Calcium activated potassium channel subunit

Overview
NameCalcium activated potassium channel subunit
Smed IDSMED30006112
Length (bp)1331
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium activated potassium channel subunit (SMED30006112) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium activated potassium channel subunit (SMED30006112) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium activated potassium channel subunit (SMED30006112) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium activated potassium channel subunit (SMED30006112) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006112

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30006112h1SMcG0005093 SmedASXL_061484SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30006112h1SMcG0005093 dd_Smed_v4_12880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006112h1SMcG0005093 dd_Smed_v4_12880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30006112h1SMcG0005093 dd_Smed_v4_12880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30006112h1SMcG0005093 dd_Smed_v6_12880_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium activated potassium channel subunit vs. Ensembl Xenopus
Match: dnajc1 (DnaJ heat shock protein family (Hsp40) member C1 [Source:Xenbase;Acc:XB-GENE-950431])

HSP 1 Score: 51.2174 bits (121), Expect = 6.627e-7
Identity = 52/192 (27.08%), Postives = 82/192 (42.71%), Query Frame = 2
Query:  593 FLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCS-TSPCHLLLSDNIDWVISFDRTLYSK---HNFSCYYNT-KDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDV 1153
             + SG I   IL    L P L E + +   C    S  +     +    C ++C K T  +PC+ + VN    NS     QD                +CS   PC      N + V+S+     ++     F+CY+N  +    VLL + + +S++LHC LWP   F+VG++ +  T + A C   K E +
Sbjct:   24 LIISGVISLFILGFCWLHPALLEMQGKTANCTVL-SVQQIGETFECTFSCGSEC-KGTSLYPCLQIYVNNSESNSRALLHQD--------ERQLISNPKCSYIPPCERENQKNSENVLSWQEYWNNEIGFQTFTCYFNKHRRPEDVLLRRTHDESVLLHCFLWPLVTFMVGVLIVVLT-ICAKCLAVKAEAI 204          
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Match: Kcnmb3 (potassium large conductance calcium-activated channel, subfamily M, beta member 3 [Source:MGI Symbol;Acc:MGI:3612244])

HSP 1 Score: 51.2174 bits (121), Expect = 8.247e-7
Identity = 50/185 (27.03%), Postives = 84/185 (45.41%), Query Frame = 2
Query:  578 LSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSP-CHLLLSDNIDWVISFDRTLYSKHN---FSCYYNTKDHMSVLLYKLYPKSLILHCILWPF-----GIFIVGLVGIT 1105
            L  +  + S  ++  +L   +L P++     E++ C   ++      L D    CE  C +D G+ PC+ + VN  + +SGQ+ L       +Y         +C  +P CH    D ++ V+  D   +  HN   F C+Y+    + V+L K   K ++ HC+ WP      G  IVGLV +T
Sbjct:   52 LLGVAMMASSVLMFFLLGTTVLKPFMLRSPREESNCTTVHTHIVDDGL-DFSFTCEGSC-QDHGRSPCLQVFVN--LSHSGQKVL------LHYDDEAIRTNPKCFYTPKCHGDRDDLLNSVL--DIKEFFDHNNGTFPCFYSPDGPLGVVLRKSGHK-VVFHCLFWPLLTLLGGALIVGLVRLT 223          
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Match: sp|A7VL23|KCMB3_RAT (Calcium-activated potassium channel subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Kcnmb3 PE=2 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 6.809e-6
Identity = 47/183 (25.68%), Postives = 82/183 (44.81%), Query Frame = 2
Query:  578 LSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTC--VYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPF-----GIFIVGLVGIT 1105
            L  +  + S  ++  +L   +L P++     E++ C  V+ + +  ++   D    CE  C +  G +PC+ + VN  + +SGQ+ L              +   +C     HLL S  +D    FD   ++   F C+Y+    + V+L K   K ++ HC+ WP      G  IVGLV +T
Sbjct:   52 LLGIAMMASSVLMFFLLGTTVLKPFMLSSPREESNCTTVHTHIADDWL---DFAFTCEGSC-QGQGTYPCLQVFVN--LSHSGQKVLLHYDEEAIRTNPKCFYTPKCHGDRDHLLNS-ALDIKEFFD---HNNGTFPCFYSPDGPLGVVLRKSGHK-VVFHCLFWPLLTLLGGALIVGLVRLT 223          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A4Z2CW83 (Calcium-activated potassium channel subunit beta-2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007000 PE=4 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 2.419e-30
Identity = 71/199 (35.68%), Postives = 114/199 (57.29%), Query Frame = 2
Query:  566 KLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWK-NEDVVI 1159
            K+IYL+  T +T+ FI+ECIL+HL++ PY  E  F  T C + ++   +I+ +D+  +CENKC+KD  KFPC+ ++V Y+  N     +    L+D   TYN YK   C+TS CH    DN +WV  F R +  + +F CY +       LLYK Y  + + H + WP  +F++  + +    ++  C VW  ++DV++
Sbjct:   23 KIIYLTCATVITTTFIVECILIHLVVQPYFHESAFTHTNCSFLHA---YIVRTDV--KCENKCSKDRSKFPCLKVIVQYLSGNKNHTVI----LFDNIATYNHYKLLGCATSACHHRDMDNTEWVEKFQRRIRLQRHFRCYVHATHEDEALLYKFYTFTSVFHAVFWPISLFLISSICLLLIYIMDKCRVWTGDQDVIV 212          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A5K4F4V2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 1.644e-29
Identity = 71/199 (35.68%), Postives = 109/199 (54.77%), Query Frame = 2
Query:  566 KLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWK-NEDVVI 1159
            K+IYL+  T +T+ FI+ECIL+HL++ PY  E  F  T C + ++           ++CENKC+KD  KFPC+ ++V Y+  N     +    L+D   TYN YK   C+TS CH    DN +WV  F + +  +H F CY +T      LLYK Y  + + H I WP  +F++  + +    +   C VW  ++DV++
Sbjct:   20 KIIYLTCATIMTTTFIIECILIHLVVQPYFHESAFTHTNCTFVHAH-----YVRKDVKCENKCSKDRSKFPCLKVIVQYLNGNKNHTVI----LFDNIATYNHYKFLGCATSACHHRDMDNTEWVEKFQQRIKHQHYFQCYIHTIHEDEALLYKFYTFTSVFHSIFWPIILFLLSFICLYIIYIFDKCHVWTGDQDVIV 209          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: G7YF65 (Calcium-activated potassium channel subunit beta-2 OS=Clonorchis sinensis OX=79923 GN=CLF_106446 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 2.256e-29
Identity = 67/198 (33.84%), Postives = 109/198 (55.05%), Query Frame = 2
Query:  566 KLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVI 1159
            K++YL+  T +T+ FI+ECIL HL++ PYL E  F  T C Y ++      + +  ++CEN+C+KD  +FPC+ +LV Y    +    +    L+D   TY++YK   C+TS CH   +DN  +V+ F+  +  +++F CY ++      LL K Y    + H I WP G+F   +  + F  L+  C VW  +  +I
Sbjct:   18 KVLYLTCATVITTTFIVECILAHLVVQPYLHESAFTLTNCSYVHAH-----IVNHAVKCENRCSKDRSRFPCLQVLVRYTSRGANHTVI----LFDNIATYHQYKAFGCATSSCHHRDADNTAYVLRFEHRIKHRNHFECYIHSVHENEALLTKFYSAKTLFHVIFWPVGLFFTSIACVLFAYLVDRCRVWTGDQSMI 206          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A4S2KQU4 (Uncharacterized protein (Fragment) OS=Opisthorchis felineus OX=147828 GN=CRM22_010674 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.403e-29
Identity = 68/203 (33.50%), Postives = 111/203 (54.68%), Query Frame = 2
Query:  551 ETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVI 1159
              G  K++YL+  T +T+ FI+ECIL HL++ PYL E  F  T C Y ++      + +  ++CEN+C+KD  +FPC+ +LV Y    +    +    L+D   TY++YK   C+TS CH   +DN  +V+ F+  +  +++F CY ++      LL K Y    + H I WP G+F+  +  + F  L+  C VW  +  +I
Sbjct:   48 RVGCLKVLYLTCATVITTTFIVECILAHLVVQPYLHESAFTLTNCSYVHAH-----IVNHAVKCENRCSKDRSRFPCLQVLVRYTSRGANHTVI----LFDNIATYHQYKAYGCATSSCHHRDADNTAYVLRFEHRIKHRNHFECYIHSVHENEALLTKFYSARTLFHVIFWPVGLFLTSIACVLFAYLVDRCRVWTGDQSMI 241          
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Match: A0A4E0RIE4 (Calcium activated potassium channel subunit OS=Fasciola hepatica OX=6192 GN=D915_001494 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 7.216e-29
Identity = 69/198 (34.85%), Postives = 104/198 (52.53%), Query Frame = 2
Query:  566 KLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVI 1159
            K  YL+  T +T+ FI+ECIL+HL++ PY+ E  F  T+C Y +S      +    ++CENKC+KD  +FPC+ +LV+Y         +    LYD   TY  YK   C+TS CH   +DN  WV  F   +  + +F CY +       LL+K Y  + + H + WP  +F   LV ++   ++  C VW  +  VI
Sbjct:   20 KFTYLTCATVITTSFIIECILVHLVVQPYIHESAFSHTSCTYLHSD-----IIRQNVKCENKCSKDRSRFPCLKVLVSYYTGGDNHTVV----LYDNIATYQHYKYLGCATSSCHHRDTDNTAWVDQFRLRVQHQKHFGCYIHATHEDEALLFKFYSTNTVFHAVFWPVSLFCTSLVCVSCAYVVDRCRVWTGDQSVI 208          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000053268.1 (SMESG000053268.1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.252e-148
Identity = 218/218 (100.00%), Postives = 218/218 (100.00%), Query Frame = 2
Query:  509 MEKNFNGVLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA 1162
            MEKNFNGVLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGYLYDYYRTYNRYKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA
Sbjct:    1 MEKNFNGVLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGYLYDYYRTYNRYKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA 218          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000032303.1 (SMESG000032303.1)

HSP 1 Score: 158.303 bits (399), Expect = 8.366e-46
Identity = 90/213 (42.25%), Postives = 135/213 (63.38%), Query Frame = 2
Query:  530 VLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSS--SRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA 1162
             L   CN  GISK+ YL+S T  T+G I+ECILL+L++ PYL+EQ++  TTC Y   S   + IL      +CENKCTK+T  F C+++ V+Y   +S  +QL  GYL+D  RT++++K  +CST PC  LL DN  W ++F+ +LY +  F C+Y   +  +VLLYKL   +++++CI+WP  +  +GL+ +  T   AGC +W  +  VIA
Sbjct:    5 ALDKICNYYGISKVTYLASATLFTAGLIIECILLYLVVIPYLSEQKYINTTCHYTEGSKIGKMILK-----KCENKCTKETSFFYCLFIKVSYKKIHS--KQLTIGYLFDNLRTFSKHKVDKCSTMPCLGLLEDNRRWAMAFNESLYRRTYFQCFYKDDETTNVLLYKLQSPTIVMNCIVWPCTLLTLGLISLFLTWYCAGCKIWSQDKTVIA 210          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000017226.1 (SMESG000017226.1)

HSP 1 Score: 127.872 bits (320), Expect = 3.553e-34
Identity = 74/199 (37.19%), Postives = 108/199 (54.27%), Query Frame = 2
Query:  566 KLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA 1162
            K+IYL+S++   S FI+ CIL+HL++ PYL E  F    C    +      + D ++RCENKC+KD  KF C+ ++VNY   N    ++   YLY++  T   + K  C+TSPCH    DN   V  F+R +  + NF+C+ + K     LLYK Y  S  LHC LWP  + +     +T    I  C VW ++  VI+
Sbjct:   40 KIIYLASISIFVSTFIVVCILMHLVIIPYLHETSFISAQCNLNETR-----MGD-EVRCENKCSKDRSKFKCLQIIVNYRRNN----KMFSAYLYEHVATLRHFSKNHCATSPCHKEEIDNYLIVSRFNRDIKRQRNFNCFTSIKHPSEALLYKFYDASTFLHCTLWPLLLIVSSATSLTVIYQIDKCRVWHDDRTVIS 228          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000055809.1 (SMESG000055809.1)

HSP 1 Score: 105.916 bits (263), Expect = 3.098e-26
Identity = 73/211 (34.60%), Postives = 105/211 (49.76%), Query Frame = 2
Query:  557 GISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNS----GQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWV-----ISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKNEDVVIA 1162
             + K +Y+SS++   SGFI+ECILLHL+++PY  E +F    C   N S+R+       ++C NKC+K+  KF C  + V Y    S      +    GYL+D   T + +K ++C  SPC+ L  DN         + FD  L S   F CY N      VLLYK Y     + CILWP  + ++ +  I     I  C VW N+  +I 
Sbjct:   11 SVLKFLYISSLSVAVSGFIIECILLHLIISPYGHETQFVDGKCTVLNISTRY------GIKCVNKCSKERSKFFCSTVKVKYQSKISLGRLSNQTWYHGYLFDQITTLHNFKDEKCIISPCYKLKLDNYIETRNFLHVHFDH-LESNSAFPCYVNRYLTNEVLLYKFYSYETYISCILWPITLIVLSVFIILLCYWIDRCKVWANDKAIIT 214          
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Match: SMESG000047387.1 (SMESG000047387.1)

HSP 1 Score: 96.6709 bits (239), Expect = 4.861e-23
Identity = 62/205 (30.24%), Postives = 100/205 (48.78%), Query Frame = 2
Query:  530 VLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLAEQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVIPNSGQRQLQDGXXXXXXXXXXXXKKQRCSTSPCHLLLSDNIDWVISFDRTLYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITFTALIAGCDVWKN 1144
            ++   C +  + K +Y+S  T      I+  IL+HL++ P+  E  F  +TC   N++          ++CENKC+KD   FPC+ +   Y   +  Q  L   Y+YD+  T + Y+K +C+ SPC     DN   V  F   +     F+CY N +    VLLYK Y   +  HC+ WP G+ ++ L+ +        C+VW +
Sbjct:    3 IISKSCAQDWV-KFLYISCSTLSLCALIVGAILIHLVVIPFTHENSFYSSTCTLINTNIT------TSIKCENKCSKDRSMFPCLQITAKYT--DLDQEFL--AYVYDHIATLSHYRKSQCAISPCFSSTKDNGIIVSEFQSRMRKTPTFACYINAEHRDEVLLYKFYSIGMFWHCVAWPSGLLVISLLILAVLYSKDKCNVWND 196          
The following BLAST results are available for this feature:
BLAST of Calcium activated potassium channel subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dnajc16.627e-727.08DnaJ heat shock protein family (Hsp40) member C1 [... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Kcnmb38.247e-727.03potassium large conductance calcium-activated chan... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|A7VL23|KCMB3_RAT6.809e-625.68Calcium-activated potassium channel subunit beta-3... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CW832.419e-3035.68Calcium-activated potassium channel subunit beta-2... [more]
A0A5K4F4V21.644e-2935.68Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
G7YF652.256e-2933.84Calcium-activated potassium channel subunit beta-2... [more]
A0A4S2KQU42.403e-2933.50Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4E0RIE47.216e-2934.85Calcium activated potassium channel subunit OS=Fas... [more]
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium activated potassium channel subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053268.11.252e-148100.00SMESG000053268.1[more]
SMESG000032303.18.366e-4642.25SMESG000032303.1[more]
SMESG000017226.13.553e-3437.19SMESG000017226.1[more]
SMESG000055809.13.098e-2634.60SMESG000055809.1[more]
SMESG000047387.14.861e-2330.24SMESG000047387.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006112 ID=SMED30006112|Name=Calcium activated potassium channel subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1331bp
AAATTTTTTGGCAATTAGAAATCAGGAGAAAATTTTCACGAATTTTCACA
AATCTTCGATTTGGTTTTTCTATTAAAATTTCAATTGAGGTAAAAATTAT
TGATTTTTTAAAGAAAAGATTTCAAATTGTTTTTGTTTTTAATGTATGAG
TAAAATATTTAAATCATCAAGATATTCTTTGAAATCTAAAATAGGAAGAA
AAAGACAGACAAGAAAACACAACTAAACTACATCAAAAGTGATTGGATGC
CATTAAAATATCCCATTATAGCCCAGCTAATTCATCCCAGTGCAGTTCTT
TGAATTTGTATTATTCTACAATATATTGTTTGCCTCTTTGAGCTGTGTTC
TGCTTCGACTAATAATGGAATAACAATAAATCAATTAATATTCCTCATTG
ATTTTATTAATAATTTCGATTTTTTTCTATATAAAAATAATATATATATA
AATATATATTCTCTGGAATTTACTCAGTAAAACTAAAACAAAAAAATAAT
AATCTCAAATGGAAAAGAATTTTAATGGGGTGTTGCGAAACAAATGCAAC
GAAACTGGAATTAGCAAACTCATCTATTTGTCCAGCATGACATTTCTCAC
TTCTGGATTCATACTAGAATGCATTCTGTTGCACTTGATGCTGACCCCTT
ATTTGGCAGAACAGGAATTTGAACAAACTACTTGTGTTTATCGCAACTCT
TCAAGTCGCTTTATATTGCTCTCTGATCTCCAGTTGAGATGTGAAAATAA
ATGCACTAAAGATACAGGTAAATTTCCGTGCGTCTGGCTGCTTGTAAATT
ATGTCATTCCGAATTCTGGCCAACGTCAACTTCAAGATGGCTACCTTTAC
GATTATTATAGAACGTATAATCGCTACAAAAAGCAAAGATGTTCCACGAG
CCCTTGTCACTTGCTACTGTCAGATAATATAGACTGGGTTATATCATTCG
ACAGGACCTTATACAGTAAACACAATTTTTCTTGTTACTATAATACCAAA
GACCATATGTCGGTGTTGCTGTATAAGCTCTATCCAAAATCCTTGATATT
ACATTGTATATTGTGGCCGTTTGGTATATTTATTGTAGGGTTGGTAGGTA
TCACCTTCACAGCCTTGATTGCTGGCTGCGATGTATGGAAAAACGAGGAC
GTTGTTATAGCATGAGTCCTTTGTGCCTATCACATTTTTACTATGATTTA
AAGCGTTCTGTTGAGTTTTGATTCCATTATTTCATATTTTTTATTGTAGA
CAATTAATAGTACTAGTTCAATTACTCATTTTTTGGTGCATTTAGATTTT
AAAAAACTTGTTTTAATACACTATGCTCGTC
back to top

protein sequence of SMED30006112-orf-1

>SMED30006112-orf-1 ID=SMED30006112-orf-1|Name=SMED30006112-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=219bp
MEKNFNGVLRNKCNETGISKLIYLSSMTFLTSGFILECILLHLMLTPYLA
EQEFEQTTCVYRNSSSRFILLSDLQLRCENKCTKDTGKFPCVWLLVNYVI
PNSGQRQLQDGYLYDYYRTYNRYKKQRCSTSPCHLLLSDNIDWVISFDRT
LYSKHNFSCYYNTKDHMSVLLYKLYPKSLILHCILWPFGIFIVGLVGITF
TALIAGCDVWKNEDVVIA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003930K_chnl_Ca-activ_BK_bsu
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015269calcium-activated potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003930Potassium channel, calcium-activated, BK, beta subunitPFAMPF03185CaKBcoord: 34..201
e-value: 2.4E-14
score: 53.5
IPR003930Potassium channel, calcium-activated, BK, beta subunitPANTHERPTHR10258CALCIUM-ACTIVATED POTASSIUM CHANNEL SUBUNIT BETAcoord: 24..213
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 184..206