGCTTTTTAATTTGGAAACTGACGTATATCATGACC
TGTGGCATTTTGAGTTTTGGCCTTGGCCTGATCACAGGGCTCCCAAATGT
TTATATTCATTTCTCACTCTTTTGGGAACTGTTCGTCAACAGAATATACT
CGATTATCCAGAAAATCCAGCTATCATTCATTGTTCAGCTGGAGCTGGTC
GAAGCGGCACATTTTGTTTAATCGATTTATTGATATTAAAAATGGAAAAA
TATCACAGTCTGGATAACTTGGAAATATCAGGAATGATTGAAGAATTGCG
AGTGCAAAGAATGGGAATGGTTCATTCTATAGTTCAATTAAAATTTAGTT
ATGAAGCTATCATTGAAGCGTTTAAACAATTTAAATTTCAACCAACTGCT
CAATTAAATGGATCATATCTACTCTGTGATGATAAAGCTCACGTTATCAA
TAAATATGAGCTCTTTTCATCATCTAGCAGTGAGAGTGCGGCTTCTGATA
CCGTATATTATCAAATAAGCGATGAATATGATGAAAGTGATCTTTCCGAC
ACATCTCATTCTGATAACTATTTTAGCAATTTCTATAAAGATTCTGTGGA
TGGAAATCAAAATATGTCAAACTCAAACATACAAGAACTAAGTTATAACG
ACAATGAAATATTGAGCAATCGAGATCAGATCATTTCCCAAAGAAAAATG
AAGAATCAACAAAACATTGATAGACTGTCAAAACATCTTGAAGAAACAAA
TATGAAACGGTTTCGACTTATTTCAAATATTCCCAGTTCCTCCACAATAT
CTTTATTTGACGAAATCAACAATAATTATCACTGGTCATTGTTTATTGTA
GGTGGGGCAATTTTCGTCATGGGTGCTTGTTTGTTGATCAAATATAACCC
TTTCAAATGAAACTGTTTGATTGTAATATTTTGCATTTTTATGTATGAAT
ATTAGTTAATTAAAGGTTTTGTGAATATATGATTTGAATTTGAAGGCAAA
TATTATTAGATCAATACATT
back to top

protein sequence of SMED30006117-orf-1

>SMED30006117-orf-1 ID=SMED30006117-orf-1|Name=SMED30006117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MIDNLEFHESNLEREYDELCMNNGWNVLFQKIKNNASFKMMNNECKISRS
EENRFKNKYREIVPYDYNRILLPRSSYFNSDYINASLVKIDKRSYIVTQY
PSRTRDLFWLMVWHFKSLGIILLGNFEESESESYFPKTENDLYIRSTDNQ
KIIFSIKLLEMHTSNGFYQRKLRLFNLETDVYHDLWHFEFWPWPDHRAPK
CLYSFLTLLGTVRQQNILDYPENPAIIHCSAGAGRSGTFCLIDLLILKME
KYHSLDNLEISGMIEELRVQRMGMVHSIVQLKFSYEAIIEAFKQFKFQPT
AQLNGSYLLCDDKAHVINKYELFSSSSSESAASDTVYYQISDEYDESDLS
DTSHSDNYFSNFYKDSVDGNQNMSNSNIQELSYNDNEILSNRDQIISQRK
MKNQQNIDRLSKHLEETNMKRFRLISNIPSSSTISLFDEINNNYHWSLFI
VGGAIFVMGACLLIKYNPFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 81..88
score: 65.66
coord: 258..273
score: 30.96
coord: 183..200
score: 35.13
coord: 224..242
score: 59.97
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 24..293
e-value: 1.0E-68
score: 244.3
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 53..290
e-value: 1.5E-49
score: 168.7
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 12..291
score: 36.411
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 184..290
e-value: 8.9E-29
score: 111.6
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 5..304
e-value: 1.8E-65
score: 223.1
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 11..296
NoneNo IPR availablePANTHERPTHR46047FAMILY NOT NAMEDcoord: 11..422
NoneNo IPR availableCDDcd14608PTPc-N1coord: 25..293
e-value: 9.11639E-63
score: 203.333
NoneNo IPR availableTMHMMTMhelixcoord: 444..466
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 227..237
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 203..282
score: 17.102