Chloride channel accessory 4

Overview
NameChloride channel accessory 4
Smed IDSMED30006106
Length (bp)3038
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chloride channel accessory 4 (SMED30006106) t-SNE clustered cells

Violin plots show distribution of expression levels for Chloride channel accessory 4 (SMED30006106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chloride channel accessory 4 (SMED30006106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chloride channel accessory 4 (SMED30006106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30006106SMESG000080916.1 dd_Smed_v4_968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006106SMESG000080916.1 dd_Smed_v4_968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006106SMESG000080916.1 dd_Smed_v6_968_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chloride channel accessory 4 vs. Ensembl Human
Match: CLCA4 (chloride channel accessory 4 [Source:HGNC Symbol;Acc:HGNC:2018])

HSP 1 Score: 173.711 bits (439), Expect = 1.186e-43
Identity = 225/877 (25.66%), Postives = 371/877 (42.30%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNP----ITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPL---------KNRLLA-FDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK-FNIVKGQTEKIVLVLDTSGSM--VNIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHIGT--HRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLAD---MSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT---IPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKR------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--------------------RADITINNTVNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQS---------NETIVIRKTAF----ANPAEKIMFEVE-LLKMNVTNPFEISVRGVDNS 2593
            NN F+DI++ I+ +V E + +++ +I D V+ AS  L++AT           F  V I +P  W    NP           +A   VA   +   ++P TKQ  +CG+ G +  F        K N+    GK F+ E+  LR+GV+ E    +P            R  A   G+N +    G        +          +C++   K Q    SIMF     +   FC++  + HN+ A +L N KCN RS   VI N +DFK+    +       F+++K     + LVLD SGSM   + +  M  A   F L++V N ++VG+V FDS+ATI++ L+ I +   R TL+  +   Y  GGT+I  G+    QV+ GE+   + + GS ++LLTDGE+N     +    I+++ +    V+ IA G+ AD   + ++KIT G++        N    D  G   S + D+S   L     E+  + L       +   ID  +G +    +T   +P   S ++ +    +N  +  + K+           I GT   G +   L++  N          R  +     ITV+AK   N++ +  PS  I  +EI +                G +      V   IES N   + L++ DNG G D+ ++D V++R   A    + G YS                     RA       VNG+I                     RT   G+ +++Q  +    D+  P++I D+     E K +L     A G++  +G +  Y I+I +         ++ + +  T      AN  E   F+ E + + N T+ F I+++ +D S
Sbjct:   28 NNGFEDIVIVIDPSVPE-DEKIIEQIEDMVTTASTYLFEATEKR------FFFKNVSILIPENWKE--NPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNE--KTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPT-YPLGGTSICSGIKYAFQVI-GEL--HSQLDGSEVLLLTDGEDN-----TASSCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGNTDLSQKSLQL---ESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIMENFTVDATSKMAY-------LSIPGTAKVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAK--MNKDVNSFPSPMIVYAEILQ----------------GYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTA--YTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIEANPPRPEIDEDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKIILT--WTAPGDNFDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATHIF-IAIKSIDKS 851          
BLAST of Chloride channel accessory 4 vs. Ensembl Human
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 156.762 bits (395), Expect = 2.227e-38
Identity = 140/471 (29.72%), Postives = 222/471 (47.13%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNTE--------------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIY---ENVKFNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQS 1567
            NN ++ I+V I+ NV E +  L+ +I D V+ AS  L +AT           F  V I +P TW   ++++ P       NA   VA      N++P T+Q+G CG+ G        F    KL +   +G+ F+ E+  LR+GV+ E     +    +G+  IQAV C   I    V  + Q     T+              C++ +   Q    SIMF     +   FC +++  HNK A N  N+KCN RS   VI + +DFK  KT+ +     N  F++++     + LVLD SGSM   N +  +  A   F L++V   ++VG+V FDS+A + + L+ I  G+ R TL + +    A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +     N++ +    ++ +A G  A   L +++  T G   +A+   Q   L   F + S
Sbjct:   29 NNGYEGIVVAIDPNVPE-DETLIQQIKDMVTQASLYLLEATGKR------FYFKNVAILIPETWKTKADYVRP-KLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGR--IQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFK--KTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLP-AAASGGTSICSGLRSAFTVIRKKYPTDGS---EIVLLTDGEDN-----TISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALS 476          
BLAST of Chloride channel accessory 4 vs. Ensembl Human
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 156.762 bits (395), Expect = 2.227e-38
Identity = 140/471 (29.72%), Postives = 222/471 (47.13%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNTE--------------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIY---ENVKFNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQS 1567
            NN ++ I+V I+ NV E +  L+ +I D V+ AS  L +AT           F  V I +P TW   ++++ P       NA   VA      N++P T+Q+G CG+ G        F    KL +   +G+ F+ E+  LR+GV+ E     +    +G+  IQAV C   I    V  + Q     T+              C++ +   Q    SIMF     +   FC +++  HNK A N  N+KCN RS   VI + +DFK  KT+ +     N  F++++     + LVLD SGSM   N +  +  A   F L++V   ++VG+V FDS+A + + L+ I  G+ R TL + +    A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +     N++ +    ++ +A G  A   L +++  T G   +A+   Q   L   F + S
Sbjct:   29 NNGYEGIVVAIDPNVPE-DETLIQQIKDMVTQASLYLLEATGKR------FYFKNVAILIPETWKTKADYVRP-KLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGR--IQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFK--KTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLP-AAASGGTSICSGLRSAFTVIRKKYPTDGS---EIVLLTDGEDN-----TISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALS 476          
BLAST of Chloride channel accessory 4 vs. Ensembl Human
Match: CLCA2 (chloride channel accessory 2 [Source:HGNC Symbol;Acc:HGNC:2016])

HSP 1 Score: 132.109 bits (331), Expect = 1.177e-30
Identity = 174/715 (24.34%), Postives = 307/715 (42.94%), Query Frame = 2
Query:  167 MKYLYICFGL---LSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW-SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNT--------ECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSG---KTSIIYENVKFNIVKGQTEKIVLVLDTSGSMV---NIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTH--RATLIREIQ-NLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGEN---NNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIE-ETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI 2230
            +K++ +   L   L F+ A   L  +N +  +L+ IN  V E N  L++ I + ++ AS  L+ AT         V F  + I +P+TW +N+ + I       A   V        + P T Q   CG  G +  F  +F     L   +  RG+ F+ E+  LR+GV+ +E   ++    +G+N I+   C +DI    V ++  C + N          C +     Q+   SIMF     +   FC+     HN+ A NL N+ C+ RS  +VI +  DF        + +     F++V+   + + LVLD S  M     +++  + A    ++ V    +VGI  FDS   I + L  I ++  R  L+  +   + A    +I  GL KG +V+  E  N       +IL+T G++    N +P         ++    T+++IA G  A  +L +++  T G  KF  P+   ++     FS+    + D   + I+ E+   N+      +N   +D  +G +    +T  A     E+ L  P  ++   +  IT  +  T S  I GT  PG +   L + T+   +       L +TV+++ S +    + P+   +  E   L     V +  ++   G     N TV   +E        L++ D+G G D I++D +++R  ++      G YS +  +
Sbjct:   13 LKFVTLLVALSSELPFLGAGVQLQ-DNGYNGLLIAINPQVPE-NQNLISNIKEMITEASFYLFNATKRR------VFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVF-DEYNNDKPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQNATASIMFMQSLSSVVEFCNA--STHNQEAPNLQNQMCSLRSAWDVITDSADFHHSFPMNGTELPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASFDSKGEIRAQLHQINSNDDRKLLVSYLPTTVSAKTDISICSGLKKGFEVV--EKLNGKAYGSVMILVTSGDDKLLGNCLP--------TVLSSGSTIHSIALGSSAAPNLEELSRLTGG-LKFFVPDISNSNSMIDAFSRISSGTGDIFQQHIQLESTGENVKPHHQLKNTVTVDNTVGNDTMFLVTWQASGPP-EIILFDPDGRKYYTNNFITNLTFRTASLWIPGTAKPGHWTYTLNN-THHSLQ------ALKVTVTSRASNSA---VPPATVEAFVERDSLHFPHPVMIYANVKQ-GFYPILNATVTATVEPETGDPVTLRLLDDGAGADVIKNDGIYSRYFFS--FAANGRYSLKVHV 691          
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 142.51 bits (358), Expect = 4.180e-34
Identity = 172/696 (24.71%), Postives = 298/696 (42.82%), Query Frame = 2
Query:  167 MKYLYICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDK-----NEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIK---WNVVKDRHQCMESNTE-------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSI-----IYENVKFNIVKGQTEKIVLVLDTSGSMV-NIIENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIG--THRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTR 2173
            ++ +++   +L    +       N + DI + I+  V E + +L+++I D V+  S  L+KA          V F  V I VP  W    N   + +    LF   +  ID       ++P T Q G+CG  G +  F  +F +  KL   +  RGK  + E+  LR+GVY E   K           I+A  C  +I+   ++V  D  Q  +++ +       C++   K Q  + S+M      +   FC  R   HN  A NL N KC+ ++   VI      K    S+           F +V+     + LVLD SGSM  + I  ++ A+  FL++ + + + V +V F + A+ LS L  I   + R  L++ + N+ A G TN+  GL  G+QVL    T++ +V+G  II LTDGE  + +       IN        ++ IA G  AD +L ++   T GK+  A+ +     L   F   S  +   +  K   +  ++ +           +D+ IG   K + TI  +     +++ +P       ++        T + ++ GT   G +   + SPT +         +L +T +++ ++     I+    ++  +  + G    +     + N   L    V   L+ ES    +  LQ+ DNG G D  +DD V++R
Sbjct:    8 LRSVFVLLWMLRLSTSTGIKLDGNGYIDITIAISSKVPEDD-KLIDKIKDMVTEGSVHLYKALDKK------VYFKEVTILVPLNW----NSKGFTKARTELFETGMIRIDNPHPAYGDEPYTNQYGECGAEGQYIHFTPNFLRDDKLIRLYGSRGKVLVHEWAHLRWGVYDEYSEKTPFYR-SASGKIEATRCSKNIEGQLYDVTADPLQPCQNDPQTSLPTDGCRFIPNKYQSTDSSMMSLPSLDSVITFC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTLSALTTIDKESTRENLVKLLPNV-AEGATNMCKGLNLGLQVLK---TDNQDVLGDEIIFLTDGEATDTLSNCVPAAIN----SGAIIHTIALGDKADKALREMADKTGGKFITASDDVLSNQLLNGF--SSLIMPTGNQTKDPVQIDSVGIKTSDWFNGTVSVDQTIGT--KTSFTITYETKLPRISIQSPSGLTYSQTQMRHDEPAKTVTLKVPGTAQTGDWKYSILSPTLQ---------SLTVTATSQAARANVPPITVKAQMN-QQFSD-GSKPMIVFAEVVQNYKPLIKAEVWATLESESGT--VHELQLLDNGAGADTFKDDGVYSR 664          
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 125.946 bits (315), Expect = 6.836e-29
Identity = 174/712 (24.44%), Postives = 292/712 (41.01%), Query Frame = 2
Query:  182 ICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNAL---FFVAVDNID--KNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVK----DRHQC------MESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILN---HKDFKSGKTSIIYENVK--FNIVKGQTEKIVLVLDTSGSMVN---IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGT-----HRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGT--------------TFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTR 2173
            + + LL +      LD    + DI + I   V++ +  L+++I + V++ S  L+ A          V      I VPS WS          C+ A    F  A   ID  K  +P TK  G+CG  G +  F   F     LND+       RGK F+ E+  LR+GVY E   +      +G+      C  +I+  + +        C         +++CK+   K+Q+ + S+MF         FC  R   HN  A    N  CN ++   VI      KD  S    +        F +++ +   + L+LD SGSM     I+   + AT      V   A VGIV+F ++A+I+S L  I +     H   L+ E       G TN+ +GL  G+QVL     +D + IG  II LTDG+  +++       I   I     ++ IA    A  +L ++   T G + ++  +     L   F S +     DH  + ++        E V T+   + +  + V+  +      +K+++ +       +RI P+  I   SG               T + ++  T +PG +   +K+ T++ F          ITV+++ S     D+ P   + T   +++ D T         +       NV V   +E    P++ LQ+ DNG G D + +D +++R
Sbjct:    9 VLWMLLPYPSTAIKLDGGG-YVDITIAIGAKVKQDD-TLIDKIKEMVTDGSFYLYHALDKK------VYLKDATILVPSHWSCK-------SCSKARTESFEKAKIKIDHAKLMEPRTKLYGECGKGGEYIHFTPDFL----LNDSAIQMYGPRGKVFLHEWAHLRWGVYDEYNEEKPFYLSNGRVEYTR-CTTNIEGQIFEVNGGSPQSCRINPETFLPSSDCKFFPNKDQNTDSSVMFSPSLEAVTTFC--RETEHNYEAETQQNIICNNKATWTVIFEDSVDKDALSFLPPLPSTPSPPIFKLLQRKKRAVCLILDVSGSMATESRILRMRQAATHLLRNYVEEQASVGIVKFSTAASIVSSLTIIESDATRDHLINLLPET----PGGSTNMCNGLRLGLQVLS---EDDMDAIGDEIIFLTDGQATDDV----TLCIPDAINSGAIIHTIALSDSAHNALQEMADKTGGIFFYSKDDFTSNQLMDAFASLTLSTG-DHSNEPVQ-------LESVGTRTSDWFNGTVSVDQTV-----GNKTSFVIIY-----ERIFPAVYIQSPSGIVYTEAQMNHDNRLKTVTLKVAETAEPGDWAYSIKTSTDQAF---------TITVTSQAS---HEDVPPI-IVKTRMNQQVSDGTKPMTVFAEVSQNYRPVINVEVWATLEPATGPIQSLQLLDNGAGADVMANDGIYSR 656          
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 92.8189 bits (229), Expect = 9.501e-19
Identity = 116/471 (24.63%), Postives = 203/471 (43.10%), Query Frame = 2
Query:  791 CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSI-----IYENVKFNIVKGQTEKIVLVLDTSGSMV-NIIENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIG--THRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTR 2173
            C++   K Q  + S+M      +   FC  R   HN  A NL N KC+ ++   VI      K    S+           F +V+     + LVLD SGSM  + I  ++ A+  FL++ + + + V +V F + A+ LS L  I   + R  L++ + N+ A G TN+  GL  G+QVL    T++ +V+G  II LTDGE  + +       IN        ++ IA G  AD +L ++   T GK+  A+ +     L   F   S  +   +  K   +  ++ +           +D+ IG   K + TI  +     +++ +P       ++        T + ++ GT   G +   + SPT +         +L +T +++ ++     I+    ++  +  + G    +     + N   L    V   L+ ES    +  LQ+ DNG G D  +DD V++R
Sbjct:   45 CRFIPNKYQSTDSSMMSLPSLDSVITFC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTLSALTTIDKESTRENLVKLLPNV-AEGATNMCKGLNLGLQVLK---TDNQDVLGDEIIFLTDGEATDTLSNCVPAAIN----SGAIIHTIALGDKADKALREMADKTGGKFITASDDVLSNQLLNGF--SSLIMPTGNQTKDPVQIDSVGIKTSDWFNGTVSVDQTIGT--KTSFTITYETKLPRISIQSPSGLTYSQTQMRHDEPAKTVTLKVPGTAQTGDWKYSILSPTLQ---------SLTVTATSQAARANVPPITVKAQMN-QQFSD-GSKPMIVFAEVVQNYKPLIKAEVWATLESESGT--VHELQLLDNGAGADTFKDDGVYSR 488          
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 90.5077 bits (223), Expect = 3.093e-18
Identity = 111/445 (24.94%), Postives = 192/445 (43.15%), Query Frame = 2
Query:  869 FCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSI-----IYENVKFNIVKGQTEKIVLVLDTSGSMV-NIIENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIG--THRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTR 2173
            FC  R   HN  A NL N KC+ ++   VI      K    S+           F +V+     + LVLD SGSM  + I  ++ A+  FL++ + + + V +V F + A+ LS L  I   + R  L++ + N+ A G TN+  GL  G+QVL    T++ +V+G  II LTDGE  + +       IN        ++ IA G  AD +L ++   T GK+  A+ +     L   F   S  +   +  K   +  ++ +           +D+ IG   K + TI  +     +++ +P       ++        T + ++ GT   G +   + SPT           +L +T +++ ++     I+    ++  +  + G    +     + N   L    V   L+ ES    +  LQ+ DNG G D  +DD V++R
Sbjct:    9 FC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTLSALTTIDKESTRENLVKLLPNV-AEGATNMCKGLNLGLQVLK---TDNQDVLGDEIIFLTDGEATDTLSNCVPAAIN----SGAIIHTIALGDKADKALREMADKTGGKFITASDDVLSNQLLNGF--SSLIMPTGNQTKDPVQIDSVGIKTSDWFNGTVSVDQTIGT--KTSFTITYETKLPRISIQSPSGLTYSQTQMRHDEPAKTVTLKVPGTAQTGDWKYSILSPT---------LQSLTVTATSQAARANVPPITVKAQMN-QQFSD-GSKPMIVFAEVVQNYKPLIKAEVWATLESESGT--VHELQLLDNGAGADTFKDDGVYSR 426          
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Match: si:ch211-116o3.3 (si:ch211-116o3.3 [Source:ZFIN;Acc:ZDB-GENE-131121-462])

HSP 1 Score: 53.5286 bits (127), Expect = 3.320e-7
Identity = 48/168 (28.57%), Postives = 74/168 (44.05%), Query Frame = 2
Query:  182 ICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDK-----NEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSE 667
            + + LLS+      LD N  + DI++ I+ NV E +  L+++I +  +     L+ A          V F    I VP  WS       + +     F  A   ID       ++P T Q G+CG  G +  F  +F +  KL   +  RGK  + E+  LR+GVY E
Sbjct:    9 LLWMLLSYTSTGIKLDGNG-YVDIVIAISSNVPE-DYMLIDKIKNMFTEGLFHLYLALDKK------VYFKEATILVPPHWSTK----DFSRARTETFEKAKIRIDSPHPAYGDEPYTNQYGECGAEGQYFHFTPNFLRDDKLIKLYGSRGKVLVHEWAHLRWGVYDE 164          
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Match: csnk2a2 (casein kinase 2 alpha 2 [Source:Xenbase;Acc:XB-GENE-487069])

HSP 1 Score: 155.221 bits (391), Expect = 7.193e-38
Identity = 201/812 (24.75%), Postives = 330/812 (40.64%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNH-LNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECK-------YE------IIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKT---SIIYENVKFNIVKGQTEKIVLVLDTSGSMVN---IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCD--ISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT----IPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEII-GTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFR----------------------------ADITINNT--------VNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNET 2473
            N  ++D++  IN  + E N ++++ I + ++ AS+ L+ AT +       V      I +P  WSN+          + A   +A  ++   + P T Q G+CG+PG +      F     ++    RG+ F+ E+  LR+GV+ E   +        KN     C  DI    +K   QC     +C        YE        KNQ    SIM+     +   FCD   + HN  A  L N+ CN RS  +VI+N  D KS      S I     F++++     + LVLD SGSM     I    + A +  ++ V   +YVGIV+F+S+A++ S L+ I   T R  L + +    A GGTNI  G+ +G++V   +  + ++    ++LLTDGE+N    Y+       +      ++ IA G  A   L  I   T G    A        L   F   +     +  H I+ +E + ++ L  K       +ID+ +G      +T    +PA      +TL  P N +I  S     ++ +  S  +I GT + G +   L    N         F   +T +A         ++     +T+ +KE        V     N G+L      V   IE  N     L++ DNG G D + +D +++R  Y    +  G Y  +                              IT+N +        +N     RT   GS +++   +    D   P K+ D+  + +E   VL     ATG+D   G +S Y+ ++ +N +
Sbjct:   28 NGGYEDLVFAINPGLRE-NVKIIDNIQNMITEASQYLFSATKNR------VYIRNAKILIPMAWSNNKYTKARTETYDKADVIIASSHVKFGDDPYTLQYGRCGEPGKYIHMTPDFLLNDLISTYGPRGRAFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIK---QCQGKTCKCARDPQTGLYEDGCVFVPDKNQVPKASIMYLQALQSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPQADSNIPAVPSFSLLQSSERVVTLVLDVSGSMGGGNRIGRLYQAAEVFVMQIVEMGSYVGIVQFESTASVRSSLLQIVDDTQRNRL-KSLLPKTATGGTNICAGIREGIKV--NKKYDGSSYSTELVLLTDGEDN----YATSLCFPDVTNSGSIIHVIALGPNAAKELETIVDMTGGLRFLATDKVDAQGLIDAFIGLTAGDGATTQHAIQ-LESSGSV-LKSKDCLTGTVFIDKTVGNGTFFLVTWVNLVPA------ITLTDP-NGKIYTSNDFASDATSKSSRLVIPGTAERGAWQYNL---CNTHTANQAIGF--VVTSTAADENVPPITVNAHMNQNTNNLKE------PMVVYASVNQGLLPVIGANVTAIIEPVNGNPVTLELWDNGAGADIVRNDGIYSR--YYTAFQGNGRYGLKVRVENSNKKSRLALPRGRALYIPGYLENGQITLNPSRPVINDEDLNLGEFSRTASGGSFVVSNLPSGPQPDLYKPEKVTDLEAKIEEGTVVLT--WTATGDDLDQGTVSGYDFRMSTNPS 795          
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Match: ENSXETT00000038434.1 (chloride channel accessory 1 gene 2 [Source:NCBI gene;Acc:100490932])

HSP 1 Score: 150.599 bits (379), Expect = 1.668e-36
Identity = 210/820 (25.61%), Postives = 333/820 (40.61%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW-SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTE---------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS--GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN---IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSC--DISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT----IPADKSNYEVTLITPKNKRIVPSKKITQNSGT-TFSFEIIGTPDPGMYVVEL--KSPTNKRF-----KRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI-TINN-----------------TVNGDI------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNET 2473
            N  ++DI++ IN  + E N ++++ I + +  AS+ L+ AT +       V   +V I +P TW +N+         + A   +A  ++   + P T Q G+CG+ G +      F     LND        RG+ F+ E+  LR+GV+ E   +        KN     C  DI    +K + Q    N +         C +   +NQ    SIM+     +   FCD   + HN  A  L N+ CN RS  +VI+N  D K+   +         F +++     + LVLD SGSM +   I    + A +  ++ V   ++VGIV F +S T+LS L+ +   T R  L + +    A GGTNI  G+ +G++V      +D +  G+ I+LLTDGE+N N    +  + N  I     V+ IA G   + +L  I   T G    A        L   F S +     +  H I+       +N   K       +ID+ +G      +T    IPA      +TL  P N +I  +K  T ++ + +    I GT + G +   L     TN+        R  D     ITV+A  ++N      P                   V     N G+L      V   IE  N     L + DNG G D +++D ++++  Y  + +  G YS +  +  INN                   NG I                    RT   GS I+N        D   P K+ D+  + +    VL     ATG+D   G +S Y++++ +N +
Sbjct:   27 NGGYEDIVIAINQGLGE-NVKIIDNIQNMIKEASQYLFSATKNR------VYIRSVKILIPITWPNNNYAKAKTETYDKADVIIASPHLKFGDDPYTLQYGRCGEAGKYIHMTPDFL----LNDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIK-QPQGQPCNRDPQTGLYEDGCVFVPEQNQAAKASIMYLQALPSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKATPPQADSNLPVPTFTLLQSSDRVVTLVLDVSGSMASDGRIGRLYQAAEVFVMQIVEEGSHVGIVSFSTSTTVLSKLVQVIDDTQRNHL-KFLLPKTAVGGTNICAGIREGIKV---NNQHDGSSYGTEIVLLTDGEDNYNTSLCFPDISNSGI----IVHFIALGPNPNPNLETIVDMTGGLRFLATDKVDAQGLIDAFSSLTAGDGATTQHAIQLESSGSVVN--PKDCLTGTVFIDKTVGNGTFFLVTWVTLIPA------ITLTDP-NGKIYTAKDFTADTTSKSTRLAIPGTAERGAWQYSLCNTHTTNQAIGILVTSRAADENVPPITVNAHMNQNANNFPEP------------------MVVYASVNQGLLPVIGANVTAIIEPVNGNPDPLDLLDNGAGADIVKNDGIYSK--YYTNFQGNGRYSLKVRVENINNKGRLALPRSQALYIPGYLENGQITMNPLRPVINDEDLNLGEFSRTASGGSFIVNNIPAGPQPDLYKPEKVTDLEAKINGNTIVLT--WTATGDDLDQGIVSGYDLRMSTNPS 792          
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Match: ENSXETT00000026373.1 (chloride channel accessory 1 gene 2 [Source:NCBI gene;Acc:100490932])

HSP 1 Score: 150.599 bits (379), Expect = 1.718e-36
Identity = 209/820 (25.49%), Postives = 332/820 (40.49%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW-SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTE---------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS--GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN---IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSC--DISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT----IPADKSNYEVTLITPKNKRIVPSKKITQNSGT-TFSFEIIGTPDPGMYVVEL--KSPTNKRF-----KRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI-TINN-----------------TVNGDI------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNET 2473
            N  ++DI++ IN  + E N ++++ I + +  AS+ L+ AT +       V   +V I +P TW +N+         + A   +A  ++   + P T Q G+CG+ G +      F     LND        RG+ F+ E+  LR+GV+ E   +        KN     C  DI    +K + Q    N +         C +   +NQ    SIM+     +   FCD  H   N  A  L N+ CN RS  +VI+N  D K+   +         F +++     + LVLD SGSM +   I    + A +  ++ V   ++VGIV F +S T+LS L+ +   T R  L + +    A GGTNI  G+ +G++V      +D +  G+ I+LLTDGE+N N    +  + N      + V+ IA G   + +L  I   T G    A        L   F S +     +  H I+       +N   K       +ID+ +G      +T    IPA      +TL  P N +I  +K  T ++ + +    I GT + G +   L     TN+        R  D     ITV+A  ++N      P                   V     N G+L      V   IE  N     L + DNG G D +++D ++++  Y  + +  G YS +  +  INN                   NG I                    RT   GS I+N        D   P K+ D+  + +    VL     ATG+D   G +S Y++++ +N +
Sbjct:   27 NGGYEDIVIAINQGLGE-NVKIIDNIQNMIKEASQYLFSATKNR------VYIRSVKILIPITWPNNNYAKAKTETYDKADVIIASPHLKFGDDPYTLQYGRCGEAGKYIHMTPDFL----LNDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIK-QPQGQPCNRDPQTGLYEDGCVFVPEQNQAAKASIMYLQALPSVTEFCDKNH---NTEAPTLQNRICNSRSTWDVIMNSTDIKATPPQADSNLPVPTFTLLQSSDRVVTLVLDVSGSMASDGRIGRLYQAAEVFVMQIVEEGSHVGIVSFSTSTTVLSKLVQVIDDTQRNHL-KFLLPKTAVGGTNICAGIREGIKV---NNQHDGSSYGTEIVLLTDGEDNYNTSLCFPDISN----SGIIVHFIALGPNPNPNLETIVDMTGGLRFLATDKVDAQGLIDAFSSLTAGDGATTQHAIQLESSGSVVN--PKDCLTGTVFIDKTVGNGTFFLVTWVTLIPA------ITLTDP-NGKIYTAKDFTADTTSKSTRLAIPGTAERGAWQYSLCNTHTTNQAIGILVTSRAADENVPPITVNAHMNQNANNFPEP------------------MVVYASVNQGLLPVIGANVTAIIEPVNGNPDPLDLLDNGAGADIVKNDGIYSK--YYTNFQGNGRYSLKVRVENINNKGRLALPRSQALYIPGYLENGQITMNPLRPVINDEDLNLGEFSRTASGGSFIVNNIPAGPQPDLYKPEKVTDLEAKINGNTIVLT--WTATGDDLDQGIVSGYDLRMSTNPS 792          
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Match: gnl3 (guanine nucleotide binding protein-like 3 (nucleolar) [Source:Xenbase;Acc:XB-GENE-6456133])

HSP 1 Score: 146.362 bits (368), Expect = 4.087e-35
Identity = 196/812 (24.14%), Postives = 313/812 (38.55%), Query Frame = 2
Query:  242 FQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSN-HLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRH----QCMES------NTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENV---KFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFL-ESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSC--DISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT----IPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKR-------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINNT------------------------------------VNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIK 2455
            ++DI++ IN  + E N +++  I + ++ AS  L+ AT +       V   +V I +P TWSN           N A   +A  ++   + P T Q G CG+ G +      F     LND        RG+ F+ E+  LR+GV+ E   +        KN     C  DI    +K       +C+          +C +   +N     SIM+     +   FCD  H   N  A  L N+ CN RS  +VI+N  D KS        N+    F++++     + LVLD SGSM +   IE +  A   FL + V   +YVGI+ F +S ++LS L+ +   T R  L + +    A GGT+I  G+ +G+++       D +  G+ ++LLTDGE+N    Y        +      ++ IA G  A  +L  I   T G    A        L   F S +     +  H I+       +N   K       ++D+ +G      +T    +PA      +TL  P  K    +      +  +   EI+GT + G +   L +              R  D     ITV+A  ++N      P                   V     N G+L      V   IE  N  L  L++ DNG G D +++D +++R  Y  + +  G Y  +  +   N                                     +N     RT   GS ++N        D   P K+ D+      K   + +   ATG+D   G +S Y+++
Sbjct:   30 YEDIVIAINPGLRE-NVKIIENIQNMINGASHYLFNATRNR------VYIKSVKILIPMTWSNKSYTKARTETYNKADVIIATPHLKFGDDPYTLQYGGCGEAGKYIHMTPDFL----LNDVLVSVYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYITGDKNIEATRCSADITGTYIKPCQGQTCKCIRDPQTGLYEDDCVFVPERNGAAKASIMYLQALPSVTEFCDKNH---NTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPQ-ADSNIPVPSFSLLQSSDRVVTLVLDVSGSMASGGRIERLYQAAEVFLMQIVEEGSYVGILTFSTSISLLSNLVQVIENTQRKQL-KSLLPTNAFGGTDICLGIREGIKI---NRQYDGSSYGTELVLLTDGEDN----YDTSKCFPDITNSGAIIHVIALGPNAAKALETIVDMTEGLRFLATDKVDTQGLIEAFISLTAGDGATTQHAIQLESSGSVVN--PKDCLTGTVFMDKTVGNGTFFLVTWVNLVPA------ITLTDPNGKVYTTNNFTADTTSKSSRLEILGTAERGAWQYNLCNTHTASQAIGFVVTSRAADENVPPITVNAHMNQNANNYPEP------------------MVVYASVNQGLLPVIGANVTAIIEPVNGNLVTLELWDNGAGADIVKNDGIYSR--YYTEFQGNGRYGLKVRVENGNKKSRLALPRGRALYIPGYLENEQIIMNPSRPVINDEDLNLGEFSRTASGGSFVVNNIPAGPQPDLYKPDKVTDL--EAKIKGNTIVLTWTATGDDLDQGVVSGYDVR 788          
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Match: ENSXETT00000038492.1 (chloride channel accessory 4 gene 1 [Source:NCBI gene;Acc:100488301])

HSP 1 Score: 130.183 bits (326), Expect = 4.240e-30
Identity = 192/810 (23.70%), Postives = 337/810 (41.60%), Query Frame = 2
Query:  242 FQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLN---PITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPL-KNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNT-----------ECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS--GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN---IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTH-RATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-----IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKF---FSQSCDISVDHLIKAIE-ETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFR----------------------------ADITINNT--------VNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSN 2467
            ++DI++ I+ NV E N +++  + + V  A++ L+ AT         +   +  I +P  WS H N   P T    + A   +A  ++   + P T Q G+CG+PG +      F    K+   +  RG+ F+ E+  LR+GV+ E    K   +A +G   ++A  C  DIK    K   Q    N            +C +     Q    SIM+     +   FCD +H   N  A  L N+ C  RS  +VI N  D KS   +         F++++     + LVLD SGSM +   I   ++   +  ++ + N A+VGIV+F SSA+++S L+ I T  +   ++ +    A GGTNI  G+  G+ +       + N  GS     I+LLTDGE+N +    +      +      ++ IA G  A   L  I   T G    A    +  +L   F    S + +I    + +AI+ E+I   +      +   +ID  +G   +    +  + +  ++ +  PK K+   +   T  +  +    I GT + G +         K   ++T    +  TV++KPS      I+    ++    ++        V     + G+       V   I+ P+     L++ DNG G D +++D V++R  Y +  +  G YS +                             ++T+N          +N     RT   GS +++   +    D   P K+ D+    ++   VL     ATG+D   G +SDY++++ ++
Sbjct:   31 YEDIVIAIHPNVTE-NDKIIENVQNMVKEANQYLFNATKQR------LFIKSAKILIPFKWSKHNNADKPKT-ETYDKADVIIAEPHLKYGDDPYTLQYGRCGEPGRYIHLTPDFLVNDKMISQYGPRGRVFVHEWAHLRWGVFDEYNYDKPFYIAANGD--VEATRCSADIKGTYTKRNCQGKPCNCSPDPKTGLYEDDCVFVPETYQSVKESIMYLQALPSVSEFCDSKH---NTEAPTLQNRMCESRSTWDVISNSTDIKSTVPRADFNIPVPSFSLLQFSERVVSLVLDVSGSMSSSNRIGRQLQAVELFVVQIIENGAHVGIVKFSSSASVVSSLVKINTQAQRDQLKSLIPRTAGGGTNICAGIRAGIAL-------NKNFDGSSYGTEIVLLTDGEDNLDTSLCF----KDITDSGAIIHVIALGPNAAKELETIANMTGGLRFNALDKVEANELIDAFSGLHSGNGEI----IQQAIQLESIGSVVKPNGCLEGAVFIDNTVGN--ETFFLVSWETALPDLNIEDPKRKQYYTADFNTDTASRSSRLGIPGTAEIGPWYY-------KFCNKHTSNQAITFTVTSKPSNVNIPPIT----VNAHMNQDANSFPHPMVVYASLSHGLQPVIGAKVTAAIQPPSGVPVVLELLDNGAGADIVKNDGVYSR--YFKQYDGNGRYSLKVQVKSITKKTRLALPRSRALYIPGFLENGEVTLNPPRPVINDEDLNLGEFSRTASGGSFVVSNVPSGPQPDLYKPEKVTDLEANIEDDTVVLT--WTATGDDLDQGTVSDYDLRMSTS 795          
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Match: Clca3a2 (chloride channel accessory 3A2 [Source:MGI Symbol;Acc:MGI:1931471])

HSP 1 Score: 161.77 bits (408), Expect = 4.697e-40
Identity = 185/697 (26.54%), Postives = 301/697 (43.19%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNT----------------ECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK---FNIVKGQTEKIVLVLDTSGSM---VNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNL--YANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPN-TQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSK-KITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI 2230
            +N ++ +++ IN +V E + +L+  I + V+ AS  L++A+         V F  + I VP TW   S +L P      + A   VA  ++   + P T Q G+CGD G +  F  +F     L     RG+ F+ E+  LR+GV+ E  + +R      KN I+A  C   I    V   H+C   +                 +C +   K Q    SIMF     +   FC + +  HN  A NL NK CN+RS  +VI    DF++       E      F+++K +   + LVLD SGSM     +I   + A +   + V   + VG+V FDS+A I +YL+ I T  +   +   NL   A GGT+I  GL  G Q +    ++D +  GS I+LLTDGE +N I   ++ V     +    ++ IA G  A   L  ++  T G   +AN + +   D   +  S S  +S   L     E+   N+       +   +D  +G +    +T    K   E+ L  PK K+ + S  +  + +  +   +I GT + G +   +           +   T+ +T  A+         +     ST++               L   G     NVT I++ E  ++    L++ DNG G D +++D ++TR  Y  D    G YS +  +
Sbjct:   28 SNGYEGVVIAINPSVPE-DERLIPSIKEMVTQASTYLFEASQ------GRVYFRNISILVPMTWKSKSEYLMP-KRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNV-DRPFYISRKNTIEATRCSASITGKKVV--HECQRGSCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTENN--HNAEAPNLQNKMCNRRSTWDVIKASADFQNSPPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAAHIQNYLIKI-TSSSDYQKITANLPQQATGGTSICHGLQAGFQAI---TSSDQSTSGSEIVLLTDGE-DNGISSCFEAV----SRSGAIIHTIALGPSAARELETLSDMTGGLRFYANKHVSSLIDAFSRISSTSGSVSQQALQL---ESKAFNVRAGAWINSTVPVDSTVGNDTFFVITWTVQKP--EIILQDPKGKKYITSDFQDDELNIRSARLQIPGTAETGTWTYSITG-------TKSQLITMTVTTRARSPTMEPLLATAHMSQSTAQYPSRMIVYVRVSQGFLPVLG----ANVTAIIEAEHGHQ--VTLELWDNGAGADTVKNDGIYTR--YFTDYHGNGRYSLKVRV 682          
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Match: Clca4a (chloride channel accessory 4A [Source:MGI Symbol;Acc:MGI:2139744])

HSP 1 Score: 160.999 bits (406), Expect = 7.240e-40
Identity = 203/820 (24.76%), Postives = 329/820 (40.12%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW--SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPLKNRL----------LAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIV-LVLDTSGSMVNI--IENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIGT--HRATLIREIQNLYANGGTNIPDGLVKGVQVL-GGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQ---YTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSK----------NRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--RADITINNT------------------VNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSN 2467
            N ++DI++ I+  V E +  ++  I   V+ AS  L++AT           F  V I +P +W  S            +A   VA   ++  ++P T+Q  +C +   +  F   F    K ++    GK  + E+  LR+GV+ E    +P  +                G N + A  G        +          +C++   K Q    SIMF     +   FC   +  HN+ A  LHNKKCN RS   VI   +DF S        +  F  +   +E+I+ LVLD SGSM +   +  M  A   FL   + N ++VG+V F S ATI+  L+ I +   R  L++ +    ANGGT+I  G+    QV   GE   D      I+LL+DGE++     +    I+++      V+ IA G  AD+++  ++  T G +K A    Q     D  G   S++ DI+   L   +E    I L   +   +   ID  +G +    +T    K    + L  PK  +   +   T +S +  ++  I GT   G++   L++      K N++  T+ +T  A  S           N + +  PS  I  +E+ +                G        V   IES +   + L + DNG G DA +DD V++R   A  +   G YS   RAD   N+                   V+G+I                     RT   G+ +++        D   P +I D+    D ++  + +   A G+D  +G +  Y I+   N
Sbjct:   31 NGYEDIIIAIDPAVPE-DTTIIEHIKGMVTKASTYLFEATEKR------FFFKNVSILIPESWKDSPQYRRPKQESYKHADIKVAPPTVEGRDEPYTRQFTQCEEKAEYIHFTPDFVLGRKQDEYGDSGKVLVHEWAHLRWGVFDEYNEDQPFYSASSKKIEATRCSTGITGTNRVYACQGGSCAMRRCRTNSTTKLYEKDCQFFPDKVQSEKASIMFMQSIDSVTEFCKKEN--HNREAPTLHNKKCNYRSTWEVISTSEDFNSSTPMETSPSPPFFSLLRISERIMCLVLDVSGSMTSYDRLNRMNQAAKYFLSQIIENRSWVGMVHFSSQATIVHELIQINSDIERNQLLQTLPT-SANGGTSICSGIKAAFQVFKNGEYQTDGT---EILLLSDGEDS-----TAKDCIDEVKDSGSIVHFIALGPSADLAVTNMSILTGGNHKLATDEAQNNGLIDAFGALASENADITQKSL--QLESKGAI-LNNSLWLNDTVVIDSTLGRDTFFLVTW--SKQAPAIYLRDPKGTQ---TTNFTMDSASKMAYLSIPGTAQVGVWTYNLEA------KENSEILTITVTSRAANSSVPPITVNAKVNTDTNTFPSPMIVYAEVLQ----------------GYTPIIGARVTATIESNSGKTEELVLLDNGAGADAFKDDGVYSRFFTAYSVN--GRYSLKVRADGGRNSARRSLRHPSSRAAYIPGWVVDGEIQGNPPRPETTEATQPVLEDFSRTASGGAFVMSNVPIGPLPDVYPPNRITDLQATLDGEE--ISLTWTAPGDDYDVGRVQQYIIRTSKN 798          
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Match: Clca4a (chloride channel accessory 4A [Source:MGI Symbol;Acc:MGI:2139744])

HSP 1 Score: 160.999 bits (406), Expect = 7.808e-40
Identity = 203/820 (24.76%), Postives = 329/820 (40.12%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW--SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPLKNRL----------LAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIV-LVLDTSGSMVNI--IENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIGT--HRATLIREIQNLYANGGTNIPDGLVKGVQVL-GGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQ---YTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSK----------NRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--RADITINNT------------------VNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSN 2467
            N ++DI++ I+  V E +  ++  I   V+ AS  L++AT           F  V I +P +W  S            +A   VA   ++  ++P T+Q  +C +   +  F   F    K ++    GK  + E+  LR+GV+ E    +P  +                G N + A  G        +          +C++   K Q    SIMF     +   FC   +  HN+ A  LHNKKCN RS   VI   +DF S        +  F  +   +E+I+ LVLD SGSM +   +  M  A   FL   + N ++VG+V F S ATI+  L+ I +   R  L++ +    ANGGT+I  G+    QV   GE   D      I+LL+DGE++     +    I+++      V+ IA G  AD+++  ++  T G +K A    Q     D  G   S++ DI+   L   +E    I L   +   +   ID  +G +    +T    K    + L  PK  +   +   T +S +  ++  I GT   G++   L++      K N++  T+ +T  A  S           N + +  PS  I  +E+ +                G        V   IES +   + L + DNG G DA +DD V++R   A  +   G YS   RAD   N+                   V+G+I                     RT   G+ +++        D   P +I D+    D ++  + +   A G+D  +G +  Y I+   N
Sbjct:   30 NGYEDIIIAIDPAVPE-DTTIIEHIKGMVTKASTYLFEATEKR------FFFKNVSILIPESWKDSPQYRRPKQESYKHADIKVAPPTVEGRDEPYTRQFTQCEEKAEYIHFTPDFVLGRKQDEYGDSGKVLVHEWAHLRWGVFDEYNEDQPFYSASSKKIEATRCSTGITGTNRVYACQGGSCAMRRCRTNSTTKLYEKDCQFFPDKVQSEKASIMFMQSIDSVTEFCKKEN--HNREAPTLHNKKCNYRSTWEVISTSEDFNSSTPMETSPSPPFFSLLRISERIMCLVLDVSGSMTSYDRLNRMNQAAKYFLSQIIENRSWVGMVHFSSQATIVHELIQINSDIERNQLLQTLPT-SANGGTSICSGIKAAFQVFKNGEYQTDGT---EILLLSDGEDS-----TAKDCIDEVKDSGSIVHFIALGPSADLAVTNMSILTGGNHKLATDEAQNNGLIDAFGALASENADITQKSL--QLESKGAI-LNNSLWLNDTVVIDSTLGRDTFFLVTW--SKQAPAIYLRDPKGTQ---TTNFTMDSASKMAYLSIPGTAQVGVWTYNLEA------KENSEILTITVTSRAANSSVPPITVNAKVNTDTNTFPSPMIVYAEVLQ----------------GYTPIIGARVTATIESNSGKTEELVLLDNGAGADAFKDDGVYSRFFTAYSVN--GRYSLKVRADGGRNSARRSLRHPSSRAAYIPGWVVDGEIQGNPPRPETTEATQPVLEDFSRTASGGAFVMSNVPIGPLPDVYPPNRITDLQATLDGEE--ISLTWTAPGDDYDVGRVQQYIIRTSKN 797          
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Match: Clca3a1 (chloride channel accessory 3A1 [Source:MGI Symbol;Acc:MGI:1316732])

HSP 1 Score: 155.992 bits (393), Expect = 2.694e-38
Identity = 186/701 (26.53%), Postives = 301/701 (42.94%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSN---HLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKW-NVVKDRHQCMESNT----------------ECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK---FNIVKGQTEKIVLVLDTSGSM---VNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNL--YANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPN-TQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPS----KKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI 2230
            +N ++ +++ IN +V E + +L+  I + V+ AS  L++A+         V F  + I VP TW +   +L P      + A   VA  ++   + P T Q G+CGD G +  F  +F     L     RG+ F+ E+  LR+GV+ E  + ++      KN I+A  C   I   NVV   H C   N                 +C +   K Q    SIMF     +   FC +++  HN  A NL NK CN+RS  +VI    DF++       E      F+++K +   + LVLD SGSM     +I   + A +   + V   + VG+V FDS+A I +YL+ I T  +   +   NL   A+GGT+I  GL  G Q +    ++D +  GS I+LLTDGE +N I   ++ V     +    ++ IA G  A   L  ++  T G   +AN +     D   +  S S  +S   L     E+   ++           +D  +G +    +T    K   E+ L  PK K+   S     K+   S      +I GT + G +   +           +   T+ +T  A+         +     ST++        +      L   G     NVT +++ E  ++    L++ DNG G D +++D ++TR  Y  D    G YS +  +
Sbjct:   28 SNGYEGVVIAINPSVPE-DERLIPSIKEMVTQASTYLFEASQ------GRVYFRNISILVPMTWKSKPEYLMP-KRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNV-DQPFYMSRKNTIEATRCSTRITGTNVV---HNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTEKN--HNAEAPNLQNKMCNRRSTWDVIKTSADFQNAPPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAAHIQNYLIKI-TSSSDYQKITANLPQQASGGTSICHGLQAGFQAI---TSSDQSTSGSEIVLLTDGE-DNGIRSCFEAV----SRSGAIIHTIALGPSAARELETLSDMTGGLRFYANKDLNSLIDAFSRISSTSGSVSQQALQL---ESKAFDVRAGAWINGTVPLDSTVGNDTFFVITWMVKKP--EIILQDPKGKKYTTSDFQDDKLNIRSA---RLQIPGTAETGTWTYSITG-------TKSQLITMTVTTRARSPTMEPLLATAHMSQSTAQYPSRMIVYARVSQGFLPVLG----ANVTALIEAEHGHQ--VTLELWDNGAGADTVKNDGIYTR--YFTDYHGNGRYSLKVRV 682          
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Match: Clca1 (chloride channel accessory 1 [Source:MGI Symbol;Acc:MGI:1346342])

HSP 1 Score: 149.828 bits (377), Expect = 2.674e-36
Identity = 178/713 (24.96%), Postives = 301/713 (42.22%), Query Frame = 2
Query:  164 KMKYLYICFGLLSFVYAEYYLD-SNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE------------EPLKNRL-LAFDGKNHIQAVCGNDIKWN--VVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK-FNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDIS--VDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFR 2221
            K     +   LL  V +E  +  +NN ++ I++ I+ +V E    L+  I D V+ AS  L++AT           F  V I +P +W     +  P       NA   V+  +   N++P T+ +G CG+ G        F    KL     + + F+ E+   R+GV++E            +P   R   A  GKN ++   G     N   V DR   +  +  C +    +Q+   SIMF+    +   FC +++  HN+ A N  N++CN RS   VI   +DFK             F++++     + LVLD SGSM+N   +  M  A+  F L++V   ++VG+V FDS+A + S L  +  G  R  LI+ +  + A GGT+I  GL     V+  +   D +    I+LLTDGE +N I   +D V     +    ++ +A G  A   L +++  T G   +++   Q   L   F + S   +    H I+   E+  +NL           +D  +G +    +T     + +  T+       +  +  I   +      ++ GT   G +   +++ +           TL +TV+++ +      I+ +  ++    K  G   S          G       +V   IES N     L++ DNG G DA ++D V++R   A D    G YS +
Sbjct:    5 KSPVFLLILHLLEGVLSESLIQLNNNGYEGIVIAIDHDVPEDEA-LIQHIKDMVTQASPYLFEATGKR------FYFKNVAILIPESWKAKPEYTRP-KLETFKNADVLVSTTSPLGNDEPYTEHIGACGEKGIRIHLTPDFLAGKKLTQYGPQDRTFVHEWAHFRWGVFNEYNNDEKFYLSKGKPQAVRCSAAITGKNQVRRCQGGSCITNGKCVIDRVTGLYKD-NCVFVPDPHQNEKASIMFNQNINSVVEFCTEKN--HNQEAPNDQNQRCNLRSTWEVIQESEDFKQTTPMTAQPPAPTFSLLQIGQRIVCLVLDKSGSMLNDDRLNRMNQASRLFLLQTVEQGSWVGMVTFDSAAYVQSELKQLNSGADRDLLIKHLPTVSA-GGTSICSGLRTAFTVIKKKYPTDGS---EIVLLTDGE-DNTISSCFDLV----KQSGAIIHTVALGPAAAKELEQLSKMTGGLQTYSSDQVQNNGLVDAFAALSSGNAAIAQHSIQL--ESRGVNLQNNQWMNGSVIVDSSVGKDTLFLITW----TTHPPTIFIWDPSGVEQNGFILDTTTKVAYLQVPGTAKVGFWKYSIQASSQ----------TLTLTVTSRAASATLPPITVTPVVN----KNTGKFPSPVTVYASIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKNDGVYSRFFTAFDAN--GRYSVK 675          
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Match: sp|Q2TU62|CLCA1_HORSE (Calcium-activated chloride channel regulator 1 OS=Equus caballus OX=9796 GN=CLCA1 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.964e-43
Identity = 207/817 (25.34%), Postives = 347/817 (42.47%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE--------------EPLKNRLLAFDGKNHIQAVCGNDIKWNVV-KDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK---FNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIA----FLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKF--FSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRA------------DITINNTV--------NGDII--------------------RRTLDLGSLIINQKQTKKFEDKILPAKIDDI--LVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSN 2467
            NN ++ I++ I+ NV E +  L+ +I D V+ AS  L++AT           F  V I VP  W     +  P       NA   VA  N   N++P T+Q+GKCG+ G    F   F    +L++   +G+ F+ E+  LR+G+++E              +P+K       GKN +    G         +DR   + +  EC++   + Q    SIMF     +   FC + +  HN+ A N+ N++CN RS   VI + +DFK  KT+ +        F++++     + LVLD SGSM  I + +K  T A     L++V   ++VG+V FDS+A + S L  I  GT R  L + +  + A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +     N++ +    ++ +A G  A   L +++  T G   +A+   Q   L   F   S        H I+ +    T+   + ++      +D  +G +    +T  +     ++ L  P  K+         ++ T  ++ ++ GT   G +   L++ +           TL +TV+++ S        P   +++   K+ G   S  V     + G L     TV   IES +     L++ DNG G DA +DD +++R   A +    G YS +              I+  N          NG+II                     RT   GS + +        D   P +I D+   ++GD    ++ +   A G+D   G    Y I+I +N
Sbjct:   29 NNGYEGIVIAIDPNVPE-DETLIQQIKDMVTQASPYLFEATEKR------FYFKNVAILVPENWKTKPEYERP-KLETYKNADVLVAEPNPPGNDQPYTEQMGKCGEKGERIYFTPDFLAGKRLDEYGPQGRVFVHEWAHLRWGLFNEYNDDQKFYLSNKEIKPVKCS-ADIAGKNVVNHCQGGSCATKPCRRDRVTGLYAQ-ECEFIPDEQQTEKASIMFSQSIDSVVEFCTEEN--HNREAPNMQNQRCNLRSTWEVIRDSEDFK--KTTPMTAQPPQPTFSLLQIGQRIVCLVLDKSGSMA-IGDRLKRLTQAGKLFLLQTVEQGSWVGMVTFDSAAYVQSALRQIKGGTDRDALTKSLPTV-ASGGTSICSGLRSAFTVIRKKYKTDGS---EIVLLTDGEDN-----TISSCFNEVKQSGAIIHTVALGPSAAAELEELSKMTGGLQTYASDQAQNNGLIDAFGALSSGNGAVSQHSIQLVSRGSTLQNSQWMN--GTVIVDSTVGNDTLFLITWTSQPP--QILLWDPSGKK---QDGFVVDTNTKMAYLQVPGTAKVGTWTYSLQASSQ----------TLTLTVTSRASSA----TLPPVTVTSKVNKDTGKFPSPVVVYAKIHQGGLPILRATVTALIESVDGKTVTLELLDNGAGADATKDDGIYSRYFTAYNTN--GRYSIKVWALGGVNAARQMGISQQNGAMYRAGRMKNGEIIWNPPRPKINIDDLLSKQVPFSRTSSGGSFVASNVPNAPIPDLFPPCQITDLKAKIQGD---SLINLTWTAPGDDYDHGRADRYIIRISTN 795          
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Match: sp|Q14CN2|CLCA4_HUMAN (Calcium-activated chloride channel regulator 4 OS=Homo sapiens OX=9606 GN=CLCA4 PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 5.696e-43
Identity = 225/877 (25.66%), Postives = 371/877 (42.30%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNP----ITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPL---------KNRLLA-FDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK-FNIVKGQTEKIVLVLDTSGSM--VNIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHIGT--HRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLAD---MSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMT---IPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKR------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--------------------RADITINNTVNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQS---------NETIVIRKTAF----ANPAEKIMFEVE-LLKMNVTNPFEISVRGVDNS 2593
            NN F+DI++ I+ +V E + +++ +I D V+ AS  L++AT           F  V I +P  W    NP           +A   VA   +   ++P TKQ  +CG+ G +  F        K N+    GK F+ E+  LR+GV+ E    +P            R  A   G+N +    G        +          +C++   K Q    SIMF     +   FC++  + HN+ A +L N KCN RS   VI N +DFK+    +       F+++K     + LVLD SGSM   + +  M  A   F L++V N ++VG+V FDS+ATI++ L+ I +   R TL+  +   Y  GGT+I  G+    QV+ GE+   + + GS ++LLTDGE+N     +    I+++ +    V+ IA G+ AD   + ++KIT G++        N    D  G   S + D+S   L     E+  + L       +   ID  +G +    +T   +P   S ++ +    +N  +  + K+           I GT   G +   L++  N          R  +     ITV+AK   N++ +  PS  I  +EI +                G +      V   IES N   + L++ DNG G D+ ++D V++R   A    + G YS                     RA       VNG+I                     RT   G+ +++Q  +    D+  P++I D+     E K +L     A G++  +G +  Y I+I +         ++ + +  T      AN  E   F+ E + + N T+ F I+++ +D S
Sbjct:   28 NNGFEDIVIVIDPSVPE-DEKIIEQIEDMVTTASTYLFEATEKR------FFFKNVSILIPENWKE--NPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNE--KTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLIQIKSSDERNTLMAGLPT-YPLGGTSICSGIKYAFQVI-GEL--HSQLDGSEVLLLTDGEDN-----TASSCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGNTDLSQKSLQL---ESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIMENFTVDATSKMAY-------LSIPGTAKVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAK--MNKDVNSFPSPMIVYAEILQ----------------GYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGVYSRYFTA--YTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIEANPPRPEIDEDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKIILT--WTAPGDNFDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATHIF-IAIKSIDKS 851          
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Match: sp|Q9TUB5|CLCA1_PIG (Calcium-activated chloride channel regulator 1 OS=Sus scrofa OX=9823 GN=CLCA1 PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.672e-41
Identity = 216/870 (24.83%), Postives = 353/870 (40.57%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQ---CMES-----------NTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK---FNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNS------GTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF-------------RADITINNTV-------NGDI--------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQS---------NETIVIRKTAF----ANPAEKIMFEVELLKMNVTNPFEISVRGVDNS 2593
            N ++ I++ I+ NV E + +L+  I D V+ AS  L++AT           F  V I +P++W     ++ P       NA   V   N  +N+ P T+Q+G CG+ G    F   F    K+     +G+ F+ E+  LR+GV++E   + +      K     +C   I+   V  + Q   C+               EC++     Q    SIMF     T   FC +++  HNK A N  N+KCN RS   VI + +DFK  KT+ +        F++++     + LVLD SGSM     ++ +  A   F L++V   A+VG+V FDS+A + S L+ I     R  L R +    A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +      ++ +    ++ +A G  A   L +++  T G   +A+   +   L   F + S             E+  + L           +D  +G +    +T+       E   ++P     VPS + +Q+S           F++ GT   GM+   L++ +           TL +TVS++    R     P   +++   K+ G   S  V     + G L      V   IES N     L++ DNG G DA ++D +++R   A D    G YS              RA    +  +       NG+I                      RT   GS + +        D   P KI D L  G +   ++ +   A G+D   G    Y I+I +         N+++ +  T      AN  E  +F+ E +         I+V+ VD +
Sbjct:   30 NGYEGIVIAIDPNVPE-DERLIQNIKDMVTKASPYLFEATEKR------FYFKNVAILIPASWKAKPEYVKP-KLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFY-LSNKKEQPVICSAAIRGTNVLPQCQGGSCVTKPCRADRVTGLFQKECEFIPDPQQSEKASIMFAQSIDTVVEFCKEKN--HNKEAPNDQNQKCNLRSTWEVIQDSEDFK--KTTPMTTQPPAPTFSLLQIGQRIVCLVLDKSGSMTVGGRLKRLNQAGKLFLLQTVEQGAWVGMVAFDSAAYVKSELVQINSAAERDALARSLPTA-ASGGTSICSGLRSAFTVIKKKYPTDGS---EIVLLTDGEDN-----TISACFPEVKQNGAIIHTVALGPSAAKELEELSQMTGGLQTYASDQAENNGLIDAFGALSSGNRAASQRSIQLESQGLTLQNNEWMNGTVVVDSTVGKDTLFLITL-------ERKFLSPIPFFGVPSGR-SQDSFLVGKHNKMAYFQVPGTAKVGMWKYSLQASSQ----------TLTLTVSSR----RSSATLPPVTVTSKMNKDTGKFPSPMVVYTKIHQGTLPILRAKVTALIESENGKTVTLELLDNGAGADATKNDGIYSRYFTAYDAN--GRYSVKVWALGGVNTPRRRAPPLWSGAMYIRGWIENGEIKWNPPRPDINKDDLQGKQVCFSRTASGGSFVASDVPKSPIPDLFPPCKITD-LKAGIQGDNLINLTWTAPGDDYDHGRADRYIIRISTNILDLRDKFNDSVQVNTTDLIPKEANSEEVFVFKPEGIPFTNGTDLFIAVQAVDKT 852          
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Match: sp|Q6Q473|CLA4A_MOUSE (Calcium-activated chloride channel regulator 4A OS=Mus musculus OX=10090 GN=Clca4a PE=1 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.723e-40
Identity = 204/820 (24.88%), Postives = 331/820 (40.37%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW--SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPLKNRL----------LAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIV-LVLDTSGSMVNI--IENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYLMHIGT--HRATLIREIQNLYANGGTNIPDGLVKGVQVL-GGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQ---YTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSK----------NRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--RADITINNT------------------VNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSN 2467
            N ++DI++ I+  V E +  ++  I   V+ AS  L++AT           F  V I +P +W  S            +A   VA   ++  ++P T+Q  +C +   +  F   F    K ++    GK  + E+  LR+GV+ E    +P  +                G N + A  G        +          +C++   K Q    SIMF     +   FC   +  HN+ A  LHNKKCN RS   VI   +DF S        +  F  +   +E+I+ LVLD SGSM +   +  M  A   FL   + N ++VG+V F S ATI+  L+ I +   R  L++ +    ANGGT+I  G+    QV   GE   D      I+LL+DGE++     +    I+++      V+ IA G LAD+++  ++  T G +K A    Q     D  G   S++ DI+   L   +E    I L   +   +   ID  +G +    +T    K    + L  PK  +   +   T +S +  ++  I GT   G++   L++      K N++  T+ +T  A  S           N + +  PS  I  +E+ +                G        V   IES +   + L + DNG G DA +DD V++R   A  +   G YS   RAD   N+                   V+G+I                     RT   G+ +++   +    D   P +I D+    D ++  + +   A G+D  +G +  Y I+   N
Sbjct:   30 NGYEDIIIAIDPAVPE-DTTIIEHIKGMVTKASTYLFEATEKR------FFFKNVSILIPESWKDSPQYRRPKQESYKHADIKVAPPTVEGRDEPYTRQFTQCEEKAEYIHFTPDFVLGRKQDEYGDSGKVLVHEWAHLRWGVFDEYNEDQPFYSASSKKIEATRCSTGITGTNRVYACQGGSCAMRRCRTNSTTKLYEKDCQFFPDKVQSEKASIMFMQSIDSVTEFCKKEN--HNREAPTLHNKKCNYRSTWEVISTSEDFNSSTPMETSPSPPFFSLLRISERIMCLVLDVSGSMTSYDRLNRMNQAAKYFLSQIIENRSWVGMVHFSSQATIVHELIQINSDIERNQLLQTLPT-SANGGTSICSGIKAAFQVFKNGEYQTDGT---EILLLSDGEDS-----TAKDCIDEVKDSGSIVHFIALGPLADLAVTNMSILTGGNHKLATDEAQNNGLIDAFGALASENADITQKSL--QLESKGAI-LNNSLWLNDTVVIDSTLGRDTFFLVTW--SKQAPAIYLRDPKGTQ---TTNFTMDSASKMAYLSIPGTAQVGVWTYNLEA------KENSEILTITVTSRAANSSVPPITVNAKVNTDTNTFPSPMIVYAEVLQ----------------GYTPIIGARVTATIESNSGKTEELVLLDNGAGADAFKDDGVYSRFFTAYSVN--GRYSLKVRADGGRNSARRSLRHPSSRAAYIPGWVVDGEIQGNPPRPETTEATQPVLENFSRTASGGAFVVSNVPSGPLPDLYPPNQITDLQATLDGEE--ISLTWTAPGDDYDVGRVQQYIIRTSKN 797          
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Match: sp|A8K7I4|CLCA1_HUMAN (Calcium-activated chloride channel regulator 1 OS=Homo sapiens OX=9606 GN=CLCA1 PE=1 SV=3)

HSP 1 Score: 156.762 bits (395), Expect = 1.070e-37
Identity = 140/471 (29.72%), Postives = 222/471 (47.13%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDIKWNVVKDRHQCMESNTE--------------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIY---ENVKFNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQS 1567
            NN ++ I+V I+ NV E +  L+ +I D V+ AS  L +AT           F  V I +P TW   ++++ P       NA   VA      N++P T+Q+G CG+ G        F    KL +   +G+ F+ E+  LR+GV+ E     +    +G+  IQAV C   I    V  + Q     T+              C++ +   Q    SIMF     +   FC +++  HNK A N  N+KCN RS   VI + +DFK  KT+ +     N  F++++     + LVLD SGSM   N +  +  A   F L++V   ++VG+V FDS+A + + L+ I  G+ R TL + +    A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +     N++ +    ++ +A G  A   L +++  T G   +A+   Q   L   F + S
Sbjct:   29 NNGYEGIVVAIDPNVPE-DETLIQQIKDMVTQASLYLLEATGKR------FYFKNVAILIPETWKTKADYVRP-KLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNGR--IQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFK--KTTPMTTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELIQINSGSDRDTLAKRLP-AAASGGTSICSGLRSAFTVIRKKYPTDGS---EIVLLTDGEDN-----TISGCFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALS 476          
BLAST of Chloride channel accessory 4 vs. TrEMBL
Match: L5K694 (Calcium-activated chloride channel regulator 1 OS=Pteropus alecto OX=9402 GN=PAL_GLEAN10023929 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.269e-45
Identity = 222/861 (25.78%), Postives = 359/861 (41.70%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE---------EPLKNRLL----AFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFK-SGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARD--------LEDVGFYSFRADITINNTV--------NGDI--------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDI--LVRGDEKKKVLKIDLIATGND-----------GMIGNISDYEIK----IQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVD 2587
            NN ++ I++ I+ NV E +  L+ +I D V+ AS  L++AT           F  V I +P TW     ++ P       NA   VA  N   N++P T+Q+G CG+ G    F   F    KL     +G+ F+ E+  LR+GV++E            KN+ +    A  GKN +    G        +          EC++   K Q    SIMF     +   FC +++  HNK A NL N+KCN RS   VI + +DFK +   +       F++++     + LVLD SGSM   N ++ +  A   F L++V   ++VG+V FDS+A + S L+ I  GT R  L + +    A+GGT+I  GL     V+  +   D +    I+LLTDGE+N     +     N++ +    ++ +A G  A   L +++  T G   +A+   Q   L   F + S             E+  + L           +D  +G +    +T  A     ++ L+ P  KR       T ++ T  ++ +I GT   G++   L++ +           TL +TV+++ S        P   +++   K+     S  V     + G L     +V   IES N     L++ DNG G DA +DD +++R   A D        +  +G  + +  I   N          NG+I                      RT   GS + +        D   P +I D+   ++GD   K++ +   A G+D           G+  NI D   K     Q N T +I K   AN  E  +F+ E +         I+++ VD
Sbjct:  129 NNGYEGIVIAIDPNVPE-DETLIQQIKDMVTQASPYLFEATEKR------FYFKNVAILIPETWKTKPEYVRP-KLETFKNADVLVAESNPPGNDEPYTEQMGNCGEKGERIHFTPDFIAGKKLPQYGPQGRAFVHEWAHLRWGVFNEYNNDQKFYLSNGKNKAVRCSAAITGKNAVNKCQGGSCVTTPCRPNRTTGLYGKECEFIPDKEQMEKASIMFSQSINSVVSFCTEKN--HNKEAPNLQNQKCNLRSTWEVIRDSEDFKTTTPMTTQPPKPTFSLLQIGQRIVCLVLDKSGSMTSDNRLKRLNQAGRLFLLQTVEQGSWVGMVTFDSAAYVRSELVQINSGTERDALTKRLPTA-ASGGTSICTGLRSAFTVIKKKYPTDGS---EIVLLTDGEDN-----TISTCFNEVKQSGAIIHTVALGPSAAPELEELSKMTGGLQTYASDEAQNNGLMDAFGALSSGNGAVFQRSIQLESRGLTLQNNEWMNGTVIVDSTVGNDTLFLITWTAQPP--QILLLDPSGKR---QDSFTVDTNTKMAYLQIPGTAKVGIWNYSLQASSQ----------TLTLTVTSRASST----TLPPVTVTSKMTKDTVKFPSPMVVYAKIHQGALPILRASVTALIESVNGKTFTLELLDNGAGADATKDDGIYSRYFTAYDTNGRYSVKVWALGGVARQKKIPQQNGAMYIPGWIENGEIKWNPPRPEINKDDLQGKQVCFSRTSSGGSFVASNVPNAPIPDLFPPCQITDLKAKIQGD---KLINLTWTAPGDDYDHGRAYKYIIGISTNILDLRDKFNESFQVNTTDLIPKE--ANSEEVFVFKPESITFENGTDLFIAIQAVD 946          
BLAST of Chloride channel accessory 4 vs. TrEMBL
Match: H0UVF8 (VWFA domain-containing protein OS=Cavia porcellus OX=10141 GN=LOC100727546 PE=4 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 3.674e-45
Identity = 209/813 (25.71%), Postives = 351/813 (43.17%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQC-NNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPL---------KNRLLA-FDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS-GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSM---VNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSII-LLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIE-ETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKR------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--RADITINNT------------------VNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKI 2458
            N ++DI++ I+ +V E +GQ++ RI D V+ AS  L+ AT           F TV I +P TW   S +  P   H+   +A   VA   +   ++P T+Q  +CG    +  F   F    K N+    G+  + E+  LR+GV+ E    +P            R  A   GKN +    G        +          +C++   K Q    SIMF     +   FC++++  HN+ A +L N KCN RS   VI   +DF S            F++++ +   + LVLD SGSM     +I   + A +  +++V N ++VG+V FDSSA+I S L+ +   + R TL++ +    ANGGT+I  G+ K  +V+      D  + GS + LLTDGE+N     +    +N++IK  + ++ +A G  AD ++ ++   T GK + A+   +   L   F + + + +V    K+I+ E+  +NL       +   +D  +G +    +T    K    ++L  P       +   TQ++ +  ++  I G    G ++  L++  +          R  +     ITVSAK   N++ +  PS  I  +E+++                G +     +V   IES N     L + DNG G DA +DD V++R  Y     + G YS   RA    ++T                  VNG+I                     RT   G+ +++        D   P++I D+    + ++  L     A G D  +G +  Y I+I
Sbjct:   29 NGYEDIIIAIDPDVPE-DGQIIERIKDMVTTASTYLFDATEKR------FFFKTVSILIPETWKAYSEYRRPK--HETYKHADVIVAPPTLPNRDEPYTRQFTECGKKAEYIHFTPDFVLGKKENEYGPSGRLLVHEWAHLRWGVFDEYNEDQPYYSAKSKKIEATRCSASISGKNRVYKCQGGSCSTRNCRTNSTTKLYEKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKN--HNQEAPSLQNLKCNYRSTWEVIRKSEDFNSTTPMETPPPPPTFSLLRIRDRIVCLVLDKSGSMSAGSRLIRMNQAAKLFLMQTVENGSWVGMVHFDSSASIKSELIQVRSNSERDTLVKSLPT-QANGGTSICRGIEKAFEVIR---KVDPQLDGSEVGLLTDGEDN-----TVKNCVNEVIKSGVIIHFVALGPSADPAVTQMRNQTGGKEELASDKAENNGLIDAFAALTSE-NVGLSQKSIQLESKGLNLNTSAWMNDTVTVDSTVGKDTFFLVTW--TKQPPSISLWDPNGTL---TANFTQDTDSRMAYLSIPGDAQVGTWIYNLQAKADSETLTITVTSRAANSAVPPITVSAK--MNKDTNSFPSPMIVYAEVQQ----------------GYVPILGASVTAVIESSNGHTTVLDLLDNGSGADAFKDDGVYSR--YFTGYSENGRYSLKVRAHAATSSTRRSLKHALSRAAYIPGWVVNGEIEGNPPRPEADENTEIILENFSRTASGGAFVVSGYPNTPVTDPYPPSQITDLAATPEGEEVTLT--WTAPGEDFDVGKVERYIIRI 793          
BLAST of Chloride channel accessory 4 vs. TrEMBL
Match: H0VS80 (VWFA domain-containing protein OS=Cavia porcellus OX=10141 GN=LOC100727821 PE=4 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 9.960e-45
Identity = 205/812 (25.25%), Postives = 354/812 (43.60%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW-SNHLNPITWHQC-NNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPL---------KNRLLA-FDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFK-SGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSM---VNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGS-IILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIE-ETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSF-EIIGTPDPGMYVVELKSPTNKR------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--RADITINNT------------------VNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKI 2458
            +N ++DI+V I+ +V E +G+++  I D VS AS  L++AT           F TV I +P TW +N       H+   +A   VA   +   ++P T+Q  +CG+   +  F   F    K N+    G+  + E+  LR+GV+ E    +P            R  A   G+N +    G        K          +C++   K Q    SIMF     +   FC++++  HN+ A +L N KCN RS   VI   +DF  +           F++++ +   + LVLD SGSM     +    + A +  +++V N ++VG+V FDS+A+I S L+ +   T R TL++ +   YANGGT+I  G+ K  +V+      D  + GS I+LLTDGE+N     +    +N++ +  + ++ IA G  AD ++ +++  T G + +A+ N +   L   F + + + +V    K+I+ E+  +NL       +   +D  +G +    +T    K    ++L  P       +   TQ++ +  ++  I G    G ++  L++  +          R  +     ITVSAK   N++ +  PS  I  +E+++                G +     +V   IES N     L + DNG G DA +DD V++R  Y     + G YS   RA    ++T                  V+G+I                     RT   G+ +++        D   P++I D+    + ++  L     A G +  +G +  Y I+I
Sbjct:   29 DNGYEDIIVAIDPDVPE-DGEIIEHIKDMVSTASTYLFEATEKR------FFFKTVSILIPETWDANPEYKRPKHESYKHADVIVAPPTLPNRDEPYTRQFTECGEKAEYIHFTPDFVLGKKENEYGPSGRLLVHEWAHLRWGVFDEYNEDQPYYSAKSKKIEATRCSAGISGRNSVHKCQGGSCSTRSCKINPTTKLYEKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKN--HNQEAPSLQNLKCNYRSTWEVIRESEDFTNTTAMETPPPPPTFSLLRIRDRIVCLVLDKSGSMSAGSRLTRMNQAAKLFLMQTVENGSWVGMVHFDSTASIKSELIQVRSNTERDTLVKSLPT-YANGGTSICSGIAKAFEVIR---KVDPQLDGSEIVLLTDGEDN-----TAKNCVNEVTESGVIIHLIALGPSADPAVTQMSNQTGGNHYYASDNAENNGLIDAFAALTSE-NVGLSQKSIQLESKGLNLNTSAWMNDTVTVDSTVGKDTFFLVTW--TKQPPSISLWDPNGTL---TANFTQDTVSRMAYLSIPGDAKVGTWIYNLQAKADSETLTITVTSRAANSAVPPITVSAK--MNKDTNTFPSPMIVYAEVQQ----------------GYVPILGASVTAVIESSNGHTTVLDLLDNGSGADAFKDDGVYSR--YFTGYSENGRYSLKVRAHAATSSTRRSLKHALSRAAYIPGWVVDGEIEGNPPRPEADENTETILENFSRTASGGAFVVSGYPNTPVTDPYPPSQITDLAATPEGEEVTLT--WTAPGENFDVGKVERYIIRI 794          
BLAST of Chloride channel accessory 4 vs. TrEMBL
Match: F7CCL6 (Chloride channel accessory 4 OS=Callithrix jacchus OX=9483 GN=CLCA4 PE=4 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 2.248e-44
Identity = 218/815 (26.75%), Postives = 352/815 (43.19%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNP----ITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQC-----------MESNT-----ECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK-FNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAFL-ESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFAN---PNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKR------FKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--------------------RADITINNTVNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIK 2455
            NN F+DI++ I+ +V E + +++ RI D ++ AS  L++AT           F  V I VP  W    NP      +    +A   VA   +   ++P TKQ  +CG+ G    F   F    K N+    G+ F+ E+  LR+GV+ E        +   K      C   I  + +   H+C           ++S T     +C++   K Q    SIMF     +   FC++++  HN+ A +L N KCN RS   VI N +DFK+ K  +       F+++K     + LVLDTSGSM+  N +  M  A   FL ++V N ++VG+VRF+S+ATIL+ L+ I     R TL+ ++    A GGT+I  G+    QV+G   +  +     I+LLTDGE+N     +    I+++ +    V+ IA GK AD ++ +++  T G + +A+    N    D  G   S +  IS   L     E+  + L       +   ID  +G +    +T   D     + L  P    I+ +  +   S   +   I GT   G +   +++ TN          R  +     ITV+AK   N++ +  PS  I  +EI              L     +   NVT  ++ +S N  +  L++ DNG G D+ ++D V++R   A    + G YS                     RA       VNG+I                     RT+  G+ +++Q  +    D   P++I D+     E + VL     A G+D  +G +  Y I+
Sbjct:   28 NNGFEDIIIVIDPSVPE-DEKIIERIQDMLTTASTYLFEATEKR------FFFKNVSILVPEKWKE--NPQYKRPKYENYKHADVIVAPPVLPGRDEPYTKQFTECGEKGEHIHFTPDFLLGKKQNEYGPSGRLFVHEWAHLRWGVFDEYNEDQPFYSAKSKKIEATRCSTGI--SGINRVHKCQGGSCLTRTCRVDSTTKLYEKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKN--HNQEAPSLQNIKCNFRSTWEVISNSEDFKNTKPMVTPPPPPVFSLLKISQRIVCLVLDTSGSMLSHNRLNRMNQAAKQFLMQTVENGSWVGMVRFNSTATILNKLIQIISSNERNTLLEKLPT-RAQGGTSICSGIKSAFQVIGELYSQLDG--SEIVLLTDGEDN-----TASSCIDEVKQSGAIVHFIALGKDADKAVIEMSNITGGSHLYASDEAENNGLIDAFGALTSGNAGISQKSLQL---ESKGLTLSSNAWMNDTVIIDSTVGKDTLFLITW--DTLPPSIFLWDPSGT-IMGNFTVDAVSKMAY-LSIPGTAKVGTWAYNIQAKTNPETLTITVTSRAANSSVPPITVNAK--MNKDINSFPSPMIVYAEI--------------LQGYVPVLGANVTAFIESQSGNTEV--LELLDNGAGADSFKNDGVYSRYFTA--YTENGTYSLKVRVHGGTNTARLSLWHPLNRAAYIPGWVVNGEIEANPPRPENNEDTQATLENFSRTVSGGAFVVSQVPSLPLPDLYPPSQITDLDATPHEDEIVLT--WTAPGDDFDVGKVQHYIIR 792          
BLAST of Chloride channel accessory 4 vs. TrEMBL
Match: A0A2K5DGT9 (Chloride channel accessory 4 OS=Aotus nancymaae OX=37293 GN=CLCA4 PE=4 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.864e-44
Identity = 214/818 (26.16%), Postives = 350/818 (42.79%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNP----ITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSE----EPL---KNRLL-------AFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK-FNIVKGQTEKIVLVLDTSGSMV--NIIENMKLATIAF-LESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQ---YTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSK----------NRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSF--------------------RADITINNTVNGDI-------------------IRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKI 2458
            NN F+DI++ I+ +V E + +++ +I D ++ AS  L++AT           F  V I VP  W    NP      +    +A   VA   +   ++P TKQ  +CG+ G    F   F    K N+    G+ F+ E+  LR+GV+ E    +P    K++ +          G N +    G        +          +C++   K Q    SIMF     +   FC++++  HN+ A +L N KCN RS   VI N +DFK+    +       F+++K     + LVLD SGSMV  N +  M  A   F L++V N ++VG+V FDS+ATI++ L+ I     R TL+ ++   +A GGT+I  G+    QV+G   +  +     I+LLTDGE+N     +    I+ + +    V+ IA GK AD ++ +++  T G + +A+   Q     D  G   S + DIS   L     E+  + L       +   ID  +G +    +T   D+    + L  P N  I+ +  +   S   +   I GT   G +   +++      K N++  T+ +T  A  S           N++ +  PS  I  +EI              L     +   NVT  ++ +S N  +  L++ DNG G D+ ++D V++R   A    + G YS                     RA       VNG+I                     RT   G+ +++Q  +    D   P++I D+     E + VL     A G+D  +G +  Y I+I
Sbjct:   28 NNGFEDIIIVIDPSVPE-DEKIIEQIQDMLTTASTYLFEATEKR------FFFRNVSILVPENWKE--NPQYKRPKYENYKHADVIVAPPTLPGRDEPYTKQFAECGEKGEHIHFTPDFLLGKKQNEYGPSGRLFVHEWAHLRWGVFDEYNEDQPFYSAKSKKIEATRCSTGISGINRVYKCQGGSCLTRTCRVNSTTKLYEKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKN--HNQEAPSLQNIKCNFRSTWEVISNSEDFKNTTPMVTSPPPPVFSLLKISQRIVCLVLDKSGSMVSDNRLNRMNQAAKQFLLQTVENGSWVGMVHFDSTATIINKLIQIISSNERNTLLEKLPT-HAQGGTSICSGIKSAFQVIGELYSQLDG--SEIVLLTDGEDN-----TASSCIDLVKQSGAIVHFIALGKDADEAVTQMSNITGGSHFYASDEAQNNGLIDAFGALTSGNADISQKSLQL---ESKGLTLNSTAWMNDTVIIDSTVGKDTFFLITW--DRLAPSIFLWDP-NGTIMGNFTVDAASKMAY-LSIPGTAKVGTWAYNIQA------KENSETLTITVTSRAANSSVPPITVNAKMNKDINSFPSPMIVYAEI--------------LQGYVPVLGANVTAFIESQSGNTEV--LELLDNGAGADSFKNDGVYSRYFTA--YTENGRYSLKVRAHGGTNTARLSLRHPLNRAAYIPGWVVNGEIEANPPRPENNEDTQATLENFSRTASGGAFVVSQVPSFPLPDLYPPSQITDLDATPHEDEIVLT--WTAPGDDFDVGKVQHYIIRI 793          
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Match: ENSAMXT00000007776.2 (calcium-activated chloride channel regulator 1 [Source:NCBI gene;Acc:103026350])

HSP 1 Score: 156.377 bits (394), Expect = 1.727e-38
Identity = 186/691 (26.92%), Postives = 302/691 (43.70%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIK---WNVVKDRHQCMESNTE-------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSI-----IYENVKFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYL--MHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGT-TFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKEL---GXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADIT 2233
            N + D+L+ IN  V + N +L+N+I D +++ S+ L+ A          V F  V I VP TW  +         + A  F+   N    ++P TKQ+  CG+ G +  F   F     L D +  R K F+ E+  LR+GV+ E   +     F G N     C  DI+   + V   +H    ++         C++   + Q ++ SIM+     + + FC      HN  A N+ NKKC+ RS ++VI           ++           F +++ Q   I L+LD SGSM    I+   + AT+   E V   A VGIV+F ++A I+S L  +     R  LIR +     +G TN+ +GL  G +VL     +D +  G  +I LTDGE  + +    +  +  ++     VN IA G  A   L  +   TNGK+  A+ +     L   F   S  +S     K   + ++I             IDR +G     T T+  +KS   V +  P   R+     +T +  T T +  I GT +PG +        N R        T+ +TV+++ +++   D++P   I T+E+ +    G    V       N   +    V   ++ ++ +  L HL   DNG G D ++DD V++R  Y   L++ G YS +  +T
Sbjct:   26 NGYTDLLIAINPAVPQ-NDELINQIKDMITSGSQYLFHAVEDK------VFFKEVKILVPPTWKGNYERAKRETYDKASVFIDRPNPIFGDEPYTKQMKGCGEEGEYIHFTPDFLLDDDLLDAYGTREKVFVHEWAHLRWGVFDEYSEEEPFYLF-GNNIEPTRCIKDIRGRNYKVTNGKHVHCPTDVATGLPIKGCQFFPDREQENSASIMYMQSLDSVKAFCG--FMDHNYEAPNMQNKKCDYRSTSSVIFGSSVDSDALNTLQPLPSPPPPPTFTVIQRQHRVICLILDVSGSMKGERILRLQQAATLFLSEIVEEGAQVGIVKFSTNAEIVSPLTTLQGKESRDGLIRHLPKT-VDGSTNMCNGLNLGFEVLK---KDDGSTKGDDLIFLTDGEATDKV----EDCLQSVVDSGAIVNTIALGPSASSVLITMANLTNGKFIVADQSLLSNQLVDAF--TSFILSDGDPTKQAIQLVSIGKNTADWFNGTVPIDRTVGNG--TTFTVIYEKSIPTVHIEAPSG-RVYNQTHVTNHQETKTITLNIPGTAEPGDWKYSF---LNIRAAAQ----TMTLTVTSRAARD---DVNPI--IVTAEMNQPSADGSKPMVVYAEVKQNRMPVLGAKVMATMESDTGHSELLHL--LDNGAGADTLKDDGVYSR--YFTKLKN-GRYSLKVQVT 676          
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Match: ENSAMXT00000037970.1 (calcium-activated chloride channel regulator 1 [Source:NCBI gene;Acc:103026350])

HSP 1 Score: 139.428 bits (350), Expect = 3.144e-33
Identity = 172/642 (26.79%), Postives = 276/642 (42.99%), Query Frame = 2
Query:  383 VQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIK---WNVVKDRHQCMESNTE-------CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSI-----IYENVKFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYL--MHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGT-TFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKEL---GXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADIT 2233
            V F  V I VP TW  +         + A  F+   N    ++P TKQ+  CG+ G +  F   F     L D +  R K F+ E+  LR+GV+ E   +     F G N     C  DI+   + V   +H    ++         C++   + Q ++ SIM+     + + FC      HN  A N+ NKKC+ RS ++VI           ++           F +++ Q   I L+LD SGSM    I+   + AT+   E V   A VGIV+F ++A I+S L  +     R  LIR +     +G TN+ +GL  G +VL     +D +  G  +I LTDGE  + +    +  +  ++     VN IA G  A   L  +   TNGK+  A+ +     L   F   S  +S     K   + ++I             IDR +G     T T+  +KS   V +  P   R+     +T +  T T +  I GT +PG +        N R        T+ +TV+++ +++   D++P   I T+E+ +    G    V       N   +    V   ++ ++ +  L HL   DNG G D ++DD V++R  Y   L++ G YS +  +T
Sbjct:   17 VFFKEVKILVPPTWKGNYERAKRETYDKASVFIDRPNPIFGDEPYTKQMKGCGEEGEYIHFTPDFLLDDDLLDAYGTREKVFVHEWAHLRWGVFDEYSEEEPFYLF-GNNIEPTRCIKDIRGRNYKVTNGKHVHCPTDVATGLPIKGCQFFPDREQENSASIMYMQSLDSVKAFCG--FMDHNYEAPNMQNKKCDYRSTSSVIFGSSVDSDALNTLQPLPSPPPPPTFTVIQRQHRVICLILDVSGSMKGERILRLQQAATLFLSEIVEEGAQVGIVKFSTNAEIVSPLTTLQGKESRDGLIRHLPKT-VDGSTNMCNGLNLGFEVLK---KDDGSTKGDDLIFLTDGEATDKV----EDCLQSVVDSGAIVNTIALGPSASSVLITMANLTNGKFIVADQSLLSNQLVDAF--TSFILSDGDPTKQAIQLVSIGKNTADWFNGTVPIDRTVGNG--TTFTVIYEKSIPTVHIEAPSG-RVYNQTHVTNHQETKTITLNIPGTAEPGDWKYSF---LNIRAAAQ----TMTLTVTSRAARD---DVNPI--IVTAEMNQPSADGSKPMVVYAEVKQNRMPVLGAKVMATMESDTGHSELLHL--LDNGAGADTLKDDGVYSR--YFTKLKN-GRYSLKVQVT 625          
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Match: ENSAMXT00000007818.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5630898:5645307:1 gene:ENSAMXG00000007608.2 transcript:ENSAMXT00000007818.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 4.475e-31
Identity = 131/455 (28.79%), Postives = 194/455 (42.64%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNH-LNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSE----EPL---KNRLLA------------FDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSG-----KTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKIT--TGTN 1498
             N + D+L+ IN  V + N +L+NRI   ++  S+ L +A          V    V+I VP TW+ +          + A   V   N    ++P TKQ+  CG+ G    F   F     L   F  R K F+ E+  LR+GV+ E    +P    KN+ L             +D  +     C  D K  +             CK+   K+Q  + SIMF       + FC+D    HN  A N  NK+CN RS   +I  H    +               KF +V+ ++    L+LD SGSM    I    + A +   E V   A V IV+F + A+I S L  I     R  LI+ +    A GGT +  GL+K ++VL  +   D + IG  +I LTDGE ++NI    +      +K    +N +A G  A + L  +   TGT+
Sbjct:   25 GNGYTDLLIAINPAVPQ-NDELINRIKTMITKGSEYLLEALDRK------VFIKEVNILVPPTWTGYSFTKARRETYDKANVIVGHPNTAFGDEPYTKQMKGCGEEGEHIHFTPDFLLKDDLLKVFGPREKVFVHEWAHLRWGVFDEYNKKQPFYWSKNQQLEHTRCSGKIAGKLYDVSSGSPLPCSYDPKTGL---------PTKGCKFIPNKDQKTSSSIMFMPSLDAVKTFCEDGD--HNTEAPNRQNKECNFRSTRTIIYKHSVDSAALKTLTPLKTKPPPPKFRVVQRKSRATCLILDVSGSMSGERIRRQQQAAALFLSEIVEEGASVAIVQFSNDASIRSPLTKIKGKASRDALIKNLPT-SAGGGTYMCKGLLKSLEVLKAD---DGDTIGDDVIFLTDGEASDNI----NTCFQTAVKSGAIINTLALGPSASVILKTMADQTGTD 453          
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Match: ENSAMXT00000054901.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5707968:5721043:-1 gene:ENSAMXG00000007580.2 transcript:ENSAMXT00000054901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 6.972e-27
Identity = 120/437 (27.46%), Postives = 189/437 (43.25%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGK---NHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHK----DFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGT 1495
            N + D+L+ IN  V + N +L+NRI   +++ S+ L +A  +       V    V I VP  W+           +    F  +  +    +P TKQ+  CG+ G +     +F     L+D+F      RG+  +  +V +   +  +     R     G+     ++ V G+ +      D    + +   C++   K Q  N SIM+     + + FC D    HN  A N  NK+CN RS  +VI  H       ++           F  V+ +   I L+LD SGSM    I+   + AT+   E V   AYVGIV+F + A+I ++L  I     R TLIR +    A GGT +  GL+K  +V       D   IG  +I LTDGE ++NI   +   +N        +N +A G  A + L  +   T
Sbjct:   26 NGYTDLLIAINPAVPQ-NDELINRIKIMITDGSEYLHQALDNK------VFIKEVKILVPPNWNGSYEKARRETYDKVQHFNQILRL----RPYTKQMKGCGEEGEYVHLTPNFL----LDDSFLKSYGPRGETSVHVYVHVAQKLSWQHYSPTRPFQCSGRIAGKLVEVVNGSALP--CYYDPKTSLPTEG-CQFLPDKYQQTNASIMYIQSLDSVKTFCGDEE--HNTEAPNQQNKECNFRSTRSVIYKHSVDSAALQTLTPVPSPSPPTFREVQRRNRVICLILDVSGSMAGGRILRQQQAATLFLSEIVEEGAYVGIVQFSNDASIRNHLTKIKGKASRDTLIRNLPT-SAGGGTYMCKGLLKSFEVRNS--MYDGETIGDDVIFLTDGEASDNIQNCFKDAVN----SSAIINTLALGPSASVILKNMADET 435          
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Match: ENSAMXT00000007808.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5707968:5721043:-1 gene:ENSAMXG00000007580.2 transcript:ENSAMXT00000007808.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 1.817e-24
Identity = 120/437 (27.46%), Postives = 190/437 (43.48%), Query Frame = 2
Query:  236 NKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-----KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGK---NHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHK----DFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVN--IIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGT 1495
            N + D+L+ IN  V + N +L+NRI   +++ S+ L +A  +       V    V I VP  W+           +  +  +    I +  +P TKQ+  CG+ G +     +F     L+D+F      RG E     +   + ++ +  +   L    G+     ++ V G+ +      D    + +   C++   K Q  N SIM+     + + FC D    HN  A N  NK+CN RS  +VI  H       ++           F  V+ +   I L+LD SGSM    I+   + AT+   E V   AYVGIV+F + A+I ++L  I     R TLIR +    A GGT +  GL+K  +V       D   IG  +I LTDGE ++NI   +   +N        +N +A G  A + L  +   T
Sbjct:   26 NGYTDLLIAINPAVPQ-NDELINRIKIMITDGSEYLHQALDNK------VFIKEVKILVPPNWNGSYEKARRETYDKYIHSLRHGRILR-LRPYTKQMKGCGEEGEYVHLTPNFL----LDDSFLKSYGPRG-ETSVHGIDSHWNLFRDFRVNFCLCTCSGRIAGKLVEVVNGSALP--CYYDPKTSLPTEG-CQFLPDKYQQTNASIMYIQSLDSVKTFCGDEE--HNTEAPNQQNKECNFRSTRSVIYKHSVDSAALQTLTPVPSPSPPTFREVQRRNRVICLILDVSGSMAGGRILRQQQAATLFLSEIVEEGAYVGIVQFSNDASIRNHLTKIKGKASRDTLIRNLPT-SAGGGTYMCKGLLKSFEVRNS--MYDGETIGDDVIFLTDGEASDNIQNCFKDAVN----SSAIINTLALGPSASVILKNMADET 437          
BLAST of Chloride channel accessory 4 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 157.918 bits (398), Expect = 9.901e-40
Identity = 183/701 (26.11%), Postives = 307/701 (43.79%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTW---SNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAV-CGNDI--------KWNVVKDRHQCMESNTE-----CKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVK--FNIVKGQTEKIVLVLDTSGSM--VNIIENMKLATIAFLESVGNSA-YVGIVRFDSSATILSYLMHIGTHRA-TLIREIQNLYANGGTNIPDGLVKGVQVL---GGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDIS-VDHLIKAIEET-ITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNC--GILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINN 2242
            NN ++ +++ IN  V E + QL+N I D ++NAS  L++AT +       + F  V I +P++W   S +  P +       +  V+ D+   N  P T Q G CG+PG +     +F       + +  RGK F+ E+  LR+G+Y E    +++  +  K  I+   C  D+        + + V  R+  ++  T      C +     Q    SIM        + FC      HNK A  LHN+ C  +S   ++  H DFK      +  + +  F +++     + LVLD SGSM   N ++ M+ A+  F+  + ++   +GI+ F+S A     L  I    +  LI+    +  NGGTN+  G+    QVL    G+++ D      I+LLTDGE++          + ++   +  V+ IA G  AD +L K+TT   G    A+ N     L   F S   D      L+  +E T  ++N  E +  +    +D  IG N +  +T  A  +  E+ +I P N     +  +      T    I GT  PG +  +LK   NK   ++     +AI++++  S +   ++ P   I    +K       ++          G       TVI  IE PN+    LQ+ DNG G DA ++D +++R  +       G YS +  +  +N
Sbjct:   30 NNGYEALVIAINPAVPE-DPQLINAIKDMITNASSDLFRATKYR------LYFRNVSILIPASWKTNSIYNRPKSESYGAADVLIVSRDDPTDNS-PYTHQFGLCGEPGQYIHLTPNFLLTDHYLEAYGPRGKVFVHEWGHLRWGLYDE--YNDQVPFYLDKGKIEFTRCSKDLTGGHVMVMRNDSVSTRNCNIDPKTGLPEEGCTFFPDVVQTATSSIMSIQALDNVKEFCSVNQ--HNKAAPTLHNRLCASKSTWQIMQRHNDFKVKTKLPVGTDTQPSFTLLQPTARVVTLVLDVSGSMNGANRLQRMRQASENFIMKILDAGTLIGIIVFNSKANTNLALTKITDEASRVLIKNNLPMNVNGGTNVCAGVRHAFQVLRALDGDVSGDE-----IVLLTDGEDSG-----ISSCVAEVQNSQCIVHTIALGPNADPALEKLTTAEGGMKFSASDNLDTNSLVDAFSSAKADDGDTSSLVLQLESTGQSLNSGETMKGE--IQVDASIGNNTQFVVTWLA-STVPEMHIIDPDNFDYQNNNFVIDTVFKTARLTIKGTSKPGTWTYKLK---NKHSVKDN----IAISITSSQSNS---NLPP---IEVKVVKPTDSNDKLSAMQVFAEVKQGSTPVVGATVIATIERPNEKPLELQLFDNGAGADAKKNDGIYSR--FFAQFTATGRYSLKVKVVGDN 690          
BLAST of Chloride channel accessory 4 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 148.673 bits (374), Expect = 1.028e-36
Identity = 213/877 (24.29%), Postives = 334/877 (38.08%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWS--NHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATK-LNDTFKRGKEFMREFVKLRYGV---YSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNT--ECKYEII------------KNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSM---VNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDIS-VDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAK--PSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINNTVNGDIIRRTL----------DLGSLIINQ-------------------KQTKKFEDKILPAKIDDI--------LVRGDEKKKVLKIDLIATGNDGMIGNISDYEI--------KIQSNETIVIRK----------TAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSN 2617
             N ++ +++ IN  V E + +L++ I   V++AS  L  AT+        V F  V I +PS+W+  N+  P T+     A   V   +  +++ P T+Q G+CG+PG + +   +F    K L     RG+ F+ E+   R+G+   YSEE         +GKN     C  DI   + K   +   + T  +CK E              + Q    SIM      +   FC    + HN+ A N  N+ C   S   V+L H D  +   + +     F +++     I LVLD SGSM   + +   ++ A I  ++ +      GIV F+S A     L  I       ++      A GGTNI  GL +G QVL  +   D +  G  IIL+TDGE+                    T++ IA G  A   L+     T+G   +A+ +     L   F S + D   +D L+  +E T  + L   +       ID  IG N +  +T     S  E+ +  P N        +   +  T    I G+   GM+   L    NK    +T   T+    S+K  P    E  +   G IS S +    +    T          +   NVT +  IE P      +++ DNG   D  +DD V++R  Y       G YS +  +  +        RR            + G L + Q                        F+  + P    DI        L    +   ++ +   A G+D   G  S YEI         +   E +++ +           A A   E   F + + ++   N    SVR +D   N GE SN
Sbjct:   32 GNGYEGLVIAINPTVPE-DPKLIDAIKGMVTDASAYLHAATNRR------VFFKNVSILIPSSWTSKNYTRP-TYEYYGKADVLVHPWDDPEDDSPYTQQYGQCGEPGQYIQLTPNFLLDDKNLKAYGPRGRAFVHEWGHFRWGLFDEYSEE----EPFYVNGKNPEFTRCSRDITGGIGKVNCRVGGACTVDKCKIESTGLPEKGCSFFPDEVQTAKESIMGLQWINSVNTFC--TAKTHNRLAPNRQNRLCGLSSAWEVMLKHDDINNTSPASVPTQPTFTLLQPSARVITLVLDKSGSMGGAMRLPRLLQAAEIFIMQILQEGDTAGIVTFESGAQTQCRLTEITAASRETLKSCLPKNAGGGTNICAGLTQGFQVLSAD---DGSASGDEIILMTDGEDGG-----ISSCFEAARGSGCTIHTIALGPSAVNGLDNFAELTDGLNFYASDSLNTNALKDAFTSITEDRGPLDALVIQLESTGKL-LSSNLWMDGDVNIDASIGNNTQFVVTW--QSSVPEMHITDPNNVAYQNGDFVIDGTFKTARLTIPGSAQAGMWKYRL---VNKAGMPDTLTLTVTSMASSKGVPPITVEAHMKAFGSISLSALTIYAEVKRGTTP--------VVGANVTAL--IERPGSATLEIELLDNGASADIKKDDGVYSR--YFTQYTSSGRYSLKVRVAGSKGTTRLAPRRGSKAIFIPGFRNEKGELEVTQVPAPAGGQVLVPSEDFSRVASGGSFQATVPPGGPPDIYPPSRVLDLTAELQAPGIVSLAWTAPGDDADFGQASKYEIITSDSIEGLLNGTEEMIVPEDNVTMGNTSDPAVAGSTET--FAISIAELQPGNSLYFSVRAIDKKNNKGENSN 866          
BLAST of Chloride channel accessory 4 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 143.665 bits (361), Expect = 3.231e-35
Identity = 188/699 (26.90%), Postives = 290/699 (41.49%), Query Frame = 2
Query:  233 NNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWS---NHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTF-KRGKEFMREFVKLRYGVYSE----EP--LKNRLLAF--------DGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGK--TSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKL---ATIAFLESVGNSAYVGIVRFDSSATI---LSYLMHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIG-SIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCD-ISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAK----PSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADIT 2233
            NN ++ +++ IN  V E + QL++ I D V +AS  L+KAT+ +        F  V I +PS WS   N+  P  +     A   +A  +  +++ P T+Q G+CG+PG + +   +F  A K  D +  RG+ F+ E+  LR+G++ E    EP  L    + F         G   +        K    K     +     C +   K Q    SIM        E FC      HN+ A NL N+ C+  S  +++  H+DF + +   + +     F++++     I LVLD SGSM       +L   A I  ++ +     VGIV FDSSA     L+ +   G+  A  ++      A G TNI  G+ KG QVL G+   D +  G  I+L+TDGE +  I   ++ V         T++ IA G  A   L K+   + G   FA+ N     L   F S + D    D L+  +E T  + L           ID  IG N +  +      S  E+ +  P N        +   +  T    I G    G +   L    NK    +TD  TL +T  A     P    E ++   G IS S +    +    T          +   NVT +  IE P      +++ DNG   D  ++D V++R  Y       G YS +  + 
Sbjct:   33 NNGYEGLVIAINPAVPE-DPQLIDAIKDMVGDASAYLFKATNRL------AYFKHVSILIPSFWSSQSNYTRP-KYESYGKAEVRIASLDDPEDDSPYTQQYGQCGEPGQYIQLTPNFLLADKNLDAYCPRGRAFVHEWGHLRWGLFDEYNEDEPFYLHGNNVEFTRCSRGVTGGTGVVSCSSIGSCKVQACKIGINGLPEQG-CMFFPDKVQMARESIMALQWLDNVEEFCTVNS--HNRNAPNLQNRLCSSSSAWDIMQKHEDFNNNEPPPADVPTQPTFSLLRPSHRVITLVLDKSGSMSGGSRLQRLRQAADIFIMQILEEGEMVGIVTFDSSAQTKCGLTLITDTGSRVA--LKSCLPTGAGGETNICAGVSKGFQVLSGD---DGSASGDEIVLMTDGE-DGGISSCFEAVRT----SGCTIHTIALGPSAVKELEKLAELSGGLNFFASDNVDGNALGDAFTSITTDNGDSDALVIQLESTGKV-LNSNQWMDGDVNIDASIGNNTQFVVIW--QSSVPEMHITDPNNVTYQNGDFVIDGTFKTARLTIPGRAMTGTWKYWL---INK--AGSTDTLTLTVTSMASSKGVPPITVEANMQAFGSISLSALTIYAEVKRGTTP--------VVGANVTTL--IERPGSATLEIELLDNGASADIKKNDGVYSR--YFTQYTSSGRYSLKVRVA 690          
BLAST of Chloride channel accessory 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001292.1 (pep scaffold:Pmarinus_7.0:GL483362:405266:418426:-1 gene:ENSPMAG00000001157.1 transcript:ENSPMAT00000001292.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 2.255e-9
Identity = 81/317 (25.55%), Postives = 126/317 (39.75%), Query Frame = 2
Query: 1289 GVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKF-FSQSCDISVDHLIKAIE-ETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSG-TTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSG-GISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGF--YSFR 2221
            G QVL  +  N + +   IILLTD  +  N     +  +  + + +  V+ IA G    M   +++  T G   FA  N     L   F  + + D + + ++  +E +  +I++ E V  Q   Y+D  IG + K  +T   + S     LIT  N R   +     ++   T    I G   PG +   + +    R        TLA+T     S+     + P G  +  S  +E            L   G        V   +E P     HLQM DNG G D I+DD +++R  Y     D G   YSF+
Sbjct:    1 GTQVLSQD--NGDALGDEIILLTDAGDTTN-----ENCLETVQQCQCVVHTIALGNTPTMEFEQLSASTGGLQLFATDNVDSNGLVDAFTLTGNRDGNWESMVIQLESKAFSIDVEEYV--QGTVYLDSTIGNDTKFVVTGVTNGSMR--ILITSPNGRAYNASDFNVDANFNTSRLTIPGIAKPGPWSYFIGNDGQAR-----ALLTLAVT-----SRVASPGVPPIGVTVRVSGTEEAAAQRRPVSLHALVAQGFRAISGANVTAVVEVPGADAFHLQMLDNGAGADVIKDDGIYSR--YFTQNSDAGSDQYSFK 294          
BLAST of Chloride channel accessory 4 vs. Planmine SMEST
Match: SMESG000080916.1 (SMESG000080916.1)

HSP 1 Score: 1691.4 bits (4379), Expect = 0.000e+0
Identity = 833/840 (99.17%), Postives = 836/840 (99.52%), Query Frame = 2
Query:  167 MKYLYICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINNTVNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSNSVPYNWKYEKIIEDRLGRKNSEK 2686
            MKYLYICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEE NGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPL+NRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLN ITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKN+ERDISPSGGISTSEIKELGDTTSVTVDVDLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDA+EDDKVFTRVLYARDLEDVGFYSFRADITINN VNGDIIRRTLDLGSL INQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSNSVPYNWKYEKIIEDRLGRKNSEK
Sbjct:    1 MKYLYICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEENGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLRNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNMITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNKERDISPSGGISTSEIKELGDTTSVTVDVDLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAMEDDKVFTRVLYARDLEDVGFYSFRADITINNIVNGDIIRRTLDLGSLRINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSNSVPYNWKYEKIIEDRLGRKNSEK 840          
BLAST of Chloride channel accessory 4 vs. Planmine SMEST
Match: SMESG000080918.1 (SMESG000080918.1)

HSP 1 Score: 409.068 bits (1050), Expect = 8.669e-129
Identity = 274/772 (35.49%), Postives = 427/772 (55.31%), Query Frame = 2
Query:  380 GVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEK--PITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQ---CMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS--GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFLES-VGNSAYVGIVRFDSSATILSYL--MHIGTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGEN---NNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFS--QSCDISVDHLIKAIEETITINLYEKVHTQN-------LTYIDRYIGVNLKITMTIPA-DKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINNTVNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSNSVP 2626
            GV+FG V I +PS W    +  +   C +A     ++ + K  K  P TKQL KCG  G +   P    K T       RG++ MRE+VKLRYGVY EE + N+         + +VC ++I+    +   +   C +SN  C ++I KNQ+HN+S+MFDTET +S+YFCDD++R HNKYA N  NK CN++S+T+VILNH DFK+      I YE   FNI++ +  KIVL+LD SGSM + I  MK A   F+ + + ++A +G+V F  SA+ LS +  M+   ++  +   + N+Y +GGTNI  GL  GV+VLGG I N+  + G+++LL+DGEN   N ++P  Y+ +++ +++K +  N ++Y + +D+ L K+T  T G +     N+   D+  +F    +SCD       K  E T+   L EK+             ++D+ +G + KI+++I +   S Y++ L T  N  I  + KI  N    + F I  +   G   VE     +KR KR+        ++      + ER   P   +S S ++E+   T +T  V LTN        V V L+IE PN  +   +M D+GL DD+I+ D VFT+++  +D+   G Y+F+  I I    +  I+R+ +   SL++       F DKI PA++++ +++   K K++K+  IATGNDGM G IS YEI I+S+   +I K+ +A P E+I   +++  + +    EIS+RGVD + NFG WS  VP
Sbjct:    7 GVKFGKVSIIIPSHWKLKGDSNSGLHCGDA----QINILPKTPKNIPFTKQLRKCGISGEYISIPTDILKLTG------RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEPPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKLSDMIPMNKMENKKIINNLLDNIYVHGGTNIGHGLQIGVEVLGGTIFNNATLDGTLLLLSDGENHEENEDMP--YNDIVDVIVRKSIQTNVVSYNQ-SDVLLTKLTRNTGGNFVHVKINSSSLDIMNRFARALESCD------GKLKENTV---LKEKIVVSQKSGKRIPFIFVDKLMGDDRKISISISSLTASKYDLKLTTKNNMEIKLTAKIPDNDKVAYCFSIPNSIKSGNLYVEFIRKGSKRVKRSLKEKPFIYSLDNTIFTDDERRFHPEAQLSHSFVEEVNGNTIITATVFLTNFYSSNLYLVRVSLEIELPNSIIVKKKMMDDGLEDDSIKGDLVFTKLILPKDISKKGVYNFKGIIEIYKEHSLQILRKDVIFNSLLVKNVSPSAFIDKIPPAQMEEPVIK-ILKNKLIKLKTIATGNDGMEGKISKYEILIRSSSDYIIEKSVYAEPYERIEIILDISNIMLQKVGEISIRGVDYNGNFGMWSFGVP 755          
BLAST of Chloride channel accessory 4 vs. Planmine SMEST
Match: SMESG000080919.1 (SMESG000080919.1)

HSP 1 Score: 404.445 bits (1038), Expect = 3.261e-126
Identity = 271/838 (32.34%), Postives = 452/838 (53.94%), Query Frame = 2
Query:  185 CFGLL-SFVYA---EYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMDHVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALF-FVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLN--DTFKRGKEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDF-KSGKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFL-ESVGNSAYVGIVRFDSSATILSYLMHI--GTHRATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGENNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFANPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINL-YEKVHTQNLTYIDRYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEIIGTPDPGMYVVE-LKSPTNKRFKRNTD-----FFTLAITVSAKPSKNRERDISPSGGISTSEIKELGXXXXXXXXXXLTNCGILKDENVTVILKIESPNKPLKHLQMTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADI-TINNTVNGDIIRRTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGNDGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFEISVRGVDNSFNFGEWSNSVPYNWKY 2641
            C  L+ S +Y    E +LDS    Q+ ++ I++ + + + +L+  I   +  ASKSL+KATS+++ +  G++FG + I VP+ W   +        + A F  V   N   ++KP TKQ  KCG PG ++RF   FF    LN  D+ K+GK  M+EFVKLRYGV+SE P KN L   +  + I+ +C  +I+W V     +C + N+ CKY I  NQ+HN+SIMFD+++ TS+YFC+D+ R HN  AYNLHN  C  +SV++VI+ H+DF K+      Y+   F I+  +  +IVLVLD SGSM    + +K     F+ E    SA + IV ++    I+S L  +     R  L  +++ +   G + I  G+  G+ +L    T   N + ++IL+TD + + +  Y Y  +I  L + ++ ++ +++ K ++ +L K+  G+NG Y+  + N    ++  K   ++   ++D  I+   +  +    Y   +  N+T ++  I  NL+  M   ++KS  E   I PK+  + P         T   FEI G   PG Y +  LKS    +   N          +  ++ A+  K+ +R I+P G IS +  +E+   T +TV VDL+ C I  +E   VIL+I  P+       + D+G+GDD+I +DK++T  +Y +DL + GFY+F A +  IN     + I+RT+   SL +   +   + D I PA++  + ++  ++ ++ ++   ATG+D M G I+ Y+I ++S E         A P E+I F+++L  ++  +  E++VRG+D++ N GEWS  VP N K+
Sbjct:    9 CLNLVFSQIYCQTQEVFLDSERNIQNFVIQISEKISKYDRKLIENIKISMEQASKSLYKATSNLDKSQPGIKFGKIFISVPNQWQTEIQVSPKKFTDKAHFKIVPRKNKKNSDKPWTKQYPKCGKPGKYSRFSSEFFNEKSLNEKDSLKKGKRIMKEFVKLRYGVFSERPYKNVLFVHNNFSLIKGICNQNIQWKVNNSPEKCSDENSVCKYTIDGNQNHNYSIMFDSDSHTSDYFCNDKDRPHNHLAYNLHNIFCKGKSVSSVIMKHQDFNKNSAKFSSYKIPTFQILLRRGRQIVLVLDRSGSMNEFADKVKDVVCKFIKEYAEESAEISIVTYNKEVNIVSPLTRVDNANTRKHLNDQVKMIKFFGLSKIGKGIKTGMNILLENNTKTRNDLQTMILITDEQYSRDKKYKYSDIIKALKRSEIILHVLSFNKKSNSTLRKLAKGSNGSYQRLSGNVSLDNIFTKLLLKTKTKTLDKKIELFLKDKSYKYSYNATYQANVTTVNVNIEKNLRKYMVKMSNKSGLE---ILPKSTNLNP-------RDTQLVFEIKGQLKPGKYYLTFLKSEKKSKHHNNPKNAEKILKNIKFSIYAENKKSNQRRINPVGFISKTFFEEVDSKTFLTVTVDLSGCDITNEERANVILEINLPSDKKVFKILKDDGIGDDSISNDKIYTVNIYPKDLLEKGFYNFIAQVEIINMKTTKEKIKRTVIFESLQVKDVKDSAWTDAISPAQMIQLKIKIIDRNRI-QLKTFATGDDSMEGQINRYQIIVRSKEDKTFDVLKSAKPYEEIFFDLDLWDLDNMSSMEVAVRGIDDNNNVGEWSPFVPINMKF 835          
The following BLAST results are available for this feature:
BLAST of Chloride channel accessory 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CLCA41.186e-4325.66chloride channel accessory 4 [Source:HGNC Symbol;A... [more]
CLCA12.227e-3829.72chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA12.227e-3829.72chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA21.177e-3024.34chloride channel accessory 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clca14.180e-3424.71chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca16.836e-2924.44chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca19.501e-1924.63chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca13.093e-1824.94chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
si:ch211-116o3.33.320e-728.57si:ch211-116o3.3 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
csnk2a27.193e-3824.75casein kinase 2 alpha 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000038434.11.668e-3625.61chloride channel accessory 1 gene 2 [Source:NCBI g... [more]
ENSXETT00000026373.11.718e-3625.49chloride channel accessory 1 gene 2 [Source:NCBI g... [more]
gnl34.087e-3524.14guanine nucleotide binding protein-like 3 (nucleol... [more]
ENSXETT00000038492.14.240e-3023.70chloride channel accessory 4 gene 1 [Source:NCBI g... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clca3a24.697e-4026.54chloride channel accessory 3A2 [Source:MGI Symbol;... [more]
Clca4a7.240e-4024.76chloride channel accessory 4A [Source:MGI Symbol;A... [more]
Clca4a7.808e-4024.76chloride channel accessory 4A [Source:MGI Symbol;A... [more]
Clca3a12.694e-3826.53chloride channel accessory 3A1 [Source:MGI Symbol;... [more]
Clca12.674e-3624.96chloride channel accessory 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Chloride channel accessory 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2TU62|CLCA1_HORSE1.964e-4325.34Calcium-activated chloride channel regulator 1 OS=... [more]
sp|Q14CN2|CLCA4_HUMAN5.696e-4325.66Calcium-activated chloride channel regulator 4 OS=... [more]
sp|Q9TUB5|CLCA1_PIG1.672e-4124.83Calcium-activated chloride channel regulator 1 OS=... [more]
sp|Q6Q473|CLA4A_MOUSE3.723e-4024.88Calcium-activated chloride channel regulator 4A OS... [more]
sp|A8K7I4|CLCA1_HUMAN1.070e-3729.72Calcium-activated chloride channel regulator 1 OS=... [more]
back to top
BLAST of Chloride channel accessory 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
L5K6942.269e-4525.78Calcium-activated chloride channel regulator 1 OS=... [more]
H0UVF83.674e-4525.71VWFA domain-containing protein OS=Cavia porcellus ... [more]
H0VS809.960e-4525.25VWFA domain-containing protein OS=Cavia porcellus ... [more]
F7CCL62.248e-4426.75Chloride channel accessory 4 OS=Callithrix jacchus... [more]
A0A2K5DGT93.864e-4426.16Chloride channel accessory 4 OS=Aotus nancymaae OX... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000007776.21.727e-3826.92calcium-activated chloride channel regulator 1 [So... [more]
ENSAMXT00000037970.13.144e-3326.79calcium-activated chloride channel regulator 1 [So... [more]
ENSAMXT00000007818.24.475e-3128.79pep primary_assembly:Astyanax_mexicanus-2.0:1:5630... [more]
ENSAMXT00000054901.16.972e-2727.46pep primary_assembly:Astyanax_mexicanus-2.0:1:5707... [more]
ENSAMXT00000007808.21.817e-2427.46pep primary_assembly:Astyanax_mexicanus-2.0:1:5707... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CLCA19.901e-4026.11chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA11.028e-3624.29chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA13.231e-3526.90chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
ENSPMAT00000001292.12.255e-925.55pep scaffold:Pmarinus_7.0:GL483362:405266:418426:-... [more]
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000080916.10.000e+099.17SMESG000080916.1[more]
SMESG000080918.18.669e-12935.49SMESG000080918.1[more]
SMESG000080919.13.261e-12632.34SMESG000080919.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006106 ID=SMED30006106|Name=Chloride channel accessory 4|organism=Schmidtea mediterranea sexual|type=transcript|length=3038bp
ATTCAATCACCCATAATTTAATTATTTACCAAATATGTAGAAAAGAATTG
TTATGATATCGATTATAATATAAATATTTTATTACAATAAATAAACCGAA
GTACATTTACTATAATTATATAAAGGTTATATAAATGGTTTCTAAATTAT
AAAGTTTGTCTAAAAAATGAAATATCTTTATATATGTTTTGGCCTTCTTA
GTTTTGTCTATGCAGAATATTATTTAGATTCAAACAATAAATTCCAGGAC
ATATTAGTCTTCATTAATGATAATGTAGAAGAAGGAAATGGGCAATTATT
AAACAGAATAATGGATCATGTCAGTAACGCTTCTAAGTCACTTTGGAAAG
CTACTAGTCACATGGAATCGAACATAGCTGGAGTTCAGTTTGGAACCGTC
CACATACGAGTGCCAAGTACATGGTCAAATCACTTGAATCCGATTACATG
GCATCAGTGCAATAATGCCTTATTCTTTGTGGCGGTTGATAACATTGACA
AAAATGAAAAACCAATTACAAAACAGCTGGGAAAATGTGGGGACCCTGGG
AATTTTACTAGGTTTCCAGAATCATTTTTTAAAGCTACAAAACTGAATGA
CACATTTAAAAGAGGTAAGGAATTCATGAGAGAATTTGTGAAGCTTCGGT
ATGGGGTCTACAGTGAAGAACCATTAAAAAATCGGTTGCTAGCATTTGAT
GGAAAAAACCATATTCAGGCAGTTTGTGGAAACGACATAAAGTGGAATGT
CGTAAAAGACAGACATCAGTGCATGGAGTCCAATACTGAATGCAAATATG
AAATAATAAAAAATCAACATCATAACCACTCTATAATGTTTGATACGGAA
ACTTTTACGAGTGAATATTTTTGTGATGATAGACATCGTTTACACAATAA
ATATGCCTACAATCTTCATAATAAAAAATGTAATAAAAGAAGTGTTACAA
ATGTTATTCTCAATCACAAAGACTTCAAAAGTGGCAAGACATCAATAATT
TACGAAAATGTTAAATTCAATATTGTCAAAGGCCAGACTGAAAAAATTGT
TTTAGTGCTAGATACATCTGGGAGCATGGTCAATATTATAGAGAATATGA
AATTGGCTACAATAGCGTTCTTGGAATCAGTGGGAAACTCGGCTTATGTT
GGAATTGTTCGCTTTGACTCGTCAGCAACTATTCTTTCTTATCTAATGCA
TATTGGAACACATAGAGCTACTTTGATCAGGGAAATTCAAAACTTATATG
CCAACGGAGGTACAAATATTCCTGATGGCTTGGTAAAAGGTGTTCAAGTG
CTTGGCGGTGAAATTACAAATGATAACAACGTAATTGGGTCTATTATACT
TTTAACTGACGGGGAGAACAATAACAATATACCATATAGTTATGATTATG
TGATAAATAAATTGATAAAGAAAAAACTTACAGTCAATGCAATTGCTTAT
GGCAAGTTAGCGGATATGAGTCTTAACAAGATTACAACTGGAACCAATGG
AAAATATAAATTTGCTAATCCAAATACCCAATACACAGATTTAGCTGGGA
AATTTTTCAGTCAATCCTGTGATATTTCTGTAGACCATCTTATCAAGGCG
ATTGAAGAAACGATAACAATTAATCTGTATGAAAAAGTCCATACTCAAAA
TTTGACTTACATCGATAGATACATCGGCGTAAATCTGAAAATAACAATGA
CTATTCCAGCGGATAAAAGCAATTATGAGGTTACATTAATCACCCCTAAA
AATAAAAGAATTGTTCCCTCGAAGAAAATAACACAAAATAGTGGAACAAC
ATTTAGCTTTGAAATAATTGGAACTCCCGATCCTGGAATGTATGTCGTAG
AATTGAAATCTCCAACTAATAAACGATTCAAAAGAAATACAGATTTCTTT
ACTTTGGCTATAACAGTGTCGGCCAAACCATCAAAGAATAGAGAAAGAGA
CATAAGCCCTAGTGGAGGAATATCTACATCAGAGATAAAGGAATTGGGAG
ACACGACCTCAGTCACCGTTGACGTTGATTTGACAAATTGTGGGATATTG
AAAGATGAAAATGTTACAGTTATCCTTAAAATAGAAAGTCCTAATAAACC
TTTAAAACATTTACAAATGACTGATAACGGATTAGGCGATGATGCAATAG
AAGATGACAAAGTATTTACAAGAGTGCTATATGCAAGAGATCTAGAAGAT
GTTGGTTTCTACAGCTTTCGGGCGGATATTACAATTAACAATACTGTAAA
TGGAGATATAATTAGAAGAACTTTGGATCTTGGCAGTTTAATAATAAACC
AAAAACAAACTAAAAAGTTTGAAGACAAGATTCTGCCTGCCAAAATTGAT
GATATTTTAGTTAGAGGAGATGAAAAGAAAAAGGTATTAAAAATAGATCT
TATAGCTACTGGAAATGATGGAATGATTGGCAATATCAGTGATTATGAAA
TTAAAATCCAGTCAAATGAAACAATTGTCATCAGAAAAACAGCATTTGCA
AATCCAGCTGAAAAGATTATGTTCGAGGTGGAATTATTAAAAATGAACGT
TACAAATCCTTTTGAAATATCTGTCAGGGGGGTCGACAACAGCTTCAACT
TTGGAGAATGGTCTAATTCAGTACCATATAACTGGAAATACGAAAAAATA
ATTGAAGACAGATTAGGCAGAAAGAATAGTGAGAAGCTGCTTGTTTCGTT
TACATTACTTTTGTTGTCTTATCTATCTGTGTTGGATATCAATTAAACCA
AAAACATCTAATGAACAGAATTGTTAAGCAACTAAATTTGATTTTAAATT
GATATAAATAGATGCAAATGTTTATTAAAATAAAATGTACAATTATGACA
GTCTTCCATCAAGCCTCCAAATCTTTGATAATCTTAGGTATTGGTGAATT
CTAAGGACTTATTTGAGTAAATTCTTTTTTGATTGTTTTAATCTTTGAGC
CATTTTTCTAGTTTTTCAATAAAACTATTGTTAGCTAAAATATTTCATTT
TTATCTTTGAAAAGAAACTTTAGCTTAAGCACTCTGTA
back to top

protein sequence of SMED30006106-orf-1

>SMED30006106-orf-1 ID=SMED30006106-orf-1|Name=SMED30006106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=860bp
MKYLYICFGLLSFVYAEYYLDSNNKFQDILVFINDNVEEGNGQLLNRIMD
HVSNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNN
ALFFVAVDNIDKNEKPITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRG
KEFMREFVKLRYGVYSEEPLKNRLLAFDGKNHIQAVCGNDIKWNVVKDRH
QCMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNL
HNKKCNKRSVTNVILNHKDFKSGKTSIIYENVKFNIVKGQTEKIVLVLDT
SGSMVNIIENMKLATIAFLESVGNSAYVGIVRFDSSATILSYLMHIGTHR
ATLIREIQNLYANGGTNIPDGLVKGVQVLGGEITNDNNVIGSIILLTDGE
NNNNIPYSYDYVINKLIKKKLTVNAIAYGKLADMSLNKITTGTNGKYKFA
NPNTQYTDLAGKFFSQSCDISVDHLIKAIEETITINLYEKVHTQNLTYID
RYIGVNLKITMTIPADKSNYEVTLITPKNKRIVPSKKITQNSGTTFSFEI
IGTPDPGMYVVELKSPTNKRFKRNTDFFTLAITVSAKPSKNRERDISPSG
GISTSEIKELGDTTSVTVDVDLTNCGILKDENVTVILKIESPNKPLKHLQ
MTDNGLGDDAIEDDKVFTRVLYARDLEDVGFYSFRADITINNTVNGDIIR
RTLDLGSLIINQKQTKKFEDKILPAKIDDILVRGDEKKKVLKIDLIATGN
DGMIGNISDYEIKIQSNETIVIRKTAFANPAEKIMFEVELLKMNVTNPFE
ISVRGVDNSFNFGEWSNSVPYNWKYEKIIEDRLGRKNSEKLLVSFTLLLL
SYLSVLDIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036465vWFA_dom_sf
IPR002035VWF_A
IPR013642CLCA_N
Vocabulary: molecular function
TermDefinition
GO:0005229intracellular calcium activated chloride channel activity
Vocabulary: biological process
TermDefinition
GO:0006821chloride transport
GO:1902476chloride transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002035von Willebrand factor, type ASMARTSM00327VWA_4coord: 290..468
e-value: 4.0E-13
score: 59.6
IPR002035von Willebrand factor, type APFAMPF00092VWAcoord: 294..454
e-value: 1.3E-18
score: 67.9
IPR002035von Willebrand factor, type APROSITEPS50234VWFAcoord: 293..467
score: 14.814
IPR013642Calcium-activated chloride channel, N-terminalPFAMPF08434CLCAcoord: 22..273
e-value: 1.9E-29
score: 102.8
IPR036465von Willebrand factor A-like domain superfamilyGENE3DG3DSA:3.40.50.410coord: 291..465
e-value: 9.1E-30
score: 106.0
IPR036465von Willebrand factor A-like domain superfamilySUPERFAMILYSSF53300vWA-likecoord: 294..468
NoneNo IPR availablePANTHERPTHR10579CALCIUM-ACTIVATED CHLORIDE CHANNEL REGULATORcoord: 23..685
NoneNo IPR availablePANTHERPTHR10579:SF2CALCIUM-ACTIVATED CHLORIDE CHANNEL REGULATOR 4coord: 23..685
NoneNo IPR availableCDDcd00198vWFAcoord: 294..449
e-value: 2.47493E-20
score: 86.851
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.598