Protein-S-isoprenylcysteine O-methyltransferase

Overview
NameProtein-S-isoprenylcysteine O-methyltransferase
Smed IDSMED30006103
Length (bp)969
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein-S-isoprenylcysteine O-methyltransferase (SMED30006103) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein-S-isoprenylcysteine O-methyltransferase (SMED30006103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein-S-isoprenylcysteine O-methyltransferase (SMED30006103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein-S-isoprenylcysteine O-methyltransferase (SMED30006103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30006103SMESG000036295.1 dd_Smed_v4_4744_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006103SMESG000036295.1 dd_Smed_v4_4744_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Human
Match: ICMT (isoprenylcysteine carboxyl methyltransferase [Source:HGNC Symbol;Acc:HGNC:5350])

HSP 1 Score: 216.853 bits (551), Expect = 1.910e-68
Identity = 104/211 (49.29%), Postives = 142/211 (67.30%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG +      L  +  + S F  Y+  L  FH+SE+ +++++NP  L +D ++LNHS EY +A L S  E+ +E  ++PE+ +++ WLS  GLL+ + GE LRK +++T G NFNH V+  K D H LV SGVY WFRHPSYVGWFY+S+GTQ+ L NPIC + YA+  W FF  R  EEE  L+ FFGE+YL Y++ V TGLPFIKG
Sbjct:   70 ACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPEL-KQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKG 279          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Celegans
Match: M01E11.1 (Protein-S-isoprenylcysteine O-methyltransferase [Source:UniProtKB/TrEMBL;Acc:P91402])

HSP 1 Score: 179.489 bits (454), Expect = 2.574e-54
Identity = 85/188 (45.21%), Postives = 123/188 (65.43%), Query Frame = 1
Query:  304 YIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            Y + L  FH++EF  ++L+N   L+ D ++LNHS  Y +A  +S  E+ IE  +FPEI  K+R + + G L  I+GE+ RK+ +   G  F H +  +KR DH LV+ G+Y + RHP Y GWF ++V TQI L NPIC + YA  +W FF SRIY+EE+ L+ FFG+ Y+ YQQ V  G+PF++GY +
Sbjct:  107 YFLFLSMFHFTEFVFTALTNRRTLRPDSFLLNHSVGYWLAASISWIEFLIEAYFFPEI--KMRGILWIGTLGCIIGEIFRKVGMVHAGLAFTHRLAMTKRSDHRLVKDGIYAYLRHPGYFGWFLWAVSTQIILCNPICCVVYAYVTWHFFASRIYDEEKDLISFFGDSYVEYQQNVWCGVPFVRGYQR 292          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Celegans
Match: M01E11.1 (Protein-S-isoprenylcysteine O-methyltransferase [Source:UniProtKB/TrEMBL;Acc:P91402])

HSP 1 Score: 179.489 bits (454), Expect = 2.574e-54
Identity = 85/188 (45.21%), Postives = 123/188 (65.43%), Query Frame = 1
Query:  304 YIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            Y + L  FH++EF  ++L+N   L+ D ++LNHS  Y +A  +S  E+ IE  +FPEI  K+R + + G L  I+GE+ RK+ +   G  F H +  +KR DH LV+ G+Y + RHP Y GWF ++V TQI L NPIC + YA  +W FF SRIY+EE+ L+ FFG+ Y+ YQQ V  G+PF++GY +
Sbjct:  107 YFLFLSMFHFTEFVFTALTNRRTLRPDSFLLNHSVGYWLAASISWIEFLIEAYFFPEI--KMRGILWIGTLGCIIGEIFRKVGMVHAGLAFTHRLAMTKRSDHRLVKDGIYAYLRHPGYFGWFLWAVSTQIILCNPICCVVYAYVTWHFFASRIYDEEKDLISFFGDSYVEYQQNVWCGVPFVRGYQR 292          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Celegans
Match: M01E11.1 (Protein-S-isoprenylcysteine O-methyltransferase [Source:UniProtKB/TrEMBL;Acc:P91402])

HSP 1 Score: 179.489 bits (454), Expect = 2.574e-54
Identity = 85/188 (45.21%), Postives = 123/188 (65.43%), Query Frame = 1
Query:  304 YIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            Y + L  FH++EF  ++L+N   L+ D ++LNHS  Y +A  +S  E+ IE  +FPEI  K+R + + G L  I+GE+ RK+ +   G  F H +  +KR DH LV+ G+Y + RHP Y GWF ++V TQI L NPIC + YA  +W FF SRIY+EE+ L+ FFG+ Y+ YQQ V  G+PF++GY +
Sbjct:  107 YFLFLSMFHFTEFVFTALTNRRTLRPDSFLLNHSVGYWLAASISWIEFLIEAYFFPEI--KMRGILWIGTLGCIIGEIFRKVGMVHAGLAFTHRLAMTKRSDHRLVKDGIYAYLRHPGYFGWFLWAVSTQIILCNPICCVVYAYVTWHFFASRIYDEEKDLISFFGDSYVEYQQNVWCGVPFVRGYQR 292          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Celegans
Match: icmt-1 (Protein-S-isoprenylcysteine O-methyltransferase [Source:UniProtKB/TrEMBL;Acc:P91266])

HSP 1 Score: 155.221 bits (391), Expect = 7.284e-45
Identity = 77/192 (40.10%), Postives = 116/192 (60.42%), Query Frame = 1
Query:  295 FTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEI-FEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            F+ Y + L  FH+SEF  ++L+N   L  D ++L HS  Y +A  +   E+ IE  ++PEI    + W+  FG    I+GE++RK+ +   G  F H +  +KR  H L+ +G+Y + RHP Y GWF ++V TQI L NPI  + Y   +W FF +RI  EE+ L+ FFG+DY  YQ++  +G+PF +GY K
Sbjct:  106 FSRYFLFLSVFHFSEFVFTALTNRRTLGPDSFLLKHSFGYWLAASIGWIEFLIEANFYPEIKMYSVLWIGTFG---CIIGEIVRKVGMVHAGLAFTHLMARTKRSGHTLINTGIYAYMRHPGYFGWFIWAVSTQIVLCNPISFVIYTFVTWRFFANRIEIEEKDLISFFGDDYAEYQRKTWSGVPFARGYQK 294          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Fly
Match: ste14 (gene:FBgn0036336 transcript:FBtr0075876)

HSP 1 Score: 189.889 bits (481), Expect = 4.254e-58
Identity = 94/213 (44.13%), Postives = 139/213 (65.26%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNH-SIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGY 861
            A FLG   ++++ ++   P     F  Y   +  FH+SEF + + +NP  L +D +MLNHS  Y +A   S  E+ +E  Y P+ F++  ++   G+++ +LGE++RK ++ T G++F H V+  K  +H L+ SG+Y + RHPSYVGWF++S+GTQI LLNPIC+  Y + SWLFF+ RIY EE  LL FF  DY+ YQ+ V TGLPFI+GY
Sbjct:   85 ASFLGFAMAVSVLVICFAPTEWQQFGAYGCFMSLFHYSEFLVIAFANPRTLSLDSFMLNHSVHYGLAAAASWIEFSLEVYYLPQ-FKRYGYIWVAGVVLCLLGEMVRKAAIITAGRSFTHLVQNEKHSEHKLITSGIYAYCRHPSYVGWFWWSIGTQIVLLNPICICIYTLVSWLFFHDRIYVEEYSLLNFFQSDYVRYQKRVPTGLPFIRGY 296          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Fly
Match: ste14 (gene:FBgn0036336 transcript:FBtr0332075)

HSP 1 Score: 189.889 bits (481), Expect = 4.254e-58
Identity = 94/213 (44.13%), Postives = 139/213 (65.26%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNH-SIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGY 861
            A FLG   ++++ ++   P     F  Y   +  FH+SEF + + +NP  L +D +MLNHS  Y +A   S  E+ +E  Y P+ F++  ++   G+++ +LGE++RK ++ T G++F H V+  K  +H L+ SG+Y + RHPSYVGWF++S+GTQI LLNPIC+  Y + SWLFF+ RIY EE  LL FF  DY+ YQ+ V TGLPFI+GY
Sbjct:   85 ASFLGFAMAVSVLVICFAPTEWQQFGAYGCFMSLFHYSEFLVIAFANPRTLSLDSFMLNHSVHYGLAAAASWIEFSLEVYYLPQ-FKRYGYIWVAGVVLCLLGEMVRKAAIITAGRSFTHLVQNEKHSEHKLITSGIYAYCRHPSYVGWFWWSIGTQIVLLNPICICIYTLVSWLFFHDRIYVEEYSLLNFFQSDYVRYQKRVPTGLPFIRGY 296          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Zebrafish
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:ZFIN;Acc:ZDB-GENE-050417-90])

HSP 1 Score: 195.282 bits (495), Expect = 2.946e-60
Identity = 106/211 (50.24%), Postives = 140/211 (66.35%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + L       + F  Y+  L FFH+SE+ ++++ NP  L +D ++LNHS EY +A + S  E+ +EK   PEI ++L WL   GL++ + GE LRK ++ T G NFNH V+  K   HVLV +GVY  FRHPSYVGWFY+S+GTQI L NPIC++GY VASW FF  RI EEE  L+ FFGEDY+ Y+++V TGLPFI G
Sbjct:   78 ACFLGFTFGCGLTLSFADTTWTHFGWYMCSLSFFHYSEYLVTAIINPRSLSLDSFLLNHSVEYTLAAVSSWLEFTVEKLLVPEI-KQLNWLCLVGLVMVMCGEGLRKAAMLTAGSNFNHIVQNEKAQSHVLVTTGVYALFRHPSYVGWFYWSIGTQIMLCNPICILGYTVASWRFFRERIEEEEISLIHFFGEDYIEYKKKVFTGLPFISG 287          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Zebrafish
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:ZFIN;Acc:ZDB-GENE-050417-90])

HSP 1 Score: 195.282 bits (495), Expect = 2.946e-60
Identity = 106/211 (50.24%), Postives = 140/211 (66.35%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + L       + F  Y+  L FFH+SE+ ++++ NP  L +D ++LNHS EY +A + S  E+ +EK   PEI ++L WL   GL++ + GE LRK ++ T G NFNH V+  K   HVLV +GVY  FRHPSYVGWFY+S+GTQI L NPIC++GY VASW FF  RI EEE  L+ FFGEDY+ Y+++V TGLPFI G
Sbjct:   78 ACFLGFTFGCGLTLSFADTTWTHFGWYMCSLSFFHYSEYLVTAIINPRSLSLDSFLLNHSVEYTLAAVSSWLEFTVEKLLVPEI-KQLNWLCLVGLVMVMCGEGLRKAAMLTAGSNFNHIVQNEKAQSHVLVTTGVYALFRHPSYVGWFYWSIGTQIMLCNPICILGYTVASWRFFRERIEEEEISLIHFFGEDYIEYKKKVFTGLPFISG 287          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Xenopus
Match: ICMT (allantoinase, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5950267])

HSP 1 Score: 206.068 bits (523), Expect = 2.849e-64
Identity = 105/211 (49.76%), Postives = 146/211 (69.19%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + L +       F  Y+  L FFH+SE+ +++++NP  L +D ++LNHS EY +A + S  E+ +EKT +P++ +++ WLS  GL++ + GELLRK ++ T G NFNH V+  K D H LV SGVY+WFRHPSYVGWFY+S+GTQ+ L NP+CL GY  ASW FF  RI EEE  L+ FFGE+Y+ Y+++V TGLPFI+G
Sbjct:   76 ASFLGFAFGCGLLLGITQSPWKPFGWYVCSLSFFHYSEYLITAVNNPKSLSLDSFLLNHSLEYTLAAVSSWVEFTVEKTIYPDL-KQITWLSVIGLIMVLFGELLRKCAMLTAGSNFNHIVQNEKSDSHTLVTSGVYSWFRHPSYVGWFYWSIGTQVLLCNPLCLFGYTFASWRFFRERIEEEEFSLIHFFGENYMEYKKKVPTGLPFIRG 285          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Mouse
Match: Icmt (isoprenylcysteine carboxyl methyltransferase [Source:MGI Symbol;Acc:MGI:1888594])

HSP 1 Score: 213.772 bits (543), Expect = 1.756e-67
Identity = 102/211 (48.34%), Postives = 143/211 (67.77%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG +    + L  +  + + F  Y+  L  FH+SE+ +++++NP  L +D ++LNHS EY +A L S  E+ +E  ++PE+ +++ WLS  GLL+ + GE LRK +++T G NFNH V+  K D H LV SGVY W RHPSYVGWFY+S+GTQ+ L NPIC + YA+  W FF  R  EEE  L+ FFGE+YL+Y++ V TGLPFIKG
Sbjct:   70 ACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPEL-KQITWLSATGLLMVVFGECLRKAAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKG 279          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Match: sp|O12947|ICMT_XENLA (Protein-S-isoprenylcysteine O-methyltransferase OS=Xenopus laevis OX=8355 GN=icmt PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 3.032e-71
Identity = 108/211 (51.18%), Postives = 147/211 (69.67%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + L +       F  Y+  L FFH+SE+ +++++NP  L ID ++LNHS EY +A L S  E+ IE T +P++ +++ WLS  GL++ + GE+LRK ++ T G NFNH V+  K D H LV SGVY+WFRHPSYVGWFY+S+GTQ+ L NP+CL+GY +ASW FF  RI EEE  L+ FFGE+YL Y+++V TGLPFIKG
Sbjct:   74 ASFLGFAFGCGLLLSITQSPWKPFGWYVCSLSFFHYSEYLVTAMNNPRSLSIDSFLLNHSLEYTLAALSSWVEFTIETTIYPDL-KQITWLSVIGLIMVLFGEVLRKCAMLTAGSNFNHIVQNEKSDSHTLVTSGVYSWFRHPSYVGWFYWSIGTQVLLCNPLCLVGYTLASWRFFSERIEEEEFSLIHFFGENYLEYKKKVPTGLPFIKG 283          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Match: sp|O60725|ICMT_HUMAN (Protein-S-isoprenylcysteine O-methyltransferase OS=Homo sapiens OX=9606 GN=ICMT PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 9.171e-68
Identity = 104/211 (49.29%), Postives = 142/211 (67.30%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG +      L  +  + S F  Y+  L  FH+SE+ +++++NP  L +D ++LNHS EY +A L S  E+ +E  ++PE+ +++ WLS  GLL+ + GE LRK +++T G NFNH V+  K D H LV SGVY WFRHPSYVGWFY+S+GTQ+ L NPIC + YA+  W FF  R  EEE  L+ FFGE+YL Y++ V TGLPFIKG
Sbjct:   70 ACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFWPEL-KQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKG 279          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Match: sp|Q9WVM4|ICMT_RAT (Protein-S-isoprenylcysteine O-methyltransferase (Fragment) OS=Rattus norvegicus OX=10116 GN=Icmt PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.888e-67
Identity = 103/211 (48.82%), Postives = 144/211 (68.25%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG +    + L  +  + + F  Y+  L  FH+SE+ +++++NP  L +D ++LNHS EY +A L S  E+ +E  ++PE+ +++ WLS  GLL+ I GE LRK++++T G NFNH V+  K D H LV SGVY W RHPSYVGWFY+S+GTQ+ L NPIC + YA+  W FF  R  EEE  L+ FFGE+YL+Y++ V TGLPFIKG
Sbjct:   18 ACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTTVNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPEL-KQITWLSAAGLLMVIFGECLRKVAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKG 227          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Match: sp|Q9EQK7|ICMT_MOUSE (Protein-S-isoprenylcysteine O-methyltransferase OS=Mus musculus OX=10090 GN=Icmt PE=2 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 1.154e-66
Identity = 102/211 (48.34%), Postives = 143/211 (67.77%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG +    + L  +  + + F  Y+  L  FH+SE+ +++++NP  L +D ++LNHS EY +A L S  E+ +E  ++PE+ +++ WLS  GLL+ + GE LRK +++T G NFNH V+  K D H LV SGVY W RHPSYVGWFY+S+GTQ+ L NPIC + YA+  W FF  R  EEE  L+ FFGE+YL+Y++ V TGLPFIKG
Sbjct:   69 ACFLGFVFGCGVLLSFSQSSWNHFGWYVCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWIEFTLENIFWPEL-KQITWLSATGLLMVVFGECLRKAAMFTAGSNFNHVVQSEKSDTHTLVTSGVYAWCRHPSYVGWFYWSIGTQVMLCNPICGVVYALTVWRFFRDRTEEEEISLIHFFGEEYLDYKKRVPTGLPFIKG 278          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Match: sp|Q558K8|ICMT_DICDI (Protein-S-isoprenylcysteine O-methyltransferase OS=Dictyostelium discoideum OX=44689 GN=icmt-1 PE=2 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 1.587e-50
Identity = 82/186 (44.09%), Postives = 123/186 (66.13%), Query Frame = 1
Query:  295 FTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFI 852
            F IY+  LC FH  E+   ++ +P+ L    ++LNHS ++ +ALL+S  E+WIE  +FP +  K   L + G +  + G+++R +++ T G NF H V+  KRDDHVLV +G+Y + RHPSY GWF +SV TQ+ L+NPI +IG+  ASW FF  RI  EE  L++FFG+ Y +Y++ V +G+P I
Sbjct:   53 FGIYLAGLCTFHMWEYIWVTMYHPDKLSSKSFLLNHSPQFNMALLISFIEFWIEWYFFPSL--KTFSLWWVGAICMVFGQIVRSVAMDTAGSNFTHLVQEEKRDDHVLVTNGIYQYMRHPSYFGWFVWSVSTQVILMNPISIIGFGWASWSFFSQRIENEEDYLIQFFGKSYKDYKKSVWSGIPGI 236          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Match: A0A0R3SCR2 (Protein-S-isoprenylcysteine O-methyltransferase OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2395 PE=3 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.477e-71
Identity = 126/302 (41.72%), Postives = 189/302 (62.58%), Query Frame = 1
Query:   34 SSKVSLIGMLCGILQIAIVKICYVFGIQNY---ILITLPAIFIVSSY------------YFVSH----NHSDTDNFQKLNFFCAFFLGSITSMAIFL----MLNVPNHSI---FTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGY 861
             +  SL+G L GIL + I     ++ I+ +     I LP +F+++ Y            Y +S+    +  D D +Q  N   AF LG + ++   L      ++ +  I   F IY+  L FFHWSEFF+++L++P+   IDLY+L+HS EY  A++LS  EYW+E  ++P  +  L   +  GL +++LGE++RK ++ T   NFNHY+E++ R DH LVRSG+Y + RHP+Y GWF++SVGTQI L+NP+C + Y +A++LFF  R+Y EEQ L+ FFG+DY  YQ+EV TGLPFI+GY
Sbjct:    9 PAPTSLVGFLLGILFLFIYHFILLYLIEFFSFTTFIILPILFVLTLYVLTRFVFRRTVDYLLSYVNRGSKLDPDGYQP-NLTIAFCLGGVFALGFILSYHAFRDLSHPRIVFPFAIYLALLAFFHWSEFFVATLTSPSRANIDLYLLDHSPEYIGAMVLSFLEYWLEVYFWPTKYTSLMLANIIGLAMAVLGEIIRKAAMLTAADNFNHYIEYTLRKDHRLVRSGIYAFCRHPAYSGWFFWSVGTQILLVNPLCSVLYPIAAYLFFKDRVYTEEQSLIIFFGDDYRAYQREVSTGLPFIQGY 309          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Match: A0A0R3TL44 (Protein-S-isoprenylcysteine O-methyltransferase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS7931 PE=3 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.957e-70
Identity = 124/306 (40.52%), Postives = 190/306 (62.09%), Query Frame = 1
Query:   34 SSKVSLIGMLCGILQIAIVKICYVFGIQNYI-LITLPAIFIVSSYYFVSHN----------------HSD------TDNFQKLNFFCAFFLGSITSMAIFL----MLNVPNHSI---FTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGY 861
            ++  SL+G L GIL +    + Y F + N +   ++  +F++S ++ ++H+                ++D       D F+  N   AF LG + +  +      +L++P+  I   F  Y+  L FFHWSEFF+SSL++P+    DLY+L HS EY  A++LS  EYW+E  ++P  +  L ++S  GL I++ GE++RK ++ T   NFNHY+E++ R DH LVRSG+Y + RHP+Y GWF++SVGTQI L+NP+C I Y + +++FF SR+  EE+ LL FFG+DY  YQ+EV TGLPFI+GY
Sbjct:    9 AAPTSLVGFLLGILSL----LTYHFLLLNLVEFFSITTLFVLSIFFILTHHVLIRFVLPQAVDYLSPYTDRGSQLLPDGFRS-NLSIAFCLGGVFAAGLIFSYRSLLDLPHPRIVFPFAAYLALLAFFHWSEFFVSSLTSPSRADTDLYLLGHSPEYLGAMILSFLEYWLEIYFWPTKYTSLMFVSVIGLAIAVAGEIIRKTAMLTAADNFNHYIEYTPRKDHHLVRSGIYAFCRHPAYSGWFFWSVGTQILLVNPLCSILYPITAYVFFKSRVNAEERSLLVFFGDDYRAYQREVSTGLPFIQGY 309          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Match: A0A1S3JQC1 (Protein-S-isoprenylcysteine O-methyltransferase OS=Lingula unguis OX=7574 GN=LOC106174929 PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.234e-70
Identity = 126/291 (43.30%), Postives = 180/291 (61.86%), Query Frame = 1
Query:   16 MIMLTISSKVSLIGMLCGILQIAIVKICYVFG------IQNY--ILITLPAIFIVSSYYFVSHNHSDTDNFQKLNFFCAFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYH 864
            M  + +  + SL+  +CG   I  V +    G      +++Y  +L+ + ++FI + +  +   +             A FLG +    + L  +    + F  Y++ L FFHWSE+F ++++NP  L++D Y+L+HS EYK+A L S  E+ +E  + P + ++L+W+S FGLLI + GE LRK ++ T   NFNHYV+  K + HVLV  GVY+ FRHPSYVGWFY+S+GTQI L NPICL+GY V SW FF  RI  EE  LL FFGE+YLNYQ++V TGLPFIKGY 
Sbjct:    1 MAQIIVEGRASLLSFICGS-TICFVPLFRYLGRIPENIVEHYLPVLLGIYSVFIFALWRLIYRRYWTLWQVSSR----AAFLGLVFGCGLILTFSDTTWTHFGWYLVALSFFHWSEYFTTAVTNPFSLQLDSYLLDHSPEYKLAALASWVEFTVEWYFLPGL-KQLKWVSVFGLLIVMGGETLRKAAMITAKTNFNHYVQHVKEEGHVLVTRGVYSKFRHPSYVGWFYWSIGTQIILCNPICLVGYTVTSWKFFRERIEVEEITLLNFFGEEYLNYQRQVKTGLPFIKGYR 285          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Match: A0A482VZR5 (Protein-S-isoprenylcysteine O-methyltransferase OS=Asbolus verrucosus OX=1661398 GN=BDFB_008714 PE=3 SV=1)

HSP 1 Score: 227.639 bits (579), Expect = 1.572e-69
Identity = 110/213 (51.64%), Postives = 149/213 (69.95%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVP-NHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGY 861
            A  LG + S+ ++L L  P N  IF  Y+  +  FH+SEF   ++  P  +  D +++NHS +Y IA + S  E++IE  +FP  F+++ WLS  GL + ILG++LRK ++ T G NFNH V+  K  DHVLV  GVY WFRHPSYVGWFY+S+GTQ+ L+NPIC+ GYA+ASW+FF  RIY EE  LL FFG+ Y +YQQ+VGTG+PFI+GY
Sbjct:   68 AALLGLLFSLGMYLKLVAPSNVQIFGGYMSVMALFHYSEFLAIAIVQPKQVSTDSFVINHSPQYTIAAVTSWMEFFIESYFFPG-FKEIHWLSNIGLCVCILGDVLRKTAIMTAGSNFNHLVQCEKSSDHVLVTHGVYGWFRHPSYVGWFYWSIGTQLILINPICIPGYAIASWMFFKGRIYIEEIMLLNFFGQQYCDYQQQVGTGIPFIEGY 279          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Match: A0A433U4Z6 (Protein-S-isoprenylcysteine O-methyltransferase OS=Elysia chlorotica OX=188477 GN=EGW08_003405 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.998e-69
Identity = 104/211 (49.29%), Postives = 152/211 (72.04%), Query Frame = 1
Query:  235 LGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            LG +  +   L L     ++F  Y++ L FFHWSE+ +++++NP  L ++ ++L+HSTEYKIA   S  E+++E  + P + + LR++S  G ++++ G+ LRK+S+WT   NFNHY++ +K+D HVLV  GVY+ FRHPSYVGW+ +SVGTQ+ L NPICL+ Y V SW FF  RIY+EE CLL FFGEDYL+YQ++V TG+PF+ GY +
Sbjct:   76 LGIVFGLGFLLSLYSARWNLFGWYVMSLTFFHWSEYQITAMTNPKSLTLESFLLDHSTEYKIAAAASCVEFFLESLFLPNM-KTLRYVSLIGAVMAVGGDFLRKLSMWTARTNFNHYIQHTKQDGHVLVSWGVYSLFRHPSYVGWYCWSVGTQVMLCNPICLVTYTVVSWKFFNERIYDEEICLLNFFGEDYLDYQRKVPTGIPFVYGYRQ 285          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Cavefish
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:NCBI gene;Acc:103047473])

HSP 1 Score: 196.052 bits (497), Expect = 8.831e-61
Identity = 102/211 (48.34%), Postives = 142/211 (67.30%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + + L     + F  Y+  L FFH+SE+ ++++ NP  L +D ++LNHS EY +A + S  E+ +EK   PE+ ++L W+ + GLL+ + GE LRK ++ T G NFNH V+  K   HVLV SGVY +FRHPSYVGWFY+S+GTQI L NP+C++ Y +ASW FF  R+ EEE  L+ FFGEDY+ Y+++V TGLPFI G
Sbjct:   66 ACFLGFTFGCGLIISLGETTWTQFGWYMCSLSFFHYSEYLVTAIINPRSLSLDSFLLNHSVEYTLAAVSSWMEFTVEKLLVPEL-KQLNWICFIGLLMVLCGEGLRKAAMLTAGSNFNHIVQNEKAQTHVLVTSGVYAFFRHPSYVGWFYWSIGTQIMLFNPLCMLAYTLASWRFFRERVEEEEISLIHFFGEDYIEYKKKVSTGLPFISG 275          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Cavefish
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:NCBI gene;Acc:103047473])

HSP 1 Score: 196.052 bits (497), Expect = 1.606e-60
Identity = 102/211 (48.34%), Postives = 142/211 (67.30%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLG      + + L     + F  Y+  L FFH+SE+ ++++ NP  L +D ++LNHS EY +A + S  E+ +EK   PE+ ++L W+ + GLL+ + GE LRK ++ T G NFNH V+  K   HVLV SGVY +FRHPSYVGWFY+S+GTQI L NP+C++ Y +ASW FF  R+ EEE  L+ FFGEDY+ Y+++V TGLPFI G
Sbjct:   78 ACFLGFTFGCGLIISLGETTWTQFGWYMCSLSFFHYSEYLVTAIINPRSLSLDSFLLNHSVEYTLAAVSSWMEFTVEKLLVPEL-KQLNWICFIGLLMVLCGEGLRKAAMLTAGSNFNHIVQNEKAQTHVLVTSGVYAFFRHPSYVGWFYWSIGTQIMLFNPLCMLAYTLASWRFFRERVEEEEISLIHFFGEDYIEYKKKVSTGLPFISG 287          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Yeast
Match: STE14 (Farnesyl cysteine-carboxyl methyltransferase; mediates the carboxyl methylation step during C-terminal CAAX motif processing of a-factor and RAS proteins in the endoplasmic reticulum, localizes to the ER membrane [Source:SGD;Acc:S000002818])

HSP 1 Score: 134.42 bits (337), Expect = 2.941e-38
Identity = 74/191 (38.74%), Postives = 120/191 (62.83%), Query Frame = 1
Query:  295 FTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPE--IFE---KLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFI 852
            F ++II L  FH+ E+++++  NP  +  + ++LN+   Y  A   ++ E  +E   FP+  IF      +  +  G L+ ILG+  R I++ T G +F+H V+  K  DHVLV++GVY+W RHPSY+G+F++++GTQ+ LLNP+ L+ +    W FF  RI  EE+ L+ FF  +Y+ Y+ +VG G+PFI
Sbjct:   49 FNLFIIALSLFHFLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKLCTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFWWAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI 239          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Nematostella
Match: EDO47903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLB3])

HSP 1 Score: 207.994 bits (528), Expect = 1.141e-65
Identity = 100/211 (47.39%), Postives = 145/211 (68.72%), Query Frame = 1
Query:  226 AFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            A FLGS+  +++ L++N         Y+  L FFH+SE+ + S+ NP  L +D ++LNHS EYKIA + S  E+ IE+  FP + +    +S+ G++  I G+ +RK+++ T   NF H V + + D+HVLV  G+Y W RHP+YVGWF++S+GTQ+ L NPIC +GYA ASW FF  RI+EEE  LL+FF ++Y+ YQ++VGTGLPFIKG
Sbjct:   65 AGFLGSVFGISVVLIVNSSILRYLGWYLASLSFFHFSEYMMVSIYNPRTLSMDSFLLNHSPEYKIAAVASWMEFAIERLLFPGL-KGYFLISFVGIVFMIGGDFVRKLAMITAKSNFTHLVRYHRVDEHVLVTGGIYAWCRHPAYVGWFFWSIGTQMTLCNPICFVGYAYASWKFFKERIFEEEILLLQFFEQEYVKYQKKVGTGLPFIKG 274          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Nematostella
Match: EDO27718 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8G9])

HSP 1 Score: 152.525 bits (384), Expect = 4.234e-46
Identity = 66/121 (54.55%), Postives = 92/121 (76.03%), Query Frame = 1
Query:  496 LSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            +S+ G++  I G+ +RK+++ T   NF H V + + D+HVLV  G+Y W RHP+YVGWF++S+GTQ+ L NPIC +GYA ASW FF  RI+EEE  LL+FF ++Y+ YQ++VGTGLPFIKG
Sbjct:    7 ISFVGIVFMIGGDFVRKLAMITAKSNFTHLVRYHRVDEHVLVTGGIYAWCRHPAYVGWFFWSIGTQMTLCNPICFVGYAYASWKFFKERIFEEEILLLQFFEQEYVKYQKKVGTGLPFIKG 127          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Medaka
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:NCBI gene;Acc:101174897])

HSP 1 Score: 195.282 bits (495), Expect = 2.864e-60
Identity = 100/209 (47.85%), Postives = 142/209 (67.94%), Query Frame = 1
Query:  232 FLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKG 858
            FLG      + +  +    + F  Y+  L FFH++E+ ++++ NP+ L +D ++LNHS EY +A + S  E+ +EK   PE+ ++L+WLS  GL++ + GE LRK ++ T G NFNH V+  K   HVLV +GVY +FRHPSYVGWFY+S+GTQ+ L NP+C++GY VASW FF  RI EEE  L+ FF EDY+ Y++ V TGLPFI G
Sbjct:   80 FLGVTFGCGLMISFSETTWTHFGWYMCSLSFFHYTEYLVTAVINPHSLSLDSFLLNHSMEYTLAAVSSWVEFTVEKLTVPEL-KQLKWLSVVGLIMVLCGEGLRKAAMLTAGSNFNHIVQNEKAQSHVLVTTGVYAYFRHPSYVGWFYWSIGTQVMLCNPVCIVGYTVASWRFFRERIEEEELSLIHFFAEDYVEYKKRVPTGLPFISG 287          
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Planmine SMEST
Match: SMESG000036295.1 (SMESG000036295.1)

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 281/282 (99.65%), Postives = 281/282 (99.65%), Query Frame = 1
Query:   22 MLTISSKVSLIGMLCGILQIAIVKICYVFGIQNYILITLPAIFIVSSYYFVSHNHSDTDNFQKLNFFCAFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 867
            MLTISSKVSLIGMLCGILQIAIVKICYVFGIQNYILITLPAIFIVSSYYFVSHNHSDTDNFQKLNFFCAFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWT GQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK
Sbjct:    1 MLTISSKVSLIGMLCGILQIAIVKICYVFGIQNYILITLPAIFIVSSYYFVSHNHSDTDNFQKLNFFCAFFLGSITSMAIFLMLNVPNHSIFTIYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYWIEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTAGQNFNHYVEFSKRDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLFFYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK 282          
The following BLAST results are available for this feature:
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ICMT1.910e-6849.29isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
M01E11.12.574e-5445.21Protein-S-isoprenylcysteine O-methyltransferase [... [more]
M01E11.12.574e-5445.21Protein-S-isoprenylcysteine O-methyltransferase [... [more]
M01E11.12.574e-5445.21Protein-S-isoprenylcysteine O-methyltransferase [... [more]
icmt-17.284e-4540.10Protein-S-isoprenylcysteine O-methyltransferase [... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ste144.254e-5844.13gene:FBgn0036336 transcript:FBtr0075876[more]
ste144.254e-5844.13gene:FBgn0036336 transcript:FBtr0332075[more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
icmt2.946e-6050.24isoprenylcysteine carboxyl methyltransferase [Sour... [more]
icmt2.946e-6050.24isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ICMT2.849e-6449.76allantoinase, mitochondrial-like [Source:Xenbase;A... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Icmt1.756e-6748.34isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O12947|ICMT_XENLA3.032e-7151.18Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
sp|O60725|ICMT_HUMAN9.171e-6849.29Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
sp|Q9WVM4|ICMT_RAT1.888e-6748.82Protein-S-isoprenylcysteine O-methyltransferase (F... [more]
sp|Q9EQK7|ICMT_MOUSE1.154e-6648.34Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
sp|Q558K8|ICMT_DICDI1.587e-5044.09Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SCR22.477e-7141.72Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
A0A0R3TL441.957e-7040.52Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
A0A1S3JQC13.234e-7043.30Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
A0A482VZR51.572e-6951.64Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
A0A433U4Z61.998e-6949.29Protein-S-isoprenylcysteine O-methyltransferase OS... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
icmt8.831e-6148.34isoprenylcysteine carboxyl methyltransferase [Sour... [more]
icmt1.606e-6048.34isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
STE142.941e-3838.74Farnesyl cysteine-carboxyl methyltransferase; medi... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO479031.141e-6547.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277184.234e-4654.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
icmt2.864e-6047.85isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Protein-S-isoprenylcysteine O-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000036295.10.000e+099.65SMESG000036295.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006103 ID=SMED30006103|Name=Protein-S-isoprenylcysteine O-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=969bp
CTATATAAATCTTATATGATAATGTTGACGATATCCTCAAAAGTTTCTTT
AATTGGCATGTTATGTGGAATTTTACAAATTGCTATTGTGAAAATTTGTT
ATGTTTTCGGAATTCAAAATTACATTCTAATTACTCTGCCTGCAATTTTT
ATTGTGTCATCATATTATTTCGTTTCACATAATCATAGCGACACTGATAA
TTTTCAAAAATTGAATTTCTTCTGTGCATTTTTCTTAGGAAGCATAACAT
CGATGGCTATTTTTTTAATGCTCAATGTGCCAAATCATTCTATTTTTACT
ATATATATTATACAATTGTGCTTTTTCCACTGGTCAGAATTTTTTTTGTC
CTCTCTGAGTAATCCTAATGGACTTAAAATCGATCTTTATATGCTTAATC
ATTCTACAGAATACAAAATTGCTTTATTATTAAGTGTTTTTGAATATTGG
ATAGAGAAAACTTATTTTCCGGAAATTTTTGAAAAACTCAGATGGTTATC
TTATTTTGGCTTGCTTATTAGTATCCTTGGTGAATTGTTGAGGAAAATCT
CTTTATGGACAGTCGGTCAGAATTTCAATCATTATGTGGAATTTAGTAAG
CGTGATGATCACGTATTAGTTCGAAGCGGAGTTTATAATTGGTTTCGACA
TCCTTCTTATGTTGGGTGGTTCTACTTCAGCGTTGGAACCCAAATTGCCT
TATTAAATCCAATTTGTTTGATTGGTTATGCCGTAGCTTCGTGGTTATTT
TTTTACAGTCGGATTTATGAAGAAGAGCAGTGTTTACTACGTTTTTTTGG
TGAAGACTATTTGAATTATCAACAAGAAGTGGGCACTGGATTGCCTTTTA
TTAAAGGTTATCATAAATGAGTACATTATATTATGATCTAACAATGATGC
CTTTGATTTTTCGACTGTAGTGCACTGATATATTTTTTATTTTTCAATAA
ATCAGTTGTTATTAAAAAA
back to top

protein sequence of SMED30006103-orf-1

>SMED30006103-orf-1 ID=SMED30006103-orf-1|Name=SMED30006103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=290bp
LYKSYMIMLTISSKVSLIGMLCGILQIAIVKICYVFGIQNYILITLPAIF
IVSSYYFVSHNHSDTDNFQKLNFFCAFFLGSITSMAIFLMLNVPNHSIFT
IYIIQLCFFHWSEFFLSSLSNPNGLKIDLYMLNHSTEYKIALLLSVFEYW
IEKTYFPEIFEKLRWLSYFGLLISILGELLRKISLWTVGQNFNHYVEFSK
RDDHVLVRSGVYNWFRHPSYVGWFYFSVGTQIALLNPICLIGYAVASWLF
FYSRIYEEEQCLLRFFGEDYLNYQQEVGTGLPFIKGYHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0004671protein C-terminal S-isoprenylcysteine carboxyl O-methyltransferase activity
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006481C-terminal protein methylation
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016021integral component of membrane
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
Vocabulary: INTERPRO
TermDefinition
IPR007269ICMT_MeTrfase
IPR025770PPMT_MeTrfase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.120.1630coord: 92..278
e-value: 1.9E-31
score: 111.5
NoneNo IPR availablePANTHERPTHR12714PROTEIN-S ISOPRENYLCYSTEINE O-METHYLTRANSFERASEcoord: 72..279
NoneNo IPR availablePANTHERPTHR12714:SF9PROTEIN-S-ISOPRENYLCYSTEINE O-METHYLTRANSFERASEcoord: 72..279
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 224..246
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 35..52
NoneNo IPR availableTMHMMTMhelixcoord: 157..179
IPR007269Isoprenylcysteine carboxyl methyltransferasePFAMPF04140ICMTcoord: 166..256
e-value: 8.6E-27
score: 93.4
IPR025770Protein-S-isoprenylcysteine O-methyltransferasePROSITEPS51564SAM_ICMTcoord: 6..283
score: 28.983