Multiple PDZ domain crumbs cell polarity complex component

Overview
NameMultiple PDZ domain crumbs cell polarity complex component
Smed IDSMED30006093
Length (bp)3124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multiple PDZ domain crumbs cell polarity complex component (SMED30006093) t-SNE clustered cells

Violin plots show distribution of expression levels for Multiple PDZ domain crumbs cell polarity complex component (SMED30006093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multiple PDZ domain crumbs cell polarity complex component (SMED30006093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multiple PDZ domain crumbs cell polarity complex component (SMED30006093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006093

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006093SMESG000056186.1 Contig3184GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30006093SMESG000056186.1 dd_Smed_v4_4520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006093SMESG000056186.1 dd_Smed_v4_4520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006093SMESG000056186.1 dd_Smed_v4_4520_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30006093SMESG000056186.1 SMED30006093smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 228.024 bits (580), Expect = 2.655e-61
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct:  194 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEED--TLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 671          

HSP 2 Score: 80.4925 bits (197), Expect = 1.088e-14
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct:  590 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 927          

HSP 3 Score: 72.4034 bits (176), Expect = 3.854e-12
Identity = 88/375 (23.47%), Postives = 159/375 (42.40%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT-----ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP----------------------DQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   N V  +V  +                                 NRP++P+  E + E +    L  + P   S  A +    +  ++ + S   + +  D       N+ +   T       I +++    LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++  + IR++D              P+P                      D   ++ V  +E+ K    GLGI++   +   GV I  + + GVA  DGRLK GDQIL ++ E
Sbjct:   60 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI--------------------------------INRPRAPSQSESEPEKAP---LCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKE--DEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKD-QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDE 394          

HSP 4 Score: 61.6178 bits (148), Expect = 7.061e-9
Identity = 52/229 (22.71%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIP----YIPSISTEETHIVYLTKNAQGLGFAIMEG--SFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+       +SS+S   +     +   +   +   + L +   GLGF+I+ G  S   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct:  731 SLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGD--------------------------------VSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 927          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 228.024 bits (580), Expect = 4.399e-61
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct:  271 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEED--TLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 748          

HSP 2 Score: 80.8777 bits (198), Expect = 9.656e-15
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct:  667 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 1004          

HSP 3 Score: 61.6178 bits (148), Expect = 7.509e-9
Identity = 52/229 (22.71%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIP----YIPSISTEETHIVYLTKNAQGLGFAIMEG--SFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+       +SS+S   +     +   +   +   + L +   GLGF+I+ G  S   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct:  808 SLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGD--------------------------------VSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 1004          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 228.794 bits (582), Expect = 1.498e-60
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1349 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDTL--SGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1826          

HSP 2 Score: 83.9593 bits (206), Expect = 1.338e-15
Identity = 98/380 (25.79%), Postives = 172/380 (45.26%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPK---RLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT-----ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP----------------------DQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   +HN YPK     + P   +L   N  K+P+  E + E +    L  + P   S  A +    +  ++ + S   + +  D       N+ +   T       I +++    LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++  + IR++D              P+P                      D   ++ V  +E+ K    GLGI++   +   GV I  + + GVA  DGRLK GDQIL ++ E
Sbjct: 1182 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSL---LHNLYPKYNFSSTNPFADSL-QINADKAPSQSESEPEKAP---LCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKE--DEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKD-QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDE 1549          

HSP 3 Score: 81.2629 bits (199), Expect = 8.688e-15
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1745 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2082          

HSP 4 Score: 61.6178 bits (148), Expect = 8.779e-9
Identity = 52/229 (22.71%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIP----YIPSISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+       +SS+S   +     +   +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct: 1886 SLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGD--------------------------------VSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2082          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 228.794 bits (582), Expect = 1.658e-60
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1335 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDTL--SGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1812          

HSP 2 Score: 88.5817 bits (218), Expect = 5.540e-17
Identity = 135/546 (24.73%), Postives = 235/546 (43.04%), Query Frame = 3
Query: 1245 NCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIR--SCSGKLIK-----------FVIHRSNEWQSKMAVPI----TIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPK---RLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT-----ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP----------------------DQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            N SLG+ ++ NKD   + + +  I+       DGR+ +GD IL +++      ++  A  ++R  S  G  IK           F I    +    MA+ I    T R   E+        E      +A S+ N  R+       ++   PS S   + +       +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   +HN YPK     + P   +L   N  K+P+  E + E +    L  + P   S  A +    +  ++ + S   + +  D       N+ +   T       I +++    LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++  + IR++D              P+P                      D   ++ V  +E+ K    GLGI++   +   GV I  + + GVA  DGRLK GDQIL ++ E
Sbjct: 1015 NSSLGMTVSANKD--GLGMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRV------ELWREPSKSLGISIV-----GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSL---LHNLYPKYNFSSTNPFADSL-QINADKAPSQSESEPEKAP---LCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKE--DEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKD-QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDE 1535          

HSP 3 Score: 81.2629 bits (199), Expect = 9.443e-15
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1731 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          

HSP 4 Score: 68.1662 bits (165), Expect = 8.467e-11
Identity = 64/244 (26.23%), Postives = 104/244 (42.62%), Query Frame = 3
Query: 2220 EDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH----------------EAGAELHLKIRHEDTPIPDQDIYEVVST--------------------------------VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
            E  E+T  I I +   +LG+++    D     +IV  I   GA+++DGRI +GD IL INE   I+ TN +   ML                 E   E  + +  +   +   DI+   +                                 VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct: 1003 ESFERT--INIAKGNSSLGMTVSANKDGL--GMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1242          

HSP 5 Score: 61.6178 bits (148), Expect = 8.996e-9
Identity = 52/229 (22.71%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIP----YIPSISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+       +SS+S   +     +   +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct: 1872 SLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGD--------------------------------VSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 228.794 bits (582), Expect = 1.807e-60
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1302 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDTL--SGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1779          

HSP 2 Score: 80.8777 bits (198), Expect = 1.115e-14
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1698 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2035          

HSP 3 Score: 78.1814 bits (191), Expect = 8.715e-14
Identity = 125/541 (23.11%), Postives = 222/541 (41.04%), Query Frame = 3
Query: 1245 NCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIR--SCSGKLIK-----------FVIHRSNEWQSKMAVPI----TIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT-----ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP----------------------DQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            N SLG+ ++ NKD   + + +  I+       DGR+ +GD IL +++      ++  A  ++R  S  G  IK           F I    +    MA+ I    T R   E+        E      +A S+ N  R+       ++   PS S   + +       +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   N V  +V  +                                 NRP++P+  E + E +    L  + P   S  A +    +  ++ + S   + +  D       N+ +   T       I +++    LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++  + IR++D              P+P                      D   ++ V  +E+ K    GLGI++   +   GV I  + + GVA  DGRLK GDQIL ++ E
Sbjct: 1015 NSSLGMTVSANKD--GLGMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRV------ELWREPSKSLGISIV-----GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI--------------------------------INRPRAPSQSESEPEKAP---LCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKE--DEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKD-QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDE 1502          

HSP 4 Score: 67.781 bits (164), Expect = 1.088e-10
Identity = 61/237 (25.74%), Postives = 100/237 (42.19%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH----------------EAGAELHLKIRHEDTPIPDQDIYEVVST--------------------------------VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
             I I +   +LG+++    D     +IV  I   GA+++DGRI +GD IL INE   I+ TN +   ML                 E   E  + +  +   +   DI+   +                                 VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct: 1008 TINIAKGNSSLGMTVSANKDGL--GMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1242          

HSP 5 Score: 61.6178 bits (148), Expect = 9.604e-9
Identity = 52/229 (22.71%), Postives = 99/229 (43.23%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIP----YIPSISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+       +SS+S   +     +   +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct: 1839 SLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGD--------------------------------VSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2035          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 122.865 bits (307), Expect = 3.315e-29
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI------PDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR---IQQLKQHYTPSYLIAK--------DDNDDNNRTLGKAFSANGHGHSPARSPLAS 2912
            I I ++   LG+SI+GG+DT +G V++H+++ +GA A DGR+K GD++L +N   L   T+++ I  L     ++ L I + D  +      P Q IY +   +++ KK  +GLGIS++GR+   GVY+ ++VKGG+A+ DGRL  GDQILE+NG+D R   QE  A  LK++ G++  K+GR    +   + +  +  +AK        ++N+D  R +  A S      SPA +P  S
Sbjct:   40 IEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLI-YRDVNLQLSLLDPTQ-IYNIFE-IDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVS------SPAATPSTS 270          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 126.331 bits (316), Expect = 4.674e-29
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI------PDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR---IQQLKQHYTPSYLIAK--------DDNDDNNRTLGKAFSANGHGHSPARSPLAS 2912
            I I ++   LG+SI+GG+DT +G V++H+++ +GA A DGR+K GD++L +N   L   T+++ I  L     ++ L I + D  +      P Q IY +   +++ KK  +GLGIS++GR+   GVY+ ++VKGG+A+ DGRL  GDQILE+NG+D R   QE  A  LK++ G++  K+GR    +   + +  +  +AK        ++N+D  R +  A S      SPA +P  S
Sbjct:  979 IEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLI-YRDVNLQLSLLDPTQ-IYNIFE-IDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVS------SPAATPSTS 1209          

HSP 2 Score: 86.6557 bits (213), Expect = 7.417e-17
Identity = 70/269 (26.02%), Postives = 128/269 (47.58%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKL--IKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSD-QNNSRKASSVSLG---------QIPYIPSISTEETH--------IVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            ++  KY   GGEL+L+    P   +  LG+ L GNKD +  N+F+  + P+    I    + GDE+LE++  +L   SH+ A+ V+R C  +   I+ V+ R N   ++ AV      +D I S  S           A S+ ++ + +  + + G         ++    S S E T         ++ + K+ +GLG +I+ G+ T    + I  +   G A  +G L+PGD+++ +N   +   ++D  +  L+    +VRL++ R
Sbjct:  803 KIERKYDSDGGELVLVACERP---DGGLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAV-----RSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1059          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 125.561 bits (314), Expect = 5.467e-29
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI------PDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR---IQQLKQHYTPSYLIAK--------DDNDDNNRTLGKAFSANGHGHSPARSPLAS 2912
            I I ++   LG+SI+GG+DT +G V++H+++ +GA A DGR+K GD++L +N   L   T+++ I  L     ++ L I + D  +      P Q IY +   +++ KK  +GLGIS++GR+   GVY+ ++VKGG+A+ DGRL  GDQILE+NG+D R   QE  A  LK++ G++  K+GR    +   + +  +  +AK        ++N+D  R +  A S      SPA +P  S
Sbjct:  550 IEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLI-YRDVNLQLSLLDPTQ-IYNIFE-IDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVS------SPAATPSTS 780          

HSP 2 Score: 86.6557 bits (213), Expect = 6.227e-17
Identity = 70/269 (26.02%), Postives = 128/269 (47.58%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKL--IKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSD-QNNSRKASSVSLG---------QIPYIPSISTEETH--------IVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            ++  KY   GGEL+L+    P   +  LG+ L GNKD +  N+F+  + P+    I    + GDE+LE++  +L   SH+ A+ V+R C  +   I+ V+ R N   ++ AV      +D I S  S           A S+ ++ + +  + + G         ++    S S E T         ++ + K+ +GLG +I+ G+ T    + I  +   G A  +G L+PGD+++ +N   +   ++D  +  L+    +VRL++ R
Sbjct:  374 KIERKYDSDGGELVLVACERP---DGGLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAV-----RSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 630          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 126.331 bits (316), Expect = 6.197e-29
Identity = 87/240 (36.25%), Postives = 140/240 (58.33%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI------PDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR---IQQLKQHYTPSYLIAK--------DDNDDNNRTLGKAFSANGHGHSPARSPLAS 2912
            I I ++   LG+SI+GG+DT +G V++H+++ +GA A DGR+K GD++L +N   L   T+++ I  L     ++ L I + D  +      P Q IY +   +++ KK  +GLGIS++GR+   GVY+ ++VKGG+A+ DGRL  GDQILE+NG+D R   QE  A  LK++ G++  K+GR    +   + +  +  +AK        ++N+D  R +  A S      SPA +P  S
Sbjct: 1772 IEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLI-YRDVNLQLSLLDPTQ-IYNIFE-IDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWKITETANRVHAATQALAKSATTPRTTENNNDPVRPVAVAVS------SPAATPSTS 2002          

HSP 2 Score: 85.5001 bits (210), Expect = 1.589e-16
Identity = 70/269 (26.02%), Postives = 128/269 (47.58%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKL--IKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSD-QNNSRKASSVSLG---------QIPYIPSISTEETH--------IVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            ++  KY   GGEL+L+    P   +  LG+ L GNKD +  N+F+  + P+    I    + GDE+LE++  +L   SH+ A+ V+R C  +   I+ V+ R N   ++ AV      +D I S  S           A S+ ++ + +  + + G         ++    S S E T         ++ + K+ +GLG +I+ G+ T    + I  +   G A  +G L+PGD+++ +N   +   ++D  +  L+    +VRL++ R
Sbjct: 1596 KIERKYDSDGGELVLVACERP---DGGLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVR-----SDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1852          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 126.331 bits (316), Expect = 6.343e-29
Identity = 75/185 (40.54%), Postives = 119/185 (64.32%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI------PDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            I I ++   LG+SI+GG+DT +G V++H+++ +GA A DGR+K GD++L +N   L   T+++ I  L     ++ L I + D  +      P Q IY +   +++ KK  +GLGIS++GR+   GVY+ ++VKGG+A+ DGRL  GDQILE+NG+D R   QE  A  LK++ G++  K+GR +
Sbjct: 1754 IEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLI-YRDVNLQLSLLDPTQ-IYNIFE-IDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 1935          

HSP 2 Score: 85.8853 bits (211), Expect = 1.470e-16
Identity = 70/269 (26.02%), Postives = 128/269 (47.58%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKL--IKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSD-QNNSRKASSVSLG---------QIPYIPSISTEETH--------IVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            ++  KY   GGEL+L+    P   +  LG+ L GNKD +  N+F+  + P+    I    + GDE+LE++  +L   SH+ A+ V+R C  +   I+ V+ R N   ++ AV      +D I S  S           A S+ ++ + +  + + G         ++    S S E T         ++ + K+ +GLG +I+ G+ T    + I  +   G A  +G L+PGD+++ +N   +   ++D  +  L+    +VRL++ R
Sbjct: 1578 KIERKYDSDGGELVLVACERP---DGGLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVR-----SDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1834          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335522)

HSP 1 Score: 95.1301 bits (235), Expect = 2.310e-19
Identity = 109/399 (27.32%), Postives = 183/399 (45.86%), Query Frame = 3
Query: 1695 AQGLGFAIMEGS----FTNET-GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSP-IHN---------HYPKRLSAPHI-TALPY-YNRPKSPTIQEEKSESSSPGILIKLSPESES-GLATLAKSMSDGNS------RRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD-------TFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDI---YEVVSTVEITKKPSKGLGISVIG----------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
             QGLGF+I  G     F ++  GI+I  +   G A ++G +  GD++++IN  D++ A +D  +  L   +  VRLV+ R  R    P  S  SP + N         + P   S   +    PY YN   + T   + +  +S        P S++ G AT A +  D ++       RR++       DI      + +  E  E + + +N+ +LG SIIGG+D       T    + +  I P G  +K G++++GDRIL +NE  +   T+++ +  L + G E+ L I+H+  P   Q I   Y     V ++K   + LG+ + G              +GV++  +   G A  DGRLK G ++LE+NG      + + A   L++   +I
Sbjct:  938 GQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQE-VVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQSIEVVYVKTEEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEI 1335          

HSP 2 Score: 56.9954 bits (136), Expect = 1.055e-7
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1665 ETHIVYLTKNAQGLGFAIMEGS-------FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASY-DMVLELLK 1883
            E   V L KN   LGF+I+ G+        T E GI+I H+   G A + G LR GD+++ +N  DVS A++ D VLELLK
Sbjct: 1141 EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLK 1221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0335521)

HSP 1 Score: 93.5893 bits (231), Expect = 6.968e-19
Identity = 109/399 (27.32%), Postives = 183/399 (45.86%), Query Frame = 3
Query: 1695 AQGLGFAIMEGS----FTNET-GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSP-IHN---------HYPKRLSAPHI-TALPY-YNRPKSPTIQEEKSESSSPGILIKLSPESES-GLATLAKSMSDGNS------RRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD-------TFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDI---YEVVSTVEITKKPSKGLGISVIG----------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
             QGLGF+I  G     F ++  GI+I  +   G A ++G +  GD++++IN  D++ A +D  +  L   +  VRLV+ R  R    P  S  SP + N         + P   S   +    PY YN   + T   + +  +S        P S++ G AT A +  D ++       RR++       DI      + +  E  E + + +N+ +LG SIIGG+D       T    + +  I P G  +K G++++GDRIL +NE  +   T+++ +  L + G E+ L I+H+  P   Q I   Y     V ++K   + LG+ + G              +GV++  +   G A  DGRLK G ++LE+NG      + + A   L++   +I
Sbjct:  938 GQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQE-VVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQSIEVVYVKTEEVLLSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEI 1335          

HSP 2 Score: 56.9954 bits (136), Expect = 1.155e-7
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1665 ETHIVYLTKNAQGLGFAIMEGS-------FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASY-DMVLELLK 1883
            E   V L KN   LGF+I+ G+        T E GI+I H+   G A + G LR GD+++ +N  DVS A++ D VLELLK
Sbjct: 1141 EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLK 1221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308620)

HSP 1 Score: 93.2041 bits (230), Expect = 1.098e-18
Identity = 106/396 (26.77%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1695 AQGLGFAIMEGS----FTNET-GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSP-IHN---------HYPKRLSAPHI-TALPY-YNRPKSPTIQEEKSESSSPGILIKLSPESES-GLATLAKSMSDGNS------RRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD-------TFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIG----------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
             QGLGF+I  G     F ++  GI+I  +   G A ++G +  GD++++IN  D++ A +D  +  L   +  VRLV+ R  R    P  S  SP + N         + P   S   +    PY YN   + T   + +  +S        P S++ G AT A +  D ++       RR++       DI      + +  E  E + + +N+ +LG SIIGG+D       T    + +  I P G  +K G++++GDRIL +NE  +   T+++ +  L + G E+ L I+H+  P   Q++        ++K   + LG+ + G              +GV++  +   G A  DGRLK G ++LE+NG      + + A   L++   +I
Sbjct:  938 GQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQE-VVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVL-------LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEI 1325          

HSP 2 Score: 56.9954 bits (136), Expect = 1.063e-7
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1665 ETHIVYLTKNAQGLGFAIMEGS-------FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASY-DMVLELLK 1883
            E   V L KN   LGF+I+ G+        T E GI+I H+   G A + G LR GD+++ +N  DVS A++ D VLELLK
Sbjct: 1141 EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLK 1221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308621)

HSP 1 Score: 93.2041 bits (230), Expect = 1.098e-18
Identity = 106/396 (26.77%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1695 AQGLGFAIMEGS----FTNET-GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSP-IHN---------HYPKRLSAPHI-TALPY-YNRPKSPTIQEEKSESSSPGILIKLSPESES-GLATLAKSMSDGNS------RRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD-------TFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIG----------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
             QGLGF+I  G     F ++  GI+I  +   G A ++G +  GD++++IN  D++ A +D  +  L   +  VRLV+ R  R    P  S  SP + N         + P   S   +    PY YN   + T   + +  +S        P S++ G AT A +  D ++       RR++       DI      + +  E  E + + +N+ +LG SIIGG+D       T    + +  I P G  +K G++++GDRIL +NE  +   T+++ +  L + G E+ L I+H+  P   Q++        ++K   + LG+ + G              +GV++  +   G A  DGRLK G ++LE+NG      + + A   L++   +I
Sbjct:  938 GQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQE-VVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVL-------LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEI 1325          

HSP 2 Score: 56.9954 bits (136), Expect = 1.063e-7
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1665 ETHIVYLTKNAQGLGFAIMEGS-------FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASY-DMVLELLK 1883
            E   V L KN   LGF+I+ G+        T E GI+I H+   G A + G LR GD+++ +N  DVS A++ D VLELLK
Sbjct: 1141 EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLK 1221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: scrib (gene:FBgn0263289 transcript:FBtr0308627)

HSP 1 Score: 92.8189 bits (229), Expect = 1.406e-18
Identity = 106/396 (26.77%), Postives = 182/396 (45.96%), Query Frame = 3
Query: 1695 AQGLGFAIMEGS----FTNET-GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSP-IHN---------HYPKRLSAPHI-TALPY-YNRPKSPTIQEEKSESSSPGILIKLSPESES-GLATLAKSMSDGNS------RRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD-------TFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIG----------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
             QGLGF+I  G     F ++  GI+I  +   G A ++G +  GD++++IN  D++ A +D  +  L   +  VRLV+ R  R    P  S  SP + N         + P   S   +    PY YN   + T   + +  +S        P S++ G AT A +  D ++       RR++       DI      + +  E  E + + +N+ +LG SIIGG+D       T    + +  I P G  +K G++++GDRIL +NE  +   T+++ +  L + G E+ L I+H+  P   Q++        ++K   + LG+ + G              +GV++  +   G A  DGRLK G ++LE+NG      + + A   L++   +I
Sbjct:  938 GQGLGFSIAGGKGSPPFKDDCDGIFISRITEGGLAYRDGKIMVGDRVMAINGNDMTEAHHDAAVACLTEPQRFVRLVLQREYRGPLEPPTSPRSPAVLNSLSPSGYLANRPANFSRSVVEVEQPYKYNTLATTTPTPKPTVPASISNNNNTLPSSKTNGFATAAAATIDSSTGQPVPAPRRTNSVPMGDGDIGAGSTTSGDSGEAQE-VVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLKPGDEIKLTIQHDPLPPGFQEVL-------LSKAEGERLGMHIKGGLNGQRGNPADPSDEGVFVSKINSVGAARRDGRLKVGMRLLEVNGHSLLGASHQDAVNVLRNAGNEI 1325          

HSP 2 Score: 56.9954 bits (136), Expect = 1.047e-7
Identity = 35/81 (43.21%), Postives = 47/81 (58.02%), Query Frame = 3
Query: 1665 ETHIVYLTKNAQGLGFAIMEGS-------FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASY-DMVLELLK 1883
            E   V L KN   LGF+I+ G+        T E GI+I H+   G A + G LR GD+++ +N  DVS A++ D VLELLK
Sbjct: 1141 EAQEVVLPKNQGSLGFSIIGGTDHSCVPFGTREPGIFISHIVPGGIASKCGKLRMGDRILKVNEADVSKATHQDAVLELLK 1221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 126.716 bits (317), Expect = 6.485e-29
Identity = 71/179 (39.66%), Postives = 116/179 (64.80%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L +  +E+ I  L +   ++ L +  ++    D++  +V   VE+ KK  +GLG+S++G+   KGV+I DVVKGG AD+DGRL  GDQIL ++GED R  +QE  A  LK   G+++ ++GR++
Sbjct: 1468 IEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFP-VELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKCARGKVLLELGRLK 1645          

HSP 2 Score: 87.8113 bits (216), Expect = 5.562e-17
Identity = 44/107 (41.12%), Postives = 70/107 (65.42%), Query Frame = 3
Query: 1182 NKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
             +Y DL GEL+++ +   R     LGL L GN+D + M+IF+  I     A  DGR++VGDE+LE++  +L+GRSH NA+ +I+S + K +K V+ R+ +  ++MAV
Sbjct: 1214 QRYADLPGELLIVELEKDR---NGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASK-VKLVLVRNEDAINQMAV 1316          

HSP 3 Score: 81.2629 bits (199), Expect = 5.666e-15
Identity = 69/201 (34.33%), Postives = 95/201 (47.26%), Query Frame = 3
Query: 2265 DALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEI-------------------TKKP--------SKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            DALGISI GG  + +GD+   +  I  NG  AK  R+KVGDRI+ IN   L   T+ +++ ML  A   + L++      + D +I  + S VE                    T KP        S+GLG S++G  G+      +Y+  V   G A VDGRLK GDQ+L +NGE     T E A   LK   G +   +
Sbjct: 1718 DALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQV------VADTNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1912          

HSP 4 Score: 65.4698 bits (158), Expect = 3.535e-10
Identity = 59/228 (25.88%), Postives = 106/228 (46.49%), Query Frame = 3
Query: 1251 SLGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTE--ETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            +LG+ + G K   L  + IFI  I  N +A    RL+VGD I+ ++   L G +H +   ++++  G +I  V+  +N                                +SA++ Q  S  +SS      P +  +  E  +   + L K ++GLGF+I+ G F +  G   IY+K +  +G A  +G L+ GD+L+S+N + +   +++  + +LK  +  V L V
Sbjct: 1719 ALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTN--------------------------------ISAIASQVESLSSSSAPSTN-PEVRLVEPETPKPKSITLEKGSEGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1912          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 116.316 bits (290), Expect = 1.106e-25
Identity = 68/165 (41.21%), Postives = 106/165 (64.24%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLK 2738
            I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L +  +E+ I  L +   ++ L +  ++    D++  +V   VE+ KK  +GLG+S++G+   KGV+I DVVKGG AD+DGRL  GDQIL ++GED R  +QE  A  LK
Sbjct: 1468 IEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFP-VELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILK 1631          

HSP 2 Score: 87.8113 bits (216), Expect = 5.643e-17
Identity = 44/107 (41.12%), Postives = 70/107 (65.42%), Query Frame = 3
Query: 1182 NKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
             +Y DL GEL+++ +   R     LGL L GN+D + M+IF+  I     A  DGR++VGDE+LE++  +L+GRSH NA+ +I+S + K +K V+ R+ +  ++MAV
Sbjct: 1214 QRYADLPGELLIVELEKDR---NGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASK-VKLVLVRNEDAINQMAV 1316          

HSP 3 Score: 82.0333 bits (201), Expect = 3.643e-15
Identity = 71/213 (33.33%), Postives = 100/213 (46.95%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEI-------------------TKKP--------SKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            ++T    +K   DALGISI GG  + +GD+   +  I  NG  AK  R+KVGDRI+ IN   L   T+ +++ ML  A   + L++      + D +I  + S VE                    T KP        S+GLG S++G  G+      +Y+  V   G A VDGRLK GDQ+L +NGE     T E A   LK   G +   +
Sbjct: 1623 QETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQV------VADTNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 4 Score: 65.4698 bits (158), Expect = 3.917e-10
Identity = 59/228 (25.88%), Postives = 106/228 (46.49%), Query Frame = 3
Query: 1251 SLGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTE--ETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            +LG+ + G K   L  + IFI  I  N +A    RL+VGD I+ ++   L G +H +   ++++  G +I  V+  +N                                +SA++ Q  S  +SS      P +  +  E  +   + L K ++GLGF+I+ G F +  G   IY+K +  +G A  +G L+ GD+L+S+N + +   +++  + +LK  +  V L V
Sbjct: 1636 ALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTN--------------------------------ISAIASQVESLSSSSAPSTN-PEVRLVEPETPKPKSITLEKGSEGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 116.316 bits (290), Expect = 1.106e-25
Identity = 68/165 (41.21%), Postives = 106/165 (64.24%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLK 2738
            I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L +  +E+ I  L +   ++ L +  ++    D++  +V   VE+ KK  +GLG+S++G+   KGV+I DVVKGG AD+DGRL  GDQIL ++GED R  +QE  A  LK
Sbjct: 1468 IEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFP-VELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILK 1631          

HSP 2 Score: 87.8113 bits (216), Expect = 5.643e-17
Identity = 44/107 (41.12%), Postives = 70/107 (65.42%), Query Frame = 3
Query: 1182 NKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
             +Y DL GEL+++ +   R     LGL L GN+D + M+IF+  I     A  DGR++VGDE+LE++  +L+GRSH NA+ +I+S + K +K V+ R+ +  ++MAV
Sbjct: 1214 QRYADLPGELLIVELEKDR---NGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASK-VKLVLVRNEDAINQMAV 1316          

HSP 3 Score: 82.0333 bits (201), Expect = 3.643e-15
Identity = 71/213 (33.33%), Postives = 100/213 (46.95%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEI-------------------TKKP--------SKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            ++T    +K   DALGISI GG  + +GD+   +  I  NG  AK  R+KVGDRI+ IN   L   T+ +++ ML  A   + L++      + D +I  + S VE                    T KP        S+GLG S++G  G+      +Y+  V   G A VDGRLK GDQ+L +NGE     T E A   LK   G +   +
Sbjct: 1623 QETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQV------VADTNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 4 Score: 65.4698 bits (158), Expect = 3.917e-10
Identity = 59/228 (25.88%), Postives = 106/228 (46.49%), Query Frame = 3
Query: 1251 SLGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTE--ETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            +LG+ + G K   L  + IFI  I  N +A    RL+VGD I+ ++   L G +H +   ++++  G +I  V+  +N                                +SA++ Q  S  +SS      P +  +  E  +   + L K ++GLGF+I+ G F +  G   IY+K +  +G A  +G L+ GD+L+S+N + +   +++  + +LK  +  V L V
Sbjct: 1636 ALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTN--------------------------------ISAIASQVESLSSSSAPSTN-PEVRLVEPETPKPKSITLEKGSEGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 108.612 bits (270), Expect = 2.859e-23
Identity = 64/196 (32.65%), Postives = 116/196 (59.18%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYT 2801
            + I +    LG+SI+GG +T +G +++H++  +GA  +DGR+  GD IL +N I L   T+EE +++L  +   + L I          +H       +D++++ + VE+  +P +GLG+ ++G+    G+++ ++ +GG ADVDGRL  GDQIL +NGED R  +Q+ A+  L+   G ++ ++ R +    HY+
Sbjct: 1462 VDICKGTTGLGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLRLSPQRVRLSIYRDHVTEKHSKHTSQKHTPEDMWDLFN-VELNLQPRQGLGLCIVGKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKA-SSHYS 1655          

HSP 2 Score: 72.7886 bits (177), Expect = 1.999e-12
Identity = 42/115 (36.52%), Postives = 71/115 (61.74%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCS-----LGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKM 1496
            R+  +YG L GEL++ ++      +CS     LGL L+GN+D     M++F+ +I  +  A  DGR++VGDE+LE++  +L+GRSH NAT +I +   K ++ ++ R+   Q +M
Sbjct: 1223 RMQQRYGSLPGELLMFDL------DCSSHGSGLGLCLSGNRDGARGRMSVFVSEITADGAAAADGRVRVGDELLEINGQVLYGRSHQNATAIINNAPAK-VRILLTRNKAVQKQM 1330          

HSP 3 Score: 60.077 bits (144), Expect = 1.588e-8
Identity = 67/254 (26.38%), Postives = 107/254 (42.13%), Query Frame = 3
Query: 1743 TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTP 2498
             G+YI  L     A + G L+ G ++ISIN       S      LLKN    V L V   R            I +   K++          +N   S T            + +K+ P   SG A  A   +D     RSS+ ++      N   +N +   + + I ++R    LG SI+GG  +  GD  + V +IFP GA  +DGR++ GD++L +N   L   T+ E + +L +    + L++  +  P
Sbjct: 1707 AGMYISKLDASTLAARSGLLQLGSRVISINGTQTERLSVAEASFLLKNSSGAVTLQVCVFR----------QDILDTKQKQM----------FNHSPSHTC-----------VSLKVMP---SGCADGASISTD-----RSSLIHSSPGLSENYTTHNHQSSPQYQTITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKRPP 1921          

HSP 4 Score: 57.7658 bits (138), Expect = 9.693e-8
Identity = 59/231 (25.54%), Postives = 98/231 (42.42%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSH 1946
            LGL + G  +     I I ++  +  A  DGRL  GD ILEV+   L   +H  A  V+R  S + ++  I+R                                D ++    ++ S+K          + P    +  ++    +  QGLG  I+     N+TGI++  +   G A  +G L  GD+++S+N +D+ +AS D    LL+     V L VAR + S+  S+
Sbjct: 1471 LGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLR-LSPQRVRLSIYR--------------------------------DHVTEKHSKHTSQK----------HTPEDMWDLFNVELNLQPRQGLGLCIV--GKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSHYSY 1656          

HSP 5 Score: 55.0694 bits (131), Expect = 5.122e-7
Identity = 29/93 (31.18%), Postives = 54/93 (58.06%), Query Frame = 3
Query: 1656 STEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVR 1925
            S+ +   + L + + GLGF+I+ G F +  G   IY+K++  +G A+++G LR GD+L+++N Q +   ++   +E+L+     V L V   R
Sbjct: 1828 SSPQYQTITLERGSAGLGFSIV-GGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKR 1919          

HSP 6 Score: 54.299 bits (129), Expect = 9.176e-7
Identity = 35/94 (37.23%), Postives = 48/94 (51.06%), Query Frame = 3
Query: 1647 PSISTEETHIVY---LTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            PS ST +   +Y   L  +  GLGF I+ G     TG  +K +   G A ++G LR GD L+SI   DVS    + V   L+     VRL++AR
Sbjct:  256 PSFSTPKPRQIYHVELENDGSGLGFGIIGG---RSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAR 346          

HSP 7 Score: 52.373 bits (124), Expect = 3.607e-6
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 3
Query: 2232 KTENIY---IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDT---PIP----DQDIYEVVSTVEITKKPSKG 2564
            K   IY   ++ +   LG  IIGG  T     +V  I P+G   KDGR++ GD +L I ++ +    +EE+   L  AG  + L I  E T   P+P     QD  +   TVE  +K  KG
Sbjct:  262 KPRQIYHVELENDGSGLGFGIIGGRST---GTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREITDSDPLPASALQQDTQKKQDTVE--QKWKKG 377          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 108.227 bits (269), Expect = 3.079e-23
Identity = 64/196 (32.65%), Postives = 116/196 (59.18%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYT 2801
            + I +    LG+SI+GG +T +G +++H++  +GA  +DGR+  GD IL +N I L   T+EE +++L  +   + L I          +H       +D++++ + VE+  +P +GLG+ ++G+    G+++ ++ +GG ADVDGRL  GDQIL +NGED R  +Q+ A+  L+   G ++ ++ R +    HY+
Sbjct: 1428 VDICKGTTGLGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLRLSPQRVRLSIYRDHVTEKHSKHTSQKHTPEDMWDLFN-VELNLQPRQGLGLCIVGKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKA-SSHYS 1621          

HSP 2 Score: 73.1738 bits (178), Expect = 1.810e-12
Identity = 42/115 (36.52%), Postives = 71/115 (61.74%), Query Frame = 3
Query: 1173 RLANKYGDLGGELILLNIPNPRLSNCS-----LGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKM 1496
            R+  +YG L GEL++ ++      +CS     LGL L+GN+D     M++F+ +I  +  A  DGR++VGDE+LE++  +L+GRSH NAT +I +   K ++ ++ R+   Q +M
Sbjct: 1189 RMQQRYGSLPGELLMFDL------DCSSHGSGLGLCLSGNRDGARGRMSVFVSEITADGAAAADGRVRVGDELLEINGQVLYGRSHQNATAIINNAPAK-VRILLTRNKAVQKQM 1296          

HSP 3 Score: 57.7658 bits (138), Expect = 8.867e-8
Identity = 59/231 (25.54%), Postives = 98/231 (42.42%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSH 1946
            LGL + G  +     I I ++  +  A  DGRL  GD ILEV+   L   +H  A  V+R  S + ++  I+R                                D ++    ++ S+K          + P    +  ++    +  QGLG  I+     N+TGI++  +   G A  +G L  GD+++S+N +D+ +AS D    LL+     V L VAR + S+  S+
Sbjct: 1437 LGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLR-LSPQRVRLSIYR--------------------------------DHVTEKHSKHTSQK----------HTPEDMWDLFNVELNLQPRQGLGLCIV--GKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSHYSY 1622          

HSP 4 Score: 57.7658 bits (138), Expect = 8.942e-8
Identity = 29/89 (32.58%), Postives = 50/89 (56.18%), Query Frame = 3
Query: 2238 ENIYIKRNEDALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTP 2498
            + I ++R    LG SI+GG  +  GD  + V +IFP GA  +DGR++ GD++L +N   L   T+ E + +L +    + L++  +  P
Sbjct: 1770 QTITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKRPP 1858          

HSP 5 Score: 55.0694 bits (131), Expect = 5.144e-7
Identity = 29/93 (31.18%), Postives = 54/93 (58.06%), Query Frame = 3
Query: 1656 STEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVR 1925
            S+ +   + L + + GLGF+I+ G F +  G   IY+K++  +G A+++G LR GD+L+++N Q +   ++   +E+L+     V L V   R
Sbjct: 1765 SSPQYQTITLERGSAGLGFSIV-GGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKR 1856          

HSP 6 Score: 54.299 bits (129), Expect = 8.909e-7
Identity = 35/94 (37.23%), Postives = 48/94 (51.06%), Query Frame = 3
Query: 1647 PSISTEETHIVY---LTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            PS ST +   +Y   L  +  GLGF I+ G     TG  +K +   G A ++G LR GD L+SI   DVS    + V   L+     VRL++AR
Sbjct:  222 PSFSTPKPRQIYHVELENDGSGLGFGIIGG---RSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAR 312          

HSP 7 Score: 52.373 bits (124), Expect = 3.415e-6
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 3
Query: 2232 KTENIY---IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDT---PIP----DQDIYEVVSTVEITKKPSKG 2564
            K   IY   ++ +   LG  IIGG  T     +V  I P+G   KDGR++ GD +L I ++ +    +EE+   L  AG  + L I  E T   P+P     QD  +   TVE  +K  KG
Sbjct:  228 KPRQIYHVELENDGSGLGFGIIGGRST---GTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREITDSDPLPASALQQDTQKKQDTVE--QKWKKG 343          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 230.72 bits (587), Expect = 3.363e-61
Identity = 175/546 (32.05%), Postives = 281/546 (51.47%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV-PITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYL--TKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKS-MSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K+++ +YG+L GEL ++ +   +     LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV P+                                 KA+  S        ++  +  HIV     K+  GLG AI E    N  G+ IK L   G A ++G ++ GD +++++ + V     + V+ LLK  K  V+L +              S      P+ L  P IT                   +SS G       E ++G   L  S  S+    R SS ++T +    +     +    +T  I I +    LG+SI+GG+DT +G +I+H+++  GA +KDGR+  GD+IL +N I L N T++E I +L +   ++ L +  ++    ++D+Y+V+  +E+ KKP KGLG+S++G+    GV++ D+VKGG+A++DGRL  GDQ+L +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1177 KKISQRYGNLPGELHMIELEKGK---TGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAVCPV---------------------------------KATEPSFPNSSAFSNLEVQNNHIVIFLPNKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI--------------SSDEKDMPQLLPLPSITL------------------TSSTG-------EIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCET-TIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1642          

HSP 2 Score: 78.9518 bits (193), Expect = 3.954e-14
Identity = 97/391 (24.81%), Postives = 158/391 (40.41%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI--RHEDTPIPDQDIYEVVSTVE----------------------ITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+L+ +N +DV +A+ + V  LLK     V+L V R++           P H+      S+  I  L  +  P +  IQ            + L+     GL T                                        + IK+   D+LGISI GG  + +GDV   +  +  NG  A+  +++VGDRI+ I        T+ + +T+L  A   + L++    + + +  Q    + STV                       I ++   GLG S++G  G+      +Y+  V   G A  DGRL  GDQI+ +NG+     T E A + LK   G +   +
Sbjct: 1561 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTG---------PFHSERRTSQSSQVIKNLTQF--PLNRLIQ-----------FLSLAASEIQGLRT----------------------------------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 1887          

HSP 3 Score: 63.1586 bits (152), Expect = 3.122e-9
Identity = 56/199 (28.14%), Postives = 93/199 (46.73%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH--------------EDTP-IP---------DQDIYEVVSTVEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLK 2738
            +  E + +  +   LG  I+GG  T    VIV  I P G   ++GR+  GD IL I +  L   ++E++  +L + G  + L I                + TP +P         D D ++V  T     K ++GLGI++ G  G K     G+++  + KG   + DGR++ GDQI+ ++G + R  T + A   L+
Sbjct:  256 QHVETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVNADGDAFDVKLT-----KNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLR 446          

HSP 4 Score: 59.3066 bits (142), Expect = 4.402e-8
Identity = 53/229 (23.14%), Postives = 96/229 (41.92%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIP----SISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  +  N +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+ Q      S+VS   +         +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L  GD++I++N Q +   +++  + +LK  K  V L V
Sbjct: 1691 SLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGD--------------------------------VSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 1887          

HSP 5 Score: 52.373 bits (124), Expect = 4.753e-6
Identity = 29/92 (31.52%), Postives = 49/92 (53.26%), Query Frame = 3
Query: 2226 DEKTENIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            D    ++ + +N   LGI+I G    ++GD       + V  I    AV +DGRI+VGD+I+V++   L   TN++ + +L   G  +HL +
Sbjct:  369 DGDAFDVKLTKNAQGLGITIAG----YVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTL 456          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 228.794 bits (582), Expect = 1.443e-60
Identity = 174/543 (32.04%), Postives = 285/543 (52.49%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKS-MSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K+++ +YG+L GEL ++ +   +     LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C  +          +  +    V +++       +++G    +        H V L K+  GLG AI E    N  G+ IK L   G A ++G ++ GD +++++ + V     + V+ LLK  K  V+L +              S      P+ L  P IT                   +SS G       E ++G   L  S  S+    R SS ++T +    +     +    +T  I I +    LG+SI+GG+DT +G +I+H+++  GA +KDGR+  GD+IL +N I L N T++E I +L +   ++ L +  ++    ++D+Y+V+  +E+ KKP KGLG+S++G+    GV++ D+VKGG+A++DGRL  GDQ+L +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1428 KKISQRYGNLPGELHMIELEKGK---TGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPVKATEPSFPNSSAFSNL--EVEEESVPSPVLPLNVGSFKNV-------LH-VELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI--------------SSDEKDMPQLLPLPSITL------------------TSSTG-------EIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCET-TIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1908          

HSP 2 Score: 83.1889 bits (204), Expect = 2.014e-15
Identity = 98/391 (25.06%), Postives = 164/391 (41.94%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI--RHEDTPIPDQDIYEVVSTVE----------------------ITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+L+ +N +DV +A+ + V  LLK     V+L V R++           P H+   +R S             +S  + E  S  +S    +     ++SG              ++S  +  Q L                  + IK+   D+LGISI GG  + +GDV   +  +  NG  A+  +++VGDRI+ I        T+ + +T+L  A   + L++    + + +  Q    + STV                       I ++   GLG S++G  G+      +Y+  V   G A  DGRL  GDQI+ +NG+     T E A + LK   G +   +
Sbjct: 1827 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTG---------PFHSE--RRTS-------------QSSQVSEGTSSLTSFSFPMPGPAAADSG-------------SKKSDTSEIQGL----------------RTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2162          

HSP 3 Score: 80.1073 bits (196), Expect = 2.064e-14
Identity = 97/416 (23.32%), Postives = 167/416 (40.14%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIM-----EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-----------VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            LG  + G K      + +  I+P  +AD +GRL  GD IL++ D  L G S      V+R C GK +K VI R     S   V   ++    + S++ ++      C   + D +                      +   V LTKNAQGLG  I      +GS    +GI++K +       Q+G ++ GD++I ++  ++   +    +E+L++    V L + R           V     P+ S G P+ N        P I           PT     ++S SP     L  E E+ + T  + +           +  Q +  V   +   + ++ +E+         LGIS+    +   G   +  I P G V + G +  GD +L +N I L+ + + +++ +L E
Sbjct:  271 LGFGIVGGKS---TGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQV-----CEGEIKDADG---------------------DAFDVKLTKNAQGLGITIAGYVGDKGS--EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTES-GQPLQNADSSEACVPII-----------PTSFSSDAQSQSPANWSSLQAEKETQVDTDEEDIK----------SKWQRIMGVGYEIVVAKVNKFSES-------SGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKE 621          

HSP 4 Score: 72.4034 bits (176), Expect = 4.008e-12
Identity = 128/586 (21.84%), Postives = 230/586 (39.25%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFG----------RSHLNATPVIRSCSGK--------LIKFVIHRS-NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLT-KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVA---------RVRCSNSPS----HSVGSPIHNHYPKRLSAPHITAL----PYY---NRPKSPTIQEEKSESSSPGILIKLSPESESGLATL-AKSMSDGNSRRRS-----------SVTNTQSLDIVXXXXXXXEDD-----EKTENIY-----------IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAEL---------------------------------HLKIRHEDTPIPDQDI----YEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            SLG+ ++ +KD   M   +  I+       DGR+ VGD IL +++               R H    P IRS            +I +V      E++S +  P  ++   EI    +      +        + +  + ++ S    P    +  E    + ++    +G+G  +  G      GI+IKH+    PA + G+L+ GD+++ ++  D+  AS++  +E ++   N V  +V           V CS S S    H   +P  +  PK+ + P + +     P +   N   S  +   K   +   I  + SP +        A S SD  + + S           S  N++ L + +      ED+     +K    Y           +++ +  LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++                                 +L++  E  P P   +    ++ V  VE+ K    GLGI++   +   GV I  +   G A  DGR+K GD IL ++ E
Sbjct: 1049 SLGMTVSASKDGAGM--IVRSIINGGSISRDGRISVGDCILSINNECTANLTNAQARAMLRRHSLLGPDIRSSPAPADDQAPFYVITYVPSEHLEEYRSCLGQPSEVKGTGEIYESNTESFVPELPEREEGEGEESELENATYSNWNNPRRVELWREPGKSLGISIVGGRGMGSRLSNGEVMR--GIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQHPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVELPKD-QGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDE 1629          

HSP 5 Score: 62.7734 bits (151), Expect = 3.321e-9
Identity = 106/442 (23.98%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1236 RLSNCSLGLKLT-----GNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPIT------IRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG---SFTNETGI-----------YIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGL-----ATLAKSMSDGNSRRRSSVTNTQSL-DIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA 2456
            +L+  + GL +T     G+K      IF+  I   S  + DGR+QVGD+I+ VD   L G ++  A  V+R  +G+ +   + R    Q +  +P              +Q+  SS     +   S  SD  +   A+  SL Q      + T+E  I    +   G+G+ I+      F+  +G+           +++ +  +GP  + GSL  GD+L+ +N   +   ++  V+ +LK +   V +V  R V+  NS        I               LP   +     +QE+          I  S +++S L      T+  S +D      +S  + QS+ D     L   E D   ++I +++    LG SI+   D        +++  + P G   +DGR+  GDR++ +NEI L + + EE +  L  A
Sbjct:  383 KLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRH-TGQSVHLTLVRRGLKQ-EACIPQVEEPRKPTESGQPLQNADSSEACVPIIPTSFSSDAQSQSPANWSSL-QAEKETQVDTDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQENDGPEGDFPVPLPALWK-----MQED----------IPQSLDTDSKLHIDFGGTVGSSETD--DLNTASTEDGQSIEDAQGSPLAMWETD--IQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGA 802          

HSP 6 Score: 60.4622 bits (145), Expect = 1.893e-8
Identity = 53/229 (23.14%), Postives = 96/229 (41.92%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIP----SISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  +  N +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+ Q      S+VS   +         +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L  GD++I++N Q +   +++  + +LK  K  V L V
Sbjct: 1966 SLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGD--------------------------------VSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2162          

HSP 7 Score: 53.1434 bits (126), Expect = 2.932e-6
Identity = 29/92 (31.52%), Postives = 49/92 (53.26%), Query Frame = 3
Query: 2226 DEKTENIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            D    ++ + +N   LGI+I G    ++GD       + V  I    AV +DGRI+VGD+I+V++   L   TN++ + +L   G  +HL +
Sbjct:  376 DGDAFDVKLTKNAQGLGITIAG----YVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTL 463          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 228.794 bits (582), Expect = 1.455e-60
Identity = 179/543 (32.97%), Postives = 283/543 (52.12%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKS-MSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K+++ +YG+L GEL ++ +   +     LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C  +                SA S  N   +  SV    +P          H V L K+  GLG AI E    N  G+ IK L   G A ++G ++ GD +++++ + V     + V+ LLK  K  V+L +              S      P+ L  P IT                   +SS G       E ++G   L  S  S+    R SS ++T +    +     +    +T  I I +    LG+SI+GG+DT +G +I+H+++  GA +KDGR+  GD+IL +N I L N T++E I +L +   ++ L +  ++    ++D+Y+V+  +E+ KKP KGLG+S++G+    GV++ D+VKGG+A++DGRL  GDQ+L +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1368 KKISQRYGNLPGELHMIELEKGK---TGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPVKATEPSFPNS-------SAFS--NLEVEEESVPSPVLPLNVGSFKNVLH-VELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI--------------SSDEKDMPQLLPLPSITL------------------TSSTG-------EIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCET-TIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1848          

HSP 2 Score: 83.1889 bits (204), Expect = 2.125e-15
Identity = 98/391 (25.06%), Postives = 164/391 (41.94%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI--RHEDTPIPDQDIYEVVSTVE----------------------ITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+L+ +N +DV +A+ + V  LLK     V+L V R++           P H+   +R S             +S  + E  S  +S    +     ++SG              ++S  +  Q L                  + IK+   D+LGISI GG  + +GDV   +  +  NG  A+  +++VGDRI+ I        T+ + +T+L  A   + L++    + + +  Q    + STV                       I ++   GLG S++G  G+      +Y+  V   G A  DGRL  GDQI+ +NG+     T E A + LK   G +   +
Sbjct: 1767 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTG---------PFHSE--RRTS-------------QSSQVSEGTSSLTSFSFPMPGPAAADSG-------------SKKSDTSEIQGL----------------RTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2102          

HSP 3 Score: 80.4925 bits (197), Expect = 1.647e-14
Identity = 97/416 (23.32%), Postives = 167/416 (40.14%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIM-----EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-----------VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            LG  + G K      + +  I+P  +AD +GRL  GD IL++ D  L G S      V+R C GK +K VI R     S   V   ++    + S++ ++      C   + D +                      +   V LTKNAQGLG  I      +GS    +GI++K +       Q+G ++ GD++I ++  ++   +    +E+L++    V L + R           V     P+ S G P+ N        P I           PT     ++S SP     L  E E+ + T  + +           +  Q +  V   +   + ++ +E+         LGIS+    +   G   +  I P G V + G +  GD +L +N I L+ + + +++ +L E
Sbjct:  271 LGFGIVGGKS---TGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQV-----CEGEIKDADG---------------------DAFDVKLTKNAQGLGITIAGYVGDKGS--EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTES-GQPLQNADSSEACVPII-----------PTSFSSDAQSQSPANWSSLQAEKETQVDTDEEDIK----------SKWQRIMGVGYEIVVAKVNKFSES-------SGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKE 621          

HSP 4 Score: 67.781 bits (164), Expect = 1.070e-10
Identity = 118/545 (21.65%), Postives = 217/545 (39.82%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFG----------RSHLNATPVIRSCSGK--------LIKFVIHRS-NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLT-KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTEN-------IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAEL---------------------------------HLKIRHEDTPIPDQDI----YEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            SLG+ ++ +KD   M   +  I+       DGR+ VGD IL +++               R H    P IRS            +I +V      E++S +  P  ++   EI    +      +        + +  + ++ S    P    +  E    + ++    +G+G  +  G      GI+IKH+    PA + G+L+ GD+++ ++  D+  AS++  +E ++   N V  +V  +         +  P     P R++       P    P +PT  +  S S S     +    S S   T   ++S  NS +    ++T          +  +  ++  N       I +++ +  LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++                                 +L++  E  P P   +    ++ V  VE+ K    GLGI++   +   GV I  +   G A  DGR+K GD IL ++ E
Sbjct: 1049 SLGMTVSASKDGAGM--IVRSIINGGSISRDGRISVGDCILSINNECTANLTNAQARAMLRRHSLLGPDIRSSPAPADDQAPFYVITYVPSEHLEEYRSCLGQPSEVKGTGEIYESNTESFVPELPEREEGEGEESELENATYSNWNNPRRVELWREPGKSLGISIVGGRGMGSRLSNGEVMR--GIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSI---------INRPRGTMNPVRIA---FRCSP--TNPFAPTPFKASSSSDS-----ETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVELPKD-QGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDE 1569          

HSP 5 Score: 63.1586 bits (152), Expect = 2.818e-9
Identity = 106/442 (23.98%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1236 RLSNCSLGLKLT-----GNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPIT------IRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG---SFTNETGI-----------YIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGL-----ATLAKSMSDGNSRRRSSVTNTQSL-DIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA 2456
            +L+  + GL +T     G+K      IF+  I   S  + DGR+QVGD+I+ VD   L G ++  A  V+R  +G+ +   + R    Q +  +P              +Q+  SS     +   S  SD  +   A+  SL Q      + T+E  I    +   G+G+ I+      F+  +G+           +++ +  +GP  + GSL  GD+L+ +N   +   ++  V+ +LK +   V +V  R V+  NS        I               LP   +     +QE+          I  S +++S L      T+  S +D      +S  + QS+ D     L   E D   ++I +++    LG SI+   D        +++  + P G   +DGR+  GDR++ +NEI L + + EE +  L  A
Sbjct:  383 KLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRH-TGQSVHLTLVRRGLKQ-EACIPQVEEPRKPTESGQPLQNADSSEACVPIIPTSFSSDAQSQSPANWSSL-QAEKETQVDTDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQENDGPEGDFPVPLPALWK-----MQED----------IPQSLDTDSKLHIDFGGTVGSSETD--DLNTASTEDGQSIEDAQGSPLAMWETD--IQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGA 802          

HSP 6 Score: 60.4622 bits (145), Expect = 1.968e-8
Identity = 53/229 (23.14%), Postives = 96/229 (41.92%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIP----SISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  +  N +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+ Q      S+VS   +         +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L  GD++I++N Q +   +++  + +LK  K  V L V
Sbjct: 1906 SLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGD--------------------------------VSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2102          

HSP 7 Score: 53.1434 bits (126), Expect = 3.128e-6
Identity = 28/87 (32.18%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            ++ + +N   LGI+I G    ++GD       + V  I    AV +DGRI+VGD+I+V++   L   TN++ + +L   G  +HL +
Sbjct:  381 DVKLTKNAQGLGITIAG----YVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTL 463          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 228.794 bits (582), Expect = 1.642e-60
Identity = 174/543 (32.04%), Postives = 285/543 (52.49%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKS-MSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K+++ +YG+L GEL ++ +   +     LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C  +          +  +    V +++       +++G    +        H V L K+  GLG AI E    N  G+ IK L   G A ++G ++ GD +++++ + V     + V+ LLK  K  V+L +              S      P+ L  P IT                   +SS G       E ++G   L  S  S+    R SS ++T +    +     +    +T  I I +    LG+SI+GG+DT +G +I+H+++  GA +KDGR+  GD+IL +N I L N T++E I +L +   ++ L +  ++    ++D+Y+V+  +E+ KKP KGLG+S++G+    GV++ D+VKGG+A++DGRL  GDQ+L +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1414 KKISQRYGNLPGELHMIELEKGK---TGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPVKATEPSFPNSSAFSNL--EVEEESVPSPVLPLNVGSFKNV-------LH-VELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI--------------SSDEKDMPQLLPLPSITL------------------TSSTG-------EIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCET-TIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1894          

HSP 2 Score: 83.1889 bits (204), Expect = 2.246e-15
Identity = 98/391 (25.06%), Postives = 164/391 (41.94%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI--RHEDTPIPDQDIYEVVSTVE----------------------ITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+L+ +N +DV +A+ + V  LLK     V+L V R++           P H+   +R S             +S  + E  S  +S    +     ++SG              ++S  +  Q L                  + IK+   D+LGISI GG  + +GDV   +  +  NG  A+  +++VGDRI+ I        T+ + +T+L  A   + L++    + + +  Q    + STV                       I ++   GLG S++G  G+      +Y+  V   G A  DGRL  GDQI+ +NG+     T E A + LK   G +   +
Sbjct: 1813 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTG---------PFHSE--RRTS-------------QSSQVSEGTSSLTSFSFPMPGPAAADSG-------------SKKSDTSEIQGL----------------RTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2148          

HSP 3 Score: 80.1073 bits (196), Expect = 1.993e-14
Identity = 97/416 (23.32%), Postives = 167/416 (40.14%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIM-----EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-----------VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            LG  + G K      + +  I+P  +AD +GRL  GD IL++ D  L G S      V+R C GK +K VI R     S   V   ++    + S++ ++      C   + D +                      +   V LTKNAQGLG  I      +GS    +GI++K +       Q+G ++ GD++I ++  ++   +    +E+L++    V L + R           V     P+ S G P+ N        P I           PT     ++S SP     L  E E+ + T  + +           +  Q +  V   +   + ++ +E+         LGIS+    +   G   +  I P G V + G +  GD +L +N I L+ + + +++ +L E
Sbjct:  271 LGFGIVGGKS---TGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQV-----CEGEIKDADG---------------------DAFDVKLTKNAQGLGITIAGYVGDKGS--EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTES-GQPLQNADSSEACVPII-----------PTSFSSDAQSQSPANWSSLQAEKETQVDTDEEDIK----------SKWQRIMGVGYEIVVAKVNKFSES-------SGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKE 621          

HSP 4 Score: 76.2554 bits (186), Expect = 2.674e-13
Identity = 126/572 (22.03%), Postives = 230/572 (40.21%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIR--SCSGKLIKFVIHRSN---EWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLT-KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVA---------RVRCSNSPS----HSVGSPIHNHYPKRLSAPHITAL----PYY---NRPKSPTIQEEKSESSSPGILIKLSPESESGLATL-AKSMSDGNSRRRS-----------SVTNTQSLDIVXXXXXXXEDD-----EKTENIY-----------IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAEL---------------------------------HLKIRHEDTPIPDQDI----YEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            SLG+ ++ +KD   M   +  I+       DGR+ VGD IL +++      ++  A  ++R  S  G  I      S    E++S +  P  ++   EI    +      +        + +  + ++ S    P    +  E    + ++    +G+G  +  G      GI+IKH+    PA + G+L+ GD+++ ++  D+  AS++  +E ++   N V  +V           V CS S S    H   +P  +  PK+ + P + +     P +   N   S  +   K   +   I  + SP +        A S SD  + + S           S  N++ L + +      ED+     +K    Y           +++ +  LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++                                 +L++  E  P P   +    ++ V  VE+ K    GLGI++   +   GV I  +   G A  DGR+K GD IL ++ E
Sbjct: 1049 SLGMTVSASKDGAGM--IVRSIINGGSISRDGRISVGDCILSINNECTANLTNAQARAMLRRHSLLGPDISITYVPSEHLEEYRSCLGQPSEVKGTGEIYESNTESFVPELPEREEGEGEESELENATYSNWNNPRRVELWREPGKSLGISIVGGRGMGSRLSNGEVMR--GIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQHPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVELPKD-QGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDE 1615          

HSP 5 Score: 63.1586 bits (152), Expect = 3.235e-9
Identity = 106/442 (23.98%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1236 RLSNCSLGLKLT-----GNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPIT------IRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG---SFTNETGI-----------YIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGL-----ATLAKSMSDGNSRRRSSVTNTQSL-DIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA 2456
            +L+  + GL +T     G+K      IF+  I   S  + DGR+QVGD+I+ VD   L G ++  A  V+R  +G+ +   + R    Q +  +P              +Q+  SS     +   S  SD  +   A+  SL Q      + T+E  I    +   G+G+ I+      F+  +G+           +++ +  +GP  + GSL  GD+L+ +N   +   ++  V+ +LK +   V +V  R V+  NS        I               LP   +     +QE+          I  S +++S L      T+  S +D      +S  + QS+ D     L   E D   ++I +++    LG SI+   D        +++  + P G   +DGR+  GDR++ +NEI L + + EE +  L  A
Sbjct:  383 KLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRH-TGQSVHLTLVRRGLKQ-EACIPQVEEPRKPTESGQPLQNADSSEACVPIIPTSFSSDAQSQSPANWSSL-QAEKETQVDTDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQENDGPEGDFPVPLPALWK-----MQED----------IPQSLDTDSKLHIDFGGTVGSSETD--DLNTASTEDGQSIEDAQGSPLAMWETD--IQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGA 802          

HSP 6 Score: 60.4622 bits (145), Expect = 2.147e-8
Identity = 53/229 (23.14%), Postives = 96/229 (41.92%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIP----SISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  +  N +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+ Q      S+VS   +         +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L  GD++I++N Q +   +++  + +LK  K  V L V
Sbjct: 1952 SLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGD--------------------------------VSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2148          

HSP 7 Score: 53.1434 bits (126), Expect = 2.980e-6
Identity = 29/92 (31.52%), Postives = 49/92 (53.26%), Query Frame = 3
Query: 2226 DEKTENIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            D    ++ + +N   LGI+I G    ++GD       + V  I    AV +DGRI+VGD+I+V++   L   TN++ + +L   G  +HL +
Sbjct:  376 DGDAFDVKLTKNAQGLGITIAG----YVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTL 463          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 228.794 bits (582), Expect = 1.678e-60
Identity = 179/543 (32.97%), Postives = 283/543 (52.12%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKS-MSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K+++ +YG+L GEL ++ +   +     LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C  +                SA S  N   +  SV    +P          H V L K+  GLG AI E    N  G+ IK L   G A ++G ++ GD +++++ + V     + V+ LLK  K  V+L +              S      P+ L  P IT                   +SS G       E ++G   L  S  S+    R SS ++T +    +     +    +T  I I +    LG+SI+GG+DT +G +I+H+++  GA +KDGR+  GD+IL +N I L N T++E I +L +   ++ L +  ++    ++D+Y+V+  +E+ KKP KGLG+S++G+    GV++ D+VKGG+A++DGRL  GDQ+L +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1372 KKISQRYGNLPGELHMIELEKGK---TGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPVKATEPSFPNS-------SAFS--NLEVEEESVPSPVLPLNVGSFKNVLH-VELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI--------------SSDEKDMPQLLPLPSITL------------------TSSTG-------EIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCET-TIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1852          

HSP 2 Score: 83.1889 bits (204), Expect = 2.162e-15
Identity = 98/391 (25.06%), Postives = 164/391 (41.94%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI--RHEDTPIPDQDIYEVVSTVE----------------------ITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+L+ +N +DV +A+ + V  LLK     V+L V R++           P H+   +R S             +S  + E  S  +S    +     ++SG              ++S  +  Q L                  + IK+   D+LGISI GG  + +GDV   +  +  NG  A+  +++VGDRI+ I        T+ + +T+L  A   + L++    + + +  Q    + STV                       I ++   GLG S++G  G+      +Y+  V   G A  DGRL  GDQI+ +NG+     T E A + LK   G +   +
Sbjct: 1771 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTG---------PFHSE--RRTS-------------QSSQVSEGTSSLTSFSFPMPGPAAADSG-------------SKKSDTSEIQGL----------------RTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2106          

HSP 3 Score: 80.1073 bits (196), Expect = 1.734e-14
Identity = 97/416 (23.32%), Postives = 167/416 (40.14%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIM-----EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-----------VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            LG  + G K      + +  I+P  +AD +GRL  GD IL++ D  L G S      V+R C GK +K VI R     S   V   ++    + S++ ++      C   + D +                      +   V LTKNAQGLG  I      +GS    +GI++K +       Q+G ++ GD++I ++  ++   +    +E+L++    V L + R           V     P+ S G P+ N        P I           PT     ++S SP     L  E E+ + T  + +           +  Q +  V   +   + ++ +E+         LGIS+    +   G   +  I P G V + G +  GD +L +N I L+ + + +++ +L E
Sbjct:  271 LGFGIVGGKS---TGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQV-----CEGEIKDADG---------------------DAFDVKLTKNAQGLGITIAGYVGDKGS--EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTES-GQPLQNADSSEACVPII-----------PTSFSSDAQSQSPANWSSLQAEKETQVDTDEEDIK----------SKWQRIMGVGYEIVVAKVNKFSES-------SGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKE 621          

HSP 4 Score: 64.3142 bits (155), Expect = 1.351e-9
Identity = 120/556 (21.58%), Postives = 220/556 (39.57%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFG----------RSHLNATPVIRSCSGK--------LIKFVIHRS-NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLT-KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPY--YNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDD---------EKTEN-------IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAEL---------------------------------HLKIRHEDTPIPDQDI----YEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            SLG+ ++ +KD   M   +  I+       DGR+ VGD IL +++               R H    P IRS            +I +V      E++S +  P  ++   EI    +      +        + +  + ++ S    P    +  E    + ++    +G+G  +  G      GI+IKH+    PA + G+L+ GD+++ ++  D+  AS++  +E ++   N V  +V  +     P     SP  +   +     H T  P+   +   S +   E  ++SS   L        +G +TL             S  N++ L + +      ED+         ++  N       I +++ +  LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++                                 +L++  E  P P   +    ++ V  VE+ K    GLGI++   +   GV I  +   G A  DGR+K GD IL ++ E
Sbjct: 1049 SLGMTVSASKDGAGM--IVRSIINGGSISRDGRISVGDCILSINNECTANLTNAQARAMLRRHSLLGPDIRSSPAPADDQAPFYVITYVPSEHLEEYRSCLGQPSEVKGTGEIYESNTESFVPELPEREEGEGEESELENATYSNWNNPRRVELWREPGKSLGISIVGGRGMGSRLSNGEVMR--GIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQ-----HPTTNPFSHPSPKASSSSDSETEKTSSSNYL--------TGPSTL-------------SSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVELPKD-QGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDE 1573          

HSP 5 Score: 63.1586 bits (152), Expect = 3.041e-9
Identity = 106/442 (23.98%), Postives = 185/442 (41.86%), Query Frame = 3
Query: 1236 RLSNCSLGLKLT-----GNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPIT------IRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG---SFTNETGI-----------YIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-VRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGL-----ATLAKSMSDGNSRRRSSVTNTQSL-DIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA 2456
            +L+  + GL +T     G+K      IF+  I   S  + DGR+QVGD+I+ VD   L G ++  A  V+R  +G+ +   + R    Q +  +P              +Q+  SS     +   S  SD  +   A+  SL Q      + T+E  I    +   G+G+ I+      F+  +G+           +++ +  +GP  + GSL  GD+L+ +N   +   ++  V+ +LK +   V +V  R V+  NS        I               LP   +     +QE+          I  S +++S L      T+  S +D      +S  + QS+ D     L   E D   ++I +++    LG SI+   D        +++  + P G   +DGR+  GDR++ +NEI L + + EE +  L  A
Sbjct:  383 KLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRH-TGQSVHLTLVRRGLKQ-EACIPQVEEPRKPTESGQPLQNADSSEACVPIIPTSFSSDAQSQSPANWSSL-QAEKETQVDTDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKPPNSSLDEKEQHISEQENDGPEGDFPVPLPALWK-----MQED----------IPQSLDTDSKLHIDFGGTVGSSETD--DLNTASTEDGQSIEDAQGSPLAMWETD--IQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGA 802          

HSP 6 Score: 60.4622 bits (145), Expect = 1.952e-8
Identity = 53/229 (23.14%), Postives = 96/229 (41.92%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIP----SISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  +  N +A    +L+VGD I+ +      G +H  A  ++++ SG +   V+   +                                +S V+ Q      S+VS   +         +   +   + L +   GLGF+I+   GS   +  IY+K +  +G A ++G L  GD++I++N Q +   +++  + +LK  K  V L V
Sbjct: 1910 SLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGD--------------------------------VSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2106          

HSP 7 Score: 53.1434 bits (126), Expect = 3.182e-6
Identity = 28/87 (32.18%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            ++ + +N   LGI+I G    ++GD       + V  I    AV +DGRI+VGD+I+V++   L   TN++ + +L   G  +HL +
Sbjct:  381 DVKLTKNAQGLGITIAG----YVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTL 463          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 238.424 bits (607), Expect = 8.032e-64
Identity = 170/547 (31.08%), Postives = 274/547 (50.09%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRCSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +         LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV   I       +  S + + V  C        ++  AS+  L         S  + + + L K+  GLG AI E    N  G+ I+ L   G A ++G L+PGD +++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    N     + AP +  +P  +R            SS+P +                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   T+E+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED R+ TQE  A  LK  +G +  ++GR++    H
Sbjct: 1337 KNIQERYGSLTGQLHVIELEK---GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPC--------STTSASAADLS--------SLTDVYQLELPKDQGGLGIAICEEDTIN--GVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSR------------SSTPAVF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1811          

HSP 2 Score: 85.1149 bits (209), Expect = 4.822e-16
Identity = 101/401 (25.19%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1665 ETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +T  + L K   +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV  A+ + V  LLK     V L V RV+ +  P HS         P + S    ++L  +  P S     E  ES                           NS++ +  +  Q L                  + IK+   D+LG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                +  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1721 DTFTIELQKRPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAA--PFHS------ERRPSQSSQVSESSLSSFTPPLSGINTSESLES---------------------------NSKKNALASEIQGL----------------RTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2067          

HSP 3 Score: 78.5666 bits (192), Expect = 3.736e-14
Identity = 88/379 (23.22%), Postives = 158/379 (41.69%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSES--------SSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHED---------------------------------TPIPDQDIYEVVSTVEI-TKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD++I ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   ++  Y    + P   +L      ++P+  E ++E         SSP +  ++  +     AT      D       S  N Q                +   I +++ +  LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D                                 T     D+  +    ++   K   GLGI++   +   GV I  + + G A  DGRLKPGD IL ++ E
Sbjct: 1170 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSL-QLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQE--------RYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDE 1537          

HSP 4 Score: 76.6406 bits (187), Expect = 1.615e-13
Identity = 104/449 (23.16%), Postives = 184/449 (40.98%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL-KIRHEDTPIPDQDIYEV-VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +    S +              S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++I+++  ++   +    +E+L++    VRL + R   S                 R        LP  N  K    +E  S   +  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +   R    PI   ++  + ++ +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVD----------ASTQKNDES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQ----------EAELTSRGDTAKDVDLPAENCEKD---EESLSLKRNTSIL----PIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLG 655          

HSP 5 Score: 59.3066 bits (142), Expect = 2.974e-8
Identity = 60/208 (28.85%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ-------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP                 ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    + DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRH-TGQTV 456          

HSP 6 Score: 51.6026 bits (122), Expect = 7.210e-6
Identity = 31/91 (34.07%), Postives = 52/91 (57.14%), Query Frame = 3
Query: 2535 VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
            VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct: 1154 VELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1244          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 238.424 bits (607), Expect = 8.136e-64
Identity = 170/547 (31.08%), Postives = 274/547 (50.09%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRCSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +         LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV   I       +  S + + V  C        ++  AS+  L         S  + + + L K+  GLG AI E    N  G+ I+ L   G A ++G L+PGD +++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    N     + AP +  +P  +R            SS+P +                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   T+E+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED R+ TQE  A  LK  +G +  ++GR++    H
Sbjct: 1323 KNIQERYGSLTGQLHVIELEK---GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPC--------STTSASAADLS--------SLTDVYQLELPKDQGGLGIAICEEDTIN--GVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSR------------SSTPAVF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1797          

HSP 2 Score: 85.1149 bits (209), Expect = 4.616e-16
Identity = 101/401 (25.19%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1665 ETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +T  + L K   +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV  A+ + V  LLK     V L V RV+ +  P HS         P + S    ++L  +  P S     E  ES                           NS++ +  +  Q L                  + IK+   D+LG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                +  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1707 DTFTIELQKRPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAA--PFHS------ERRPSQSSQVSESSLSSFTPPLSGINTSESLES---------------------------NSKKNALASEIQGL----------------RTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 3 Score: 78.5666 bits (192), Expect = 3.959e-14
Identity = 88/379 (23.22%), Postives = 158/379 (41.69%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSES--------SSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHED---------------------------------TPIPDQDIYEVVSTVEI-TKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD++I ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   ++  Y    + P   +L      ++P+  E ++E         SSP +  ++  +     AT      D       S  N Q                +   I +++ +  LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D                                 T     D+  +    ++   K   GLGI++   +   GV I  + + G A  DGRLKPGD IL ++ E
Sbjct: 1156 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSL-QLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQE--------RYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDE 1523          

HSP 4 Score: 76.6406 bits (187), Expect = 1.482e-13
Identity = 104/449 (23.16%), Postives = 185/449 (41.20%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL-KIRHEDTPIPDQDIYEV-VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +    S +              S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++I+++  ++   +    +E+L++    VRL + R           G+        R        LP  N  K    +E  S   +  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +   R    PI   ++  + ++ +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVD----------ASTQKNDES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRK----------GASQEAELTSRGDTAKDVDLPAENCEKD---EESLSLKRNTSIL----PIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLG 655          

HSP 5 Score: 70.4774 bits (171), Expect = 1.322e-11
Identity = 63/237 (26.58%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH----------------EAGAELHLKIRHEDTPIPDQDIYEVVST--------------------------------VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
             + I +   +LG+++    D     VIV  I   GA+++DGRI VGD IL INE   I+ TN +   ML                 E   E  +    +   I   DI+   +                                 VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct:  996 TVTIAKGSSSLGMTVSANKDGL--GVIVRSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTGRDIPELPEREEGEGEESELQNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1230          

HSP 6 Score: 59.3066 bits (142), Expect = 2.848e-8
Identity = 60/208 (28.85%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ-------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP                 ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    + DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRH-TGQTV 456          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 238.424 bits (607), Expect = 8.139e-64
Identity = 170/547 (31.08%), Postives = 274/547 (50.09%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRCSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +         LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV   I       +  S + + V  C        ++  AS+  L         S  + + + L K+  GLG AI E    N  G+ I+ L   G A ++G L+PGD +++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    N     + AP +  +P  +R            SS+P +                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   T+E+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED R+ TQE  A  LK  +G +  ++GR++    H
Sbjct: 1324 KNIQERYGSLTGQLHVIELEK---GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPC--------STTSASAADLS--------SLTDVYQLELPKDQGGLGIAICEEDTIN--GVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSR------------SSTPAVF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1798          

HSP 2 Score: 85.1149 bits (209), Expect = 4.655e-16
Identity = 101/401 (25.19%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1665 ETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +T  + L K   +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV  A+ + V  LLK     V L V RV+ +  P HS         P + S    ++L  +  P S     E  ES                           NS++ +  +  Q L                  + IK+   D+LG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                +  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1708 DTFTIELQKRPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAA--PFHS------ERRPSQSSQVSESSLSSFTPPLSGINTSESLES---------------------------NSKKNALASEIQGL----------------RTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2054          

HSP 3 Score: 78.5666 bits (192), Expect = 3.959e-14
Identity = 88/379 (23.22%), Postives = 158/379 (41.69%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSES--------SSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHED---------------------------------TPIPDQDIYEVVSTVEI-TKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD++I ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   ++  Y    + P   +L      ++P+  E ++E         SSP +  ++  +     AT      D       S  N Q                +   I +++ +  LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D                                 T     D+  +    ++   K   GLGI++   +   GV I  + + G A  DGRLKPGD IL ++ E
Sbjct: 1157 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSL-QLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQE--------RYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDE 1524          

HSP 4 Score: 76.6406 bits (187), Expect = 1.507e-13
Identity = 104/449 (23.16%), Postives = 185/449 (41.20%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL-KIRHEDTPIPDQDIYEV-VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +    S +              S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++I+++  ++   +    +E+L++    VRL + R           G+        R        LP  N  K    +E  S   +  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +   R    PI   ++  + ++ +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVD----------ASTQKNDES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRK----------GASQEAELTSRGDTAKDVDLPAENCEKD---EESLSLKRNTSIL----PIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLG 655          

HSP 5 Score: 70.0922 bits (170), Expect = 1.763e-11
Identity = 63/238 (26.47%), Postives = 99/238 (41.60%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH----------------EAGAELHLKIRHEDTPIPDQDIYEVVST---------------------------------VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
             + I +   +LG+++    D     VIV  I   GA+++DGRI VGD IL INE   I+ TN +   ML                 E   E  +    +   I   DI+   +                                  VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct:  996 TVTIAKGSSSLGMTVSANKDGL--GVIVRSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTGSRDIPELPEREEGEGEESELQNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1231          

HSP 6 Score: 59.3066 bits (142), Expect = 2.872e-8
Identity = 60/208 (28.85%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ-------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP                 ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    + DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRH-TGQTV 456          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 237.654 bits (605), Expect = 1.434e-63
Identity = 170/547 (31.08%), Postives = 274/547 (50.09%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRCSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +         LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV   I       +  S + + V  C        ++  AS+  L         S  + + + L K+  GLG AI E    N  G+ I+ L   G A ++G L+PGD +++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    N     + AP +  +P  +R            SS+P +                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   T+E+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED R+ TQE  A  LK  +G +  ++GR++    H
Sbjct: 1290 KNIQERYGSLTGQLHVIELEK---GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPC--------STTSASAADLS--------SLTDVYQLELPKDQGGLGIAICEEDTIN--GVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSR------------SSTPAVF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1764          

HSP 2 Score: 84.7297 bits (208), Expect = 5.930e-16
Identity = 101/401 (25.19%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1665 ETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +T  + L K   +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV  A+ + V  LLK     V L V RV+ +  P HS         P + S    ++L  +  P S     E  ES                           NS++ +  +  Q L                  + IK+   D+LG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                +  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1674 DTFTIELQKRPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAA--PFHS------ERRPSQSSQVSESSLSSFTPPLSGINTSESLES---------------------------NSKKNALASEIQGL----------------RTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2020          

HSP 3 Score: 76.6406 bits (187), Expect = 1.825e-13
Identity = 104/449 (23.16%), Postives = 185/449 (41.20%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL-KIRHEDTPIPDQDIYEV-VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +    S +              S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++I+++  ++   +    +E+L++    VRL + R           G+        R        LP  N  K    +E  S   +  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +   R    PI   ++  + ++ +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVD----------ASTQKNDES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRK----------GASQEAELTSRGDTAKDVDLPAENCEKD---EESLSLKRNTSIL----PIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLG 655          

HSP 4 Score: 73.9442 bits (180), Expect = 1.116e-12
Identity = 84/377 (22.28%), Postives = 149/377 (39.52%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSES--------SSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHED---------------------------------TPIPDQDIYEVVSTVEI-TKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD++I ++  D+  AS++  +E ++   N V  +V  +                                 NRP++P+  E ++E         SSP +  ++  +     AT      D       S  N Q                +   I +++ +  LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D                                 T     D+  +    ++   K   GLGI++   +   GV I  + + G A  DGRLKPGD IL ++ E
Sbjct: 1156 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI--------------------------------INRPRAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQE--------RYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDE 1490          

HSP 5 Score: 70.0922 bits (170), Expect = 1.758e-11
Identity = 63/237 (26.58%), Postives = 99/237 (41.77%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH----------------EAGAELHLKIRHEDTPIPDQDIYEVVST--------------------------------VEITKKPSKGLGISVIGREGA----------KGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRI 2777
             + I +   +LG+++    D     VIV  I   GA+++DGRI VGD IL INE   I+ TN +   ML                 E   E  +    +   I   DI+   +                                 VE+ ++PSK LGIS++G  G           +G++I  V++   A  +G LKPGD+I+E++G D R+ + E A   ++     +VF +  I
Sbjct:  996 TVTIAKGSSSLGMTVSANKDGL--GVIVRSIIHGGAISRDGRIAVGDCILSINEESTISLTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFRVSFGQQAGGIMALDIFSSYTGRDIPELPEREEGEGEESELQNAAYSSWSQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI 1230          

HSP 6 Score: 58.9214 bits (141), Expect = 3.820e-8
Identity = 60/208 (28.85%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ-------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP                 ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    + DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRH-TGQTV 456          

HSP 7 Score: 51.9878 bits (123), Expect = 5.677e-6
Identity = 58/241 (24.07%), Postives = 102/241 (42.32%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHM--------NIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGK---LIKFVIHRS---NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCL----SAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            SLG+ + G + +            IFI  ++ +S A  +G L+ GD I+EVD   L   SH  A   IR        +++ +I+R    ++ +S+   P          S  S   E   DC     +AVS+  +       S   I       T + H++ L K   GLG ++          ++I  +   G A ++G L+  D+L+ IN Q +   S+     ++K   ++V+++  R
Sbjct: 1149 SLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAPSQSESETEKPALCNVP---PSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQERYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIR 1386          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Patj (PATJ, crumbs cell polarity complex component [Source:MGI Symbol;Acc:MGI:1277960])

HSP 1 Score: 129.028 bits (323), Expect = 1.991e-30
Identity = 74/179 (41.34%), Postives = 118/179 (65.92%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L + ++EE IT L +   ++ L +  ++    D++  EV   V++ KK  +GLG+S++G+    GV+I D+VKGG AD+DGRL  GDQIL +NGED R+ +QE  AT LK + G +  +IGR++
Sbjct:  251 IEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYRDEAQYRDEENLEVF-LVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEIGRLR 428          

HSP 2 Score: 87.0409 bits (214), Expect = 4.880e-17
Identity = 44/111 (39.64%), Postives = 72/111 (64.86%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
            +++  +Y DL GEL ++ +   +     LGL L GNKD + M+IF+  I P   A  DGR+++GDE+LE+++ IL+GRSH NA+ +I++   + +K V  R+ +  S+MAV
Sbjct:    8 EKIRQRYADLPGELHIIELEKDK---NGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPTR-VKLVFIRNEDAVSQMAV 114          

HSP 3 Score: 66.2402 bits (160), Expect = 1.510e-10
Identity = 72/279 (25.81%), Postives = 124/279 (44.44%), Query Frame = 3
Query: 1662 EETHIVYLT----KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            EE   V+L     K  +GLG +I+     + +G++I  +   G A  +G L  GD+++S+N +D+  AS + V  +LK V+  V+L + R+R  +  +    S   N    + SA H +  P +                                A +  S+ +    +RSS    +            E++ +T  I I+   DALGISI GG  + +GD+   +  I  NG  A+  ++KVGDRI+ IN   L   ++ + + +L  A   + L++
Sbjct:  339 EENLEVFLVDLQKKTGRGLGLSIV--GKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEIGRLRAGSWAASRKTS--QNSQGDQHSA-HSSCRPSF--------------------------------APVITSLQNLVGTKRSSDPPQKC----------TEEEPRTVEI-IRELSDALGISIAGGKGSPLGDIPIFIAMIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQV 569          

HSP 4 Score: 53.5286 bits (127), Expect = 1.500e-6
Identity = 31/101 (30.69%), Postives = 53/101 (52.48%), Query Frame = 3
Query: 1617 SVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            SV     P +P     +  I+ ++K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+ S+S++  +  L+    +VRLVV R
Sbjct:  235 SVDPATCPIVPG----QEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYR 331          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|O55164|MPDZ_RAT (Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 8.013e-65
Identity = 176/557 (31.60%), Postives = 278/557 (49.91%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHI-------VY---LTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVR--CSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +      +  LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C                D L + S+   +++            PSI+T  + +       VY   L K+  GLG AI E    N  G+ IK L  +G A ++G L+PGD++++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    +     + AP +  +P  +R            SS+P I                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   TVE+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1322 KNIQERYGTLTGQLHMIELEK---GHSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAV-----CPGS-----------AADPLPSTSESPQNKEVE----------PSITTSASAVDLSSLTNVYHLELPKDQGGLGIAICEEDTLN--GVTIKSLTERGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLTVGAENPGCQAVPSAAVTASGERKDSSQTPAVPAPDLEPIPSTSR------------SSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TVELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAAPFH 1796          

HSP 2 Score: 77.411 bits (189), Expect = 7.451e-13
Identity = 106/445 (23.82%), Postives = 186/445 (41.80%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTEN----------------------IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP-----------DQDIYEVVSTVEITK----------KPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRT 2849
              +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   + V  +V  +  R   SP  S+    H+ YPK       +  P+    +S  +  +K+ S S         ESES  ATL    S        SV +  S D        + +DE  E+                      I +++    LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D              P+P           +  I    S V+++           K   GLGI++   +   GV I  + + G A  DGRLKPGD+IL ++ E       E   + LK+    +   +G      Q    + + A  +  D+++T
Sbjct: 1155 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGSPVVFMVQSIVNRPRKSPLPSL---PHSLYPK---CSFSSTNPFA---ESLQLTSDKAPSQS---------ESESEKATLCSVPS-----SSPSVFSEMSSDYAQPSATTVAEDEDKEDEFGYSWKNIQERYGTLTGQLHMIELEKGHSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGSAADPLPSTSESPQNKEVEPSITTSASAVDLSSLTNVYHLELPKDQGGLGIAICEEDTLNGVTIKSLTERGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLTVGAENPGCQAVPSAAVTASGERKDSSQT 1574          

HSP 3 Score: 74.7146 bits (182), Expect = 4.221e-12
Identity = 103/451 (22.84%), Postives = 181/451 (40.13%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEV----VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +     +               S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++++++  ++   +    +E+L++    VRL + R   S                 R        LP  N  K    +E  S   S  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +        +P   + EV    +  +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPAPSSLGITLSSSTSTSEMRVD-----------ASTQKNEES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQ----------EAEITSREDTAKDVDLPAENYEKD---EESLSLKRSTSIL----PIEEEGYPLLSTELEETEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRT--VPPTALSEVDSLDIHDLELTEKPHIDLG 654          

HSP 4 Score: 65.855 bits (159), Expect = 2.259e-9
Identity = 58/203 (28.57%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2253 KRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K   DALG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                T  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1851 KGPADALGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSTIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2052          

HSP 5 Score: 64.6994 bits (156), Expect = 5.774e-9
Identity = 52/225 (23.11%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG--SFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            +LGL + G     L  + IFI  + PN +A    +L+VGD I+ +      G +H  A  ++++ SG                 ++ + +    ++  V   ++E    CL+          +S++      +   +   ++  + L +   GLGF+I+ G  S   +  IY+K +  +G A ++G L+ GD++I++N Q +   +++  + +LK  K  V L+V
Sbjct: 1856 ALGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASG-----------------SIEVQVVAGGDVSVVTGHQQELANPCLAF-----TGLTSSTI------FPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2052          

HSP 6 Score: 63.1586 bits (152), Expect = 1.426e-8
Identity = 61/207 (29.47%), Postives = 96/207 (46.38%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP P              ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    ++DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPAPSSLGITLSSSTSTSEMRVDASTQKNEESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRH-TGQTV 455          

HSP 7 Score: 57.7658 bits (138), Expect = 5.825e-7
Identity = 30/85 (35.29%), Postives = 48/85 (56.47%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            +++ I + R  D LG SI+GG  +  GD  + V  +F  GA A+DGR+K GD+I+ +N   L   T+EE + +L      + L +
Sbjct: 1968 QSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2052          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|Q8VBX6|MPDZ_MOUSE (Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2)

HSP 1 Score: 238.424 bits (607), Expect = 5.691e-63
Identity = 170/547 (31.08%), Postives = 274/547 (50.09%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRCSNSPSHSV---GSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L G+L ++ +         LGL L GNKD   M++FI  I P   A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV   I       +  S + + V  C        ++  AS+  L         S  + + + L K+  GLG AI E    N  G+ I+ L   G A ++G L+PGD +++++ + V+    +  + LLK  K  V+L V      C   PS +V   G    N     + AP +  +P  +R            SS+P +                              ++  +  I+      +E         I + +  LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++D+ +   T+E+ K+P KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED R+ TQE  A  LK  +G +  ++GR++    H
Sbjct: 1323 KNIQERYGSLTGQLHVIELEK---GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPC--------STTSASAADLS--------SLTDVYQLELPKDQGGLGIAICEEDTIN--GVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTVRAENPACPAVPSSAVTVSGERKDNSQTPAVPAPDLEPIPSTSR------------SSTPAVF----------------------------ASDPATCPIIPGCETTIE---------ISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTF-TIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1797          

HSP 2 Score: 85.1149 bits (209), Expect = 3.229e-15
Identity = 101/401 (25.19%), Postives = 165/401 (41.15%), Query Frame = 3
Query: 1665 ETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRN-EDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA----------GAELHLKIRHE---------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +T  + L K   +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV  A+ + V  LLK     V L V RV+ +  P HS         P + S    ++L  +  P S     E  ES                           NS++ +  +  Q L                  + IK+   D+LG+SI GG  + +GDV   +  + PNG  A+  +++VGDRI+ I        T+ + + ++  A          G ++ +   H+                +  PD        T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1707 DTFTIELQKRPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAA--PFHS------ERRPSQSSQVSESSLSSFTPPLSGINTSESLES---------------------------NSKKNALASEIQGL----------------RTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 3 Score: 78.5666 bits (192), Expect = 2.769e-13
Identity = 88/379 (23.22%), Postives = 158/379 (41.69%), Query Frame = 3
Query: 1692 NAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSES--------SSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHED---------------------------------TPIPDQDIYEVVSTVEI-TKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
              +G+G  +  G      GI+IKH+    PA + G+L+PGD++I ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   ++  Y    + P   +L      ++P+  E ++E         SSP +  ++  +     AT      D       S  N Q                +   I +++ +  LG+S+ G  D     V +  I P GA  +DGR+++ D +L IN   L  ++++   +++  A +++  + IR+ D                                 T     D+  +    ++   K   GLGI++   +   GV I  + + G A  DGRLKPGD IL ++ E
Sbjct: 1156 GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLPHSLYPKYSFSSTNPFADSL-QLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGYSWKNIQE--------RYGSLTGQLHVIELEKGQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAICEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDE 1523          

HSP 4 Score: 76.6406 bits (187), Expect = 1.037e-12
Identity = 104/449 (23.16%), Postives = 185/449 (41.20%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRS--NEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE----TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSS--VTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL-KIRHEDTPIPDQDIYEV-VSTVEITKKPSKGLG 2570
            LG  + G K      + +  I+P  +AD  GRL  GD IL++ D  L G S      V+R C G  +K +I R    E  +  ++ IT+  +    S +              S Q N                     ET  V LTKN QGLG  I  G   ++    +GI++K +        +G ++ GD++I+++  ++   +    +E+L++    VRL + R           G+        R        LP  N  K    +E  S   +  IL    P  E G   L+  + +    ++ +  +T  Q +  +N  +      + +EN         LGIS+    +  +G   +  + P G V   G++  GD +L +N I L+ + +++++ +L E   ++ +   R    PI   ++  + ++ +E+T+KP   LG
Sbjct:  268 LGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC-GNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVD----------ASTQKNDES------------------ETFDVELTKNVQGLGITIA-GYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRK----------GASQEAELTSRGDTAKDVDLPAENCEKD---EESLSLKRNTSIL----PIEEEGFPLLSAELEEAEDVQQEAALLTKWQRIMGINYEIVVAHVSKFSEN-------SGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHIDLG 655          

HSP 5 Score: 59.3066 bits (142), Expect = 1.992e-7
Identity = 60/208 (28.85%), Postives = 94/208 (45.19%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQ-------------DIYEVVST----------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            +  E I +  +   LG  IIGG  T    VIV  I P G   + GR+  GD IL I +  L   ++E++  +L + G  + L I     E+TP                 ++    ST          VE+TK   +GLGI++ G  G K     G+++  + K    + DGR++ GDQI+ ++G + +  T + A   L+   GQ V
Sbjct:  254 QHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKN-VQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRH-TGQTV 456          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|O75970|MPDZ_HUMAN (Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 7.964e-60
Identity = 168/542 (31.00%), Postives = 274/542 (50.55%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            K +  +YG L GEL ++ +      +  LGL L GNKD + M++FI  I PN  A  DGRLQ+ DE+LE++  IL+GRSH NA+ +I+ C+   +K +  R+ +  ++MAV     C               V+ L + S+   +++           +   S +    + L K+  GLG AI E      +G+ IK L   G A  +G L+ GD++++++ + V     +  + LLK  K  V+L +      N  S +V S       ++ ++     +P    P+  +I+   S SS+P I                              ++  +  I+      +E         I +    LG+SI+GGSDT +G +I+H+++  GA  KDGR+  GD+IL +N I L   T++E I +L +    + L +  ++ P  ++++ + + T+E+ KKP KGLG+S++G+    GV++ D+VKGG+AD DGRL  GDQIL +NGED RN TQE  A  LK  +G +  ++GRI+    H
Sbjct: 1335 KNIRERYGTLTGELHMIELEK---GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFIRNKDAVNQMAV-----CPGN-----------AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEEDTL--SGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI---HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRN-TSRSSTPAIF----------------------------ASDPATCPIIPGCETTIE---------ISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTL-TIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1812          

HSP 2 Score: 88.5817 bits (218), Expect = 2.661e-16
Identity = 135/546 (24.73%), Postives = 235/546 (43.04%), Query Frame = 3
Query: 1245 NCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIR--SCSGKLIK-----------FVIHRSNEWQSKMAVPI----TIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV--RCSNSPSHSVGSPIHNHYPK---RLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT-----ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELH-LKIRHEDT-------------PIP----------------------DQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            N SLG+ ++ NKD   + + +  I+       DGR+ +GD IL +++      ++  A  ++R  S  G  IK           F I    +    MA+ I    T R   E+        E      +A S+ N  R+       ++   PS S   + +       +G+G  +  G      GI+IKH+    PA + G+L+PGD+++ ++  D+  AS++  +E ++   N V  +V  +  R   SP  S+   +HN YPK     + P   +L   N  K+P+  E + E +    L  + P   S  A +    +  ++ + S   + +  D       N+ +   T       I +++    LG+S+ G  D     V +  I PNGA  KDGR+++ D +L IN   L  ++++   +++  A +++  + IR++D              P+P                      D   ++ V  +E+ K    GLGI++   +   GV I  + + GVA  DGRLK GDQIL ++ E
Sbjct: 1015 NSSLGMTVSANKD--GLGMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSNWNQPRRV------ELWREPSKSLGISIV-----GGRGMGSRLSNGEVMR--GIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSL---LHNLYPKYNFSSTNPFADSL-QINADKAPSQSESEPEKAP---LCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKE--DEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKD-QGGLGIAISEEDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDE 1535          

HSP 3 Score: 81.2629 bits (199), Expect = 4.535e-14
Identity = 93/391 (23.79%), Postives = 161/391 (41.18%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI----------RHEDTP---------IPDQDIYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  +GLG +I+     N+TG+++  +   G A  +G L  GD+++ +N +DV +A+ + V  LLK     V L V R++           P H+                    + P+   + SE S       LS  +     +      + +S++ +  +  Q L  V +                K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I        T+ + + +L  A   + +++           H+  P         +    I++         ++ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1731 KPGKGLGLSIV--GKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAG---------PFHSE-------------------RRPSQSSQVSEGS-------LSSFTFPLSGSSTSESLESSSKKNALASEIQGLRTVEMK---------------KGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPD-GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|F1MAD2|INADL_RAT (InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 2.319e-38
Identity = 170/594 (28.62%), Postives = 263/594 (44.28%), Query Frame = 3
Query: 1236 RLSNCSLGLKLTGNKDL--------NHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRK-------ASSVSLGQIPY-IPSISTEET----------------------HIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRL--------------SAPHITALPYYNRPKSPTI-----------QEEKSES--------SSPGILIKLSPESE---SGLATLAKSM-----SDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            R  N SLG+ + G + +            IFI Q++ +S A     L+ GD+ILEV    L   SH  A   I+S +G  + FV+      QS  + P  I   +                     DQN   K       A        PY  PS  TEE+                      HI+ L K+  GLG ++      +   I++  +   GPA  +G +R GD+L+ IN+Q +   S+     ++K    +V+LV  R   + +       P+ +H P  +              S+     LP     K   +           QE+ SES          PG   ++S  S+   S  A L +S        GN +   SV +   L +       +   E    I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L + ++EE IT L +   ++ L I  ++    D++  EV   V++ KK  +GLG+S++G+    GV+I D+VKGG AD+DGRL  GDQIL +NGED R  +QE  AT LK + G +  +IGR++
Sbjct: 1081 REPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQNASHAEAVEAIKS-AGNPVVFVV------QSLSSTPRVIPSVNNKGKTPPQN-----------QDQNTQEKKAKRHGTAPPPMKLPPPYRAPSADTEESEEDSALTDKKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPDGPAAADGRMRVGDELLEINNQILYGRSHQNASAIIKTAPTRVKLVFIRNEDAVNQMAVAPFPVPSHSPSPVEDLGGTEPVSSEEDSSVDAKPLPERESSKPEDLTQAVDDSMVAEQEKASESPDSAARQMKQPGYSAQVSSSSQEIPSAPAPLCQSTHADVTGSGNFQAPLSV-DPAPLSVDPATCPIVPGQEMI--IEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVIYRDEAQYRDEENLEVF-LVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDVRQASQETVATILKCVQGLVQLEIGRLR 1652          

HSP 2 Score: 89.3521 bits (220), Expect = 1.542e-16
Identity = 45/111 (40.54%), Postives = 73/111 (65.77%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
            K++  +Y DL GEL ++ +   +     LGL L GNKD + M+IF+  I P+  A  DGR++VGDE+LE+++ IL+GRSH NA+ +I++   + +K V  R+ +  ++MAV
Sbjct: 1232 KKIRQRYADLPGELHIIELEKDK---NGLGLSLAGNKDRSRMSIFVVGINPDGPAAADGRMRVGDELLEINNQILYGRSHQNASAIIKTAPTR-VKLVFIRNEDAVNQMAV 1338          

HSP 3 Score: 56.6102 bits (135), Expect = 1.596e-6
Identity = 67/240 (27.92%), Postives = 113/240 (47.08%), Query Frame = 3
Query: 2133 SMSDGNSRRR-SSVTNTQSLDIVXXXX--------XXXEDDEKTENIYIKR-NEDALGISIIGGSDTFIG--DVIVHDIFPNGAVAKDGRIKVGDRILVINEIQL-INKTNEEIITMLHEAGAELHLKIRHE-------------DTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR 2774
            S+++GN+ R  SS+T ++SL                 +      E I I+R +   LG S++      +G  D+ V ++ P     +D R+K  D+IL IN+  L  N ++++ I +L +A   L L +  E             DT +P+   +     VE+    S GLG  ++G + + GV +  +V GG+AD DGRL+ GD IL+I   + +  T E  A  L++    +   + R
Sbjct:   89 SITNGNAHRPCSSITASESLPWTQRSGNEDFTSVIQQMAQGRHIEYIDIERPSTGGLGFSVVALRSQSLGLIDIFVKEVHPGSVADRDQRLKENDQILAINDTPLDQNISHQQAIALLQQATGSLRLVVAREVGHTQSRTSTSSADTTLPETVRWGHTEDVELINDGS-GLGFGIVGGK-SSGVVVRTIVPGGLADRDGRLQTGDHILKIGSTNVQGMTSEQVAQVLRNCGNSVRMLVAR 326          

HSP 4 Score: 56.225 bits (134), Expect = 1.693e-6
Identity = 51/204 (25.00%), Postives = 93/204 (45.59%), Query Frame = 3
Query: 2235 TENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHE---------DTPIPDQDIYEVVST--------------VEITKKPSKGLGISVIGREG------AKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIV 2759
            TE++ +  +   LG  I+GG  +    V+V  I P G   +DGR++ GD IL I    +   T+E++  +L   G  + + +  +          TP        VV+T              VE+ KK  + LGI ++G  G      A G+Y+  ++ G  A  +G+++  D+I+ ++G + +    +     L++  GQ+V
Sbjct:  246 TEDVELINDGSGLGFGIVGGKSS---GVVVRTIVPGGLADRDGRLQTGDHILKIGSTNVQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPASLPVALPVVATRTLGSDSSPFETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVAVDGVNIQGFANQDVVEVLRN-AGQVV 445          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|Q8NI35|INADL_HUMAN (InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 7.664e-30
Identity = 75/179 (41.90%), Postives = 117/179 (65.36%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            I I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L N ++EE IT L +   ++ L +  ++    D++  E+   V++ KK  +GLG+S++G+    GV+I D+VKGG AD+DGRL  GDQIL +NGED RN +QE  AT LK   G +  +IGR++
Sbjct: 1438 IEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEENLEIFP-VDLQKKAGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLR 1615          

HSP 2 Score: 110.538 bits (275), Expect = 4.463e-23
Identity = 85/300 (28.33%), Postives = 142/300 (47.33%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV--------------------PITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLG--QIPYIPSISTEET----------------------------HIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            +++  +Y DL GEL ++ +   +     LGL L GNKD + M+IF+  I P   A  DGR+++GDE+LE+++ IL+GRSH NA+ +I++   K +K V  R+ +  ++MAV                    PI+      ++  +    ES    L AVS     +  + VS    +IP  P+ S   T                             I+ ++K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+ ++S++  +  L+    +VRLVV R
Sbjct: 1224 QKIRQRYADLPGELHIIELEKDK---NGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSK-VKLVFIRNEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKL-AVSQMKQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGYGGFQAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYR 1518          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: K1R7T1 (Multiple PDZ domain protein OS=Crassostrea gigas OX=29159 GN=CGI_10010649 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.204e-73
Identity = 184/572 (32.17%), Postives = 310/572 (54.20%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV-PITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ-----QLKQHYTPSYLIAKDDNDDNNRTLGKAFS 2867
            K++  +YGDL G+L ++++      + SLG+ L GNKD N M++F+  + P  IA  DGR+QVGDE+LEV+  +L+GRSHLNA+ +I+S S  +IKFV+ R ++    MAV P+ +  A               + ++   DQ+ +   + + + Q+             V L K A GLGFAI+E    N+ GI+I+ +   G A Q+G L  GD+++ +  + ++   Y+  +E+L+N++  ++L V +                N   K+LS  +   L                    PG       +S  G ++   + +D      S+  + ++  I+           +   I I++    LG+SI+GG+DT +G +IVH+++  GA A+DGR+  GD+IL +N   L + T++  I +L +  + + +K+  +D+ + ++DIY++ S VE+TKKP +GLG+S++G+    GVYI D+VKGG A+ DGRL  GDQIL +N ED RN TQE AA  LK+LMG++   +GR++       +++ TP   + K ++  +N++ G   S
Sbjct: 1586 KKIQRQYGDLNGDLHVVDL---NRGHGSLGINLAGNKDRNTMSVFVAGVQPEGIAGKDGRIQVGDELLEVNGQVLYGRSHLNASAIIKSLSTNVIKFVLLRRSDNLEHMAVKPLKMTAA------------VSHEDVTHSEDQDKNGNLTPLDVIQV-------------VTLEKGASGLGFAIVEEVRDNQPGIFIRSITPGGVAAQDGQLSVGDQILEVGDKPLTGVHYEKAIEILRNMQGTIKLKVRK----------------NSSEKKLSFSNTNHL-----------------DPEPGTKSVFQLQSAPGESSTDPNPADEAGEEESA--DPKTCPIIPG---------RETTIEIEKGRTGLGLSIVGGADTLLGAIIVHEVYEEGAAARDGRLWAGDQILEVNYEDLKDATHDYAIQVLRQTPSTVQIKVFRDDSQVKEEDIYDIFS-VELTKKPGRGLGLSIVGKRNDVGVYISDIVKGGTAEADGRLMQGDQILAVNKEDMRNATQEYAAAVLKTLMGKVSLTVGRLKAGSRASSRKNSTPGSALKKSESSVSNKSKGGKHS 2084          

HSP 2 Score: 76.6406 bits (187), Expect = 3.840e-10
Identity = 59/207 (28.50%), Postives = 101/207 (48.79%), Query Frame = 3
Query: 2268 ALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH----------------------------------EDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +LG+SI GG  + IGD  VI+ ++ P G  AK  ++K+GD+IL IN++QL   +++E++ +L + G  + L + H                                  ++T  PD+      +T+ + K P +GLG S++G  G+      +Y+  V   G A  +G LK GDQI+ +NG+     T + A + LK+  G +   +
Sbjct: 2106 SLGLSIAGGIGSSIGDTAVIIANMTPAGPAAKSQKLKIGDQILSINDVQLDGMSHDEVVQLLKKPGT-IKLTVSHGEETRVSVSGHTSRQVSTDMSQEYAELMAQDNVFQETLAPDEGPPPQCNTLHLNKGP-EGLGFSIVGGHGSPHGDLPIYVKSVFSKGAAADEGSLKRGDQIISVNGQSLEGCTHDEAVSILKNTRGAVTMTV 2310          

HSP 3 Score: 68.9366 bits (167), Expect = 8.662e-8
Identity = 54/225 (24.00%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLGL + G     +    + I  + P   A    +L++GD+IL ++D  L G SH     +++      IK  +    E +  ++   + + + ++            +    ++  N  ++  +   G  P        + + ++L K  +GLGF+I+   GS   +  IY+K +  +G A  EGSL+ GD++IS+N Q +   ++D  + +LKN +  V + V
Sbjct: 2106 SLGLSIAGGIGSSIGDTAVIIANMTPAGPAAKSQKLKIGDQILSINDVQLDGMSHDEVVQLLKKPG--TIKLTVSHGEETRVSVSGHTSRQVSTDM----------SQEYAELMAQDNVFQETLAPDEGPPP--------QCNTLHLNKGPEGLGFSIVGGHGSPHGDLPIYVKSVFSKGAAADEGSLKRGDQIISVNGQSLEGCTHDEAVSILKNTRGAVTMTV 2310          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: T1JLQ1 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 2.780e-69
Identity = 193/596 (32.38%), Postives = 299/596 (50.17%), Query Frame = 3
Query: 1167 SKRLANKYGDLGGELILLNI---PNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV-PIT---IRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETG--IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRP-KSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXE----DDEKTENIY--------IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHS 2888
            S ++  KYGDL G +I++++   PN       LGL L G+KD   M+ FI  + P   A  DGR+ VGDEILEV+  +L+GR HLNA+ +I+  +G  IKFV+ R     + +AV P+T   +   DE Q               A ++   SR                  +E   V L K   G G  IMEG   NE G  I+I  +  +G A ++  L  GD ++S+N +D+  A+Y+    LLK  +  +R+ V+       P      P     P   S      LP+  R  K+P+        S   I+  LSP + S L     +++   +    S  N   +  +   +   +    DD    +I         I + +  LG+SI+GGSDT +G +I+H+++P+GA AKDGR++ GD+IL +N   L + T++  I  L +  +++ + +  E++P  ++D  E+   VE+ KKP KGLG+S++GR+   GV++ DVVKGG A+ DGRL  GDQI+ +NG D +N  QE AA  LK+ MG+I  K+GR++ +    T       +   D  +T+      +G G S
Sbjct:   12 SGKIVKKYGDLQGTVIIVDLQKGPN------GLGLSLAGHKDRTKMSTFIVGLNPTGNAFKDGRILVGDEILEVNGQVLYGRCHLNASAIIKGLTGNSIKFVLLRRPNALADLAVKPVTHFPVNVGDEPQ---------------ATTENQLSR-----------------FKEIRTVMLKKGPTGFGVMIMEGKH-NEAGQGIFISDIQ-EGSAAEQAGLTVGDMILSVNDEDLLGANYETAASLLKKAEGTIRVAVSNPNKLQEPIKKDEKPAIPPKPTSFSTKSF--LPHMQRLLKTPSPTNVNLSPSPTSIIGGLSPTTPSTLEVTTITVAPSPTGASPSTANVSPVTPLTPTMKPHKLRSMDDPALCDIVTGCEVTIEIAKEKMGLGLSIVGGSDTLLGAIIIHEVYPDGAAAKDGRLRPGDQILEVNNENLRDSTHDHAIGTLRQTPSKVKMVVFREESPAREEDAVELFE-VELLKKPGKGLGLSIVGRKNGPGVFVSDVVKGGAAEADGRLIQGDQIISVNGHDLKNAMQEQAAAILKTSMGRIHMKVGRLKVVPHRTTNGSTGKPNGTSDGCKTIALDRGVDGLGFS 564          

HSP 2 Score: 62.3882 bits (150), Expect = 5.580e-6
Identity = 56/195 (28.72%), Postives = 90/195 (46.15%), Query Frame = 3
Query: 2250 IKRNEDALGISIIG---GSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSK---------------GLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +K+    LG+SI+G   G   F+ DV+       GA   DGR+  GD+I+ +N   L N   E+   +L  +   +H+K+      +P +      +T   T KP+                GLG S++G  G+      +Y+  V + G A  +G+LK GDQI+ +NG+     T E A T LK+  G +   +
Sbjct:  450 LKKPGKGLGLSIVGRKNGPGVFVSDVV-----KGGAAEADGRLIQGDQIISVNGHDLKNAMQEQAAAILKTSMGRIHMKVGRLKV-VPHR------TTNGSTGKPNGTSDGCKTIALDRGVDGLGFSIVGGYGSPHGDLPIYVKTVFEKGAASENGQLKRGDQIVAVNGQQLEGYTHEKAVTILKNAKGTVTLTV 632          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A131XBC0 (Putative multiple pdz domain protein (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.382e-67
Identity = 193/594 (32.49%), Postives = 299/594 (50.34%), Query Frame = 3
Query: 1170 KRLANKYGDL---GGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV-PITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE-TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPS-HSVGSPIHNHYPKRL------SAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNR---TL-----GKAFSANGHGHSP 2891
            +++  KY +L   GGEL+L+ +   +     LGL L GNK+ + M++F+C + PN  A  DGR++V DE+LEV+  +++GR HLNA+ +I+S  G   KFV+HR  +    MAV P+T                        + +Q +          +I Y    +      V + K   GLG  I+EG       GI++  +    PA Q G L  GD ++ +N  DV+ A YD V +LLK  +  + L+VAR   +  P      + I    P R       S     AL + +    P+         SP +L  + PE      T+A+  +D   ++  S T + + D++           +   I I + +  LG+SI+GGSDT +G VI+H+++P+GA A DGR++ GD+IL +N   L    +E  I  L +  + + +++  E+ P   QDI     TVE+ KK  +GLG+S++GR  A GV+I +VV+GGVA +DGRL  GDQILE+NG      +QE AA  LK+ MG+I  ++GR+++          +++ D+  N R   TL     G  FS  G   SP
Sbjct:    1 EKIERKYQELKLAGGELLLVEL---QKGPSGLGLSLAGNKNRSRMSVFVCGLHPNGQAARDGRIRVADELLEVNGVVMYGRCHLNASAIIKSLPGPTYKFVLHRREDAVEDMAVKPLT-------------------QYPMQLDEQGH----------EIKYA---NYRGVRTVTVKKGTHGLGIMILEGRHPEAGQGIFVSDIQEGSPAHQAG-LGVGDMILDVNGTDVTGADYDTVAQLLKQAEGVLTLIVARPMGNVVPLLKKKAASIETQEPSRTVPSNRKSTVGSLALSHCSSKCRPSPSSPDGRLPSP-LLSPMRPE------TVAEHTADQTPQKPDSGTTSPASDVIRPG--------RPTAIEITKEKLGLGLSIVGGSDTPLGAVIIHEVYPDGAAAMDGRLRPGDQILEVNGEDLREACHEAAIAALRQTSSVVRMQVLREEEP--QQDIL----TVELHKKAGRGLGLSIVGRRNAPGVFISEVVRGGVAQLDGRLCQGDQILEVNGHSLAGASQEEAAALLKTTMGRICLRVGRLRRAPSQRATQVSVSRSDSTANGRMTVTLERGSEGLGFSIVGGAGSP 537          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A210QCE8 (Multiple PDZ domain protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09309 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 4.192e-67
Identity = 176/538 (32.71%), Postives = 287/538 (53.35%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVY-LTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            KR+  +YGDL G L L+++   + S   LG+ L GNKD N M++F+  I P S+A  DGR+ +GDE+LEV+  +L GRSHLNA+ +I+  +  ++K V+ R  +    MAV      A  + S       S     +  +  + S +    +L         S ++   V+ L K + GLGFAI+E +     GIY++ +   G A Q+G L   D+++ ++ + ++   YD  +E+L+N +  VRL V +   +N+ + S       H P++ +   +                    SS+PG                 +S +D  ++  S   +T   D     +       K   I I++    LG+SI+GG+DT +G +I+H+++ +GA A+DGR+  GD++L +N   L   T++  I +L +    + + +  +D  + ++DIY + + VE+ KKP +GLG+S++G+    GVYI D+VKGGVA+ DGRL  GDQIL +NGED RN TQE AAT LK+ MG+I   +GR++
Sbjct: 1358 KRIQRRYGDLTGALHLVDL---KKSGNGLGISLAGNKDRNTMSVFVAGIQPESVAWRDGRIHIGDELLEVNGQVLSGRSHLNASAIIKGLTASVVKIVLVRRQDNLEHMAVKPLKPTAAAVSSEDIRSLPSHSQPATIATTPDPSIETGGANL---------SPQDVFQVFNLQKGSSGLGFAIVEENREGRQGIYVRSITAGGVAAQDGQLSVSDQILEVSDRPLTGVHYDKAIEILRNSQGTVRLKVRKCGENNTQASS------GHSPQQNTVFQVA-------------------SSAPG-----------------ESSTDPVTQSPSQQQDTVPHDPFTCPVIPG----KETTIEIEKGRTGLGLSIVGGADTLLGAIIIHEVYEDGAAARDGRLWAGDQVLDVNGEDLREATHDYAIQVLRQTPPTVKISVFRDDNQVKEEDIYNIFA-VELMKKPGRGLGLSIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILAVNGEDMRNATQEYAATVLKTTMGKINLSVGRLK 1836          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A1S3KGP4 (multiple PDZ domain protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181849 PE=4 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 1.163e-66
Identity = 184/542 (33.95%), Postives = 299/542 (55.17%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV-PITIRCADE----IQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            K+L  KYGDL G L LL I   R SN  LGL L GNKD + M++F+  I  + +A  DGR+++GDE+LEV+  +L+GRSHLNA+ +I+  +  +IK V+ R  ++   +AV P+    + E      +  SS   +  D +S+ ++Q+ S              P ++T     V + K    LG AIMEGS   + GIYIK +    PA  EG L  GD++++++ Q + + SYD  +E L++ +  V+L V++   S+S + S   P+       L    I        P SP  +E+  ++++          S++G                  + + Q+  I       LE         I++ +  LG+SI+GGSDT IG +I+H+++ +GA A+DGR+  GD+IL +    L + T++  I +L +    + + +  +D  + ++D+Y++  T+++ KKP +GLGIS++G+    GVYI D+VKGGVA+ DGRL  GDQIL +N ++ RN TQ+ AAT LK++MG++   IGR++
Sbjct: 1684 KKLQRKYGDLNGVLHLLEIE--RGSN-GLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKGITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFST------------FPDVTT-----VTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSKPGDSSSDTAS-NIPVDEDSQAGLDVRQINV-----EPASPLEREQSQDTTT----------SDTG----------------PEMVDPQTCPIKIGQETWLE---------IEKGKSGLGLSIVGGSDTMIGAIIIHEVYEDGAAARDGRLTAGDQILEVCGQDLRDATHDNAIQVLRQTPPVVTMLVYRDDAQLREEDLYDIF-TIDLLKKPGRGLGISIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILSVNDDNMRNATQDHAATVLKTIMGKVTLTIGRLK 2163          

HSP 2 Score: 74.7146 bits (182), Expect = 1.387e-9
Identity = 66/207 (31.88%), Postives = 102/207 (49.28%), Query Frame = 3
Query: 2241 NIYIKRNED-ALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-RHEDT-----------------PIPDQDIYEVVS------TVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
             + ++R+E  +LGISI GG  + IGD  V++ ++ PNG   K G++KVGD I+ IN       T+ E + +L +    + L + + ED                  P P++D+ + +S      T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI  +NGE     T E A   LK   G+I   +
Sbjct: 2220 TVELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQGTISLVVTQGEDVVLEVNGHSKVYELPSNQPEPEEDMPQEISGQQQVKTISLERGPD-GLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKGKIELTV 2425          

HSP 3 Score: 67.781 bits (164), Expect = 1.913e-7
Identity = 92/419 (21.96%), Postives = 163/419 (38.90%), Query Frame = 3
Query: 1677 VYLTKN-AQGLGFAIMEGSFT--------NETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHY-PKRLSAPH-ITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEI-------------ITMLHEAGAELHLKIRHEDTPIPDQDI----------------------------YEVVSTVEITKKPSK-GLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR 2774
            VYL +   Q LG +I+ G             TGI+IKH+    PA + G L+ GD+++ ++  ++  A++D  +  ++N  + V+ V+  +     PS    S  ++   P R   PH +  L     P    + E      +PG      P   S   +  +        +R        L ++                 I+R  + LG+S+ G  D     V V  I  +G   +DGRI++GD +L +N   L  +++                + +L       H+ ++  D  +  +D+                            +  V+TV I K P++ GL I     EG  G+YI  +  G  A+ +G L  GDQIL ++ +     + + A   L+S  G +   + +
Sbjct: 1516 VYLERQPGQSLGISIVGGKVDLFHVSPEHTITGIFIKHVLEGSPAGKSGQLKTGDRILEVDGVELKDATHDQAVAAIRNANSPVKFVIQSIMDKAPPSDRESSSQNSTVIPDRSPLPHAVRKLHLQQEPHMSPLDESVLTIETPGESTTDQPHDSSDSESDDEFGYTYKKLQRKYGDLNGVLHLLE----------------IERGSNGLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKGITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFSTFPDVTTVTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSK 1918          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 148.288 bits (373), Expect = 1.278e-35
Identity = 147/532 (27.63%), Postives = 249/532 (46.80%), Query Frame = 3
Query: 1251 SLGLKLTGNKDL--------NHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR------------------VRCSNSPSHSVGSPIHNHYPKRLS--APHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIY--------IKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLK 2738
            SLG+ + G + +            IFI Q++P+S A     L+ GD+IL+V    L   +H  A   I++ +  ++  V   S+  + ++      R       +    R   +       + +++ + +    G           E  +V L K+ QGLG ++      +   I++  +   GPA ++G +R GD+L+ IN+Q +   S+     ++K+  ++V+LV+ R                     SN   +    P   H  K  S  A  +TA P  N+ KS  + E +S S +P +     P+S      L  +  D  +   S+  ++ S D           D  T  I         I +    LG+SI+GG DT +  +++H+++  GA A+DGR+  GD+IL +N + L +  +E+ I  L +  A++ L +  ++    D++  +V  TVE+ KK  +GLG+S++G+    GV+I DVVKGG ADVDGRL  GDQIL ++G+D R  +QE  A  LK
Sbjct: 1000 SLGISIVGGRTVIKRLKNGEELKGIFIKQVLPDSPAGRTRALKTGDKILQVSGVDLQNANHEEAVQAIKTATSPVVFTVQSLSSTPRVRITRKAGQRSVPPPMRLPPPYRPPSIMQEEEEQENDDAEQGTGSCRG-----------ELMLVELEKDRQGLGLSLAGNRDRSCMSIFVVGITPGGPASRDGRIRVGDELLEINNQVLYGRSHQNASAIIKSAASKVKLVLLRNEDAINQMAVAPVASQSSFLSSNEVQYHFRIPPDFHSVKEPSTEASPVTAEPLENKEKS--LLEGESASKTPSL-----PKSLRNSGKLPAASVDVPAPIVSAPPSSTSPDF-----EYCSKDPATCPIVPGQETVIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPAKVRLTVLRDEAQYRDEENLDVF-TVELQKKSGRGLGLSIVGKRNGTGVFISDVVKGGAADVDGRLMQGDQILSVDGDDMRQASQETVAAVLK 1507          

HSP 2 Score: 86.6557 bits (213), Expect = 9.695e-17
Identity = 44/104 (42.31%), Postives = 69/104 (66.35%), Query Frame = 3
Query: 1191 GDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAV 1502
            G   GEL+L+ +   R     LGL L GN+D + M+IF+  I P   A  DGR++VGDE+LE+++ +L+GRSH NA+ +I+S + K +K V+ R+ +  ++MAV
Sbjct: 1130 GSCRGELMLVELEKDR---QGLGLSLAGNRDRSCMSIFVVGITPGGPASRDGRIRVGDELLEINNQVLYGRSHQNASAIIKSAASK-VKLVLLRNEDAINQMAV 1229          

HSP 3 Score: 68.1662 bits (165), Expect = 5.245e-11
Identity = 63/193 (32.64%), Postives = 89/193 (46.11%), Query Frame = 3
Query: 2289 GGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVE--------------------------IT-KKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            GG  + +GD+   +  I  NG  A+  R+KVGDRI+ IN   L   T+ E++ ML  A   + L++      I D +I  + S VE                          IT +K ++GLG S++G  G+      +Y+  V   G A VDGRLK GDQIL +NGE     T E A   LK   G +   +
Sbjct: 1550 GGKGSPLGDIPIFIAMIQANGVAARTHRLKVGDRIVSINAQSLDGLTHGEVVNMLKNAYGSIILQV------IADTNISAIASQVESMSSSSALSTNTETQTTEPETPKPKSITLEKGTEGLGFSIVGGFGSPHGDLPIYVKTVFSKGAAAVDGRLKRGDQILSVNGESLEGATHEQAVAILKKQRGVVTLSV 1736          

HSP 4 Score: 55.8398 bits (133), Expect = 2.977e-7
Identity = 53/213 (24.88%), Postives = 94/213 (44.13%), Query Frame = 3
Query: 1284 LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            L  + IFI  I  N +A    RL+VGD I+ ++   L G +H     ++++  G +I  VI  +N              A   Q    S   ++       + +  + K  S++L                    K  +GLGF+I+ G F +  G   IY+K +  +G A  +G L+ GD+++S+N + +  A+++  + +LK  +  V L V
Sbjct: 1556 LGDIPIFIAMIQANGVAARTHRLKVGDRIVSINAQSLDGLTHGEVVNMLKNAYGSIILQVIADTN------------ISAIASQVESMSSSSALSTNTETQTTEPETPKPKSITL-------------------EKGTEGLGFSIV-GGFGSPHGDLPIYVKTVFSKGAAAVDGRLKRGDQILSVNGESLEGATHEQAVAILKKQRGVVTLSV 1736          

HSP 5 Score: 55.0694 bits (131), Expect = 4.430e-7
Identity = 53/199 (26.63%), Postives = 87/199 (43.72%), Query Frame = 3
Query: 2238 ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHE------------------------DTPIPDQ--------DIYEVVSTVEITKKPSKGLGISVIGR-----EGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRN-ETQEI 2720
            E I +  +   LG  I+GG  T    V+V  + PN    KDGR++ GD IL I +      T+E+++ +L   G  + + I  +                          PIP +        + YE +  V + KK  + LGIS++ R     E   G+++  VV G  A+  G +   D+I+ +NG + +   TQE+
Sbjct:  240 EEIELINDGSGLGFGIVGGKAT---GVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQACGTRVRMLIARDPLVEAQAPPLPPPAPAAAPVTSLPPPPIPARRTSRTANLEGYE-IHEVNLKKKEGQSLGISIVARNTSTSEDGMGIFVKSVVPGSAAEQSGNIMVNDRIIAMNGVNLQGFTTQEV 434          

HSP 6 Score: 53.9138 bits (128), Expect = 9.723e-7
Identity = 28/74 (37.84%), Postives = 45/74 (60.81%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITML 2447
            K ++I +++  + LG SI+GG  +  GD  + V  +F  GA A DGR+K GD+IL +N   L   T+E+ + +L
Sbjct: 1652 KPKSITLEKGTEGLGFSIVGGFGSPHGDLPIYVKTVFSKGAAAVDGRLKRGDQILSVNGESLEGATHEQAVAIL 1725          

HSP 7 Score: 53.1434 bits (126), Expect = 2.063e-6
Identity = 56/193 (29.02%), Postives = 89/193 (46.11%), Query Frame = 3
Query: 2232 KTENIYIKRN-EDALGISIIGGSDTFIG--DVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINK-TNEEIITMLHEAGAELHLKIRHEDTPIPD--------QDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR 2774
            K EN+ + R     LG S++G     +G   V +  + P G  A+DGR++  D+IL IN I L    T ++ I  L +    + L +  +    P+         + +  V  +E+    S GLG  ++G + A GV +  +V   VAD DGRL+ GD IL I     +  T E     L++   ++   I R
Sbjct:  129 KIENVSLLRPLSGGLGFSVVGLRPDGVGAHGVFIKQVQPGGVAARDGRLQENDQILAINGIPLDQSVTQQQAIAFLQQQRDRVELVVARDTASKPNFPPSGSIQSEQWGHVEEIELINDGS-GLGFGIVGGK-ATGVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQACGTRVRMLIAR 319          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000041966.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12875129:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000041966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 3.119e-31
Identity = 75/185 (40.54%), Postives = 118/185 (63.78%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
             I I +    LG+SI+GG DT +G +I+H+++  GA AKDGR+  GD+IL +N I L   T++E I +L +    + L +  ++    +++++++ + VE+ KKP + LG+S++GR    GV++ D+VKGGV + DGRL  GDQIL +NGED R+ TQE  A  LK  +G I  ++GR +    H
Sbjct: 1548 TIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFN-VELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFH 1731          

HSP 2 Score: 115.931 bits (289), Expect = 1.095e-25
Identity = 79/250 (31.60%), Postives = 136/250 (54.40%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            K++  +YG L G L ++ +   R     LGL L GN+D + M++F+  I P+  A  DGR+ VGDE+LE++  IL+GRSH NA+ +I+S   K +K +  R+ +  S+MAV       D I +                  Q      SS++L  +P +  +S    HI+ L     G+G  + E +  N  G+ ++ +  +GPA++EGS++PGD+L++++ + +   S + V+ LL + K+ V+L + R
Sbjct: 1259 KKVVERYGSLPGVLHMIELEKGR---SGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSK-VKIIFIRNTDALSQMAVGPMKEFGDTIDT------------------QTEPETCSSLNL-PLPDL-DMSKCVQHII-LPVEESGVGLHLAEDN--NGNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1480          

HSP 3 Score: 88.1965 bits (217), Expect = 3.977e-17
Identity = 103/382 (26.96%), Postives = 167/382 (43.72%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDT----PIPDQDIYEVVSTV---EITKKPSK---------GLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  Q LG +I+     N+TG+++  +   G    +G L  GD+++S+N +DV SA+ + V  LLK     +++ + R +           P H+   +R+S                    + SES +     K++ +S SG  +L     D   RR     + +SL          E D +T  +  K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I         + + +++L      + L++   DT    P PDQ      S++   ++     K         GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G I   +
Sbjct: 1650 KPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAG---------PFHSE--RRMSQ-----------------ASQLSESGN----CKITQQSFSGSGSL---QGDFEIRR-----SHESL----------EQDIRTVEL-CKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1978          

HSP 4 Score: 64.3142 bits (155), Expect = 8.237e-10
Identity = 59/213 (27.70%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQDIYEVVST--------------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTP 2804
            + E I +  +   LG  I+GG  T    VIV  I P G   +DGR+K GD IL I E  L    ++++  +L + G  + L I     +DT      +  V                 V +TK  ++GLGI++ G  G K     G+++  +  G   + DGR+  GDQI+ ++G D +  T + A   L+     +  K+ R   + +   P
Sbjct:  221 QVETIELVNDGSGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATVDDTSTLPSTLPTVTEQQGHEEEEEEHGAFDVSLTKN-AQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPP 429          

HSP 5 Score: 63.5438 bits (153), Expect = 1.126e-9
Identity = 55/225 (24.44%), Postives = 101/225 (44.89%), Query Frame = 3
Query: 1254 LGLKLTG--NKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGR-SHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LG  + G  N++   + IF+ +I   S+A  DG+L+ GD+IL ++   L    +H  A  +++  S + ++ ++ R    Q  ++ P+  R                    SA S  +    A+  +             +   + L  +  GLGF I+ G     TG+ +K +   G A Q+G L+ GD ++ I   D+     D V ++L+   N+V+LV++R
Sbjct:  115 LGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRAS-EHVQIIVARGPVPQ--LSSPVVSRTP------------------SAASTLSAHSSATHCT-------------QVETIELVNDGSGLGFGIVGG---KTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 6 Score: 56.6102 bits (135), Expect = 1.503e-7
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH-----EDTPIPDQDIYEVVSTVEITKKP 2555
            ++ + +N   LGI+I G    +IGD       + V  I    AV +DGRI VGD+I+ ++ + +   TN++ + +L   G  +HLK+       E+TP P      VV  V  TK P
Sbjct:  335 DVSLTKNAQGLGITIAG----YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPP------VVCVVTETKPP 441          

HSP 7 Score: 56.225 bits (134), Expect = 2.107e-7
Identity = 50/226 (22.12%), Postives = 94/226 (41.59%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ +G                  V + +   D                     DQ      SS+      +   +   +   + L +   GLGF+I+ G F +  G   IY+K +  +G A ++G L+ GD+++++N Q +   +++  + +LK  K  + L V
Sbjct: 1790 SLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTG-----------------TVQLQVVAGD-------------TTVTGPPPDQTPGLTTSSI------FHDDLGPPQCKTISLERGLDGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1978          

HSP 8 Score: 54.299 bits (129), Expect = 7.545e-7
Identity = 62/274 (22.63%), Postives = 108/274 (39.42%), Query Frame = 3
Query: 1677 VYLTKNAQGLGFAIME--GSFTNE-TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNE------------DALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            V LTKNAQGLG  I    G   +E +GI++K +       Q+G +  GD++I+++  D+   +    +E+L++    V L + R                   P+    P +  +      K P +  + +        + +    E  L       S   +      T  Q   I   +    E  EK +N     NE              LGIS+    +   G   +  + P G V + G++  GD +L +N I L  +T++E++++L E
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR---------------RGFMPEETPPPVVCVV---TETKPPILSLDSTLER-----VAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKE 582          

HSP 9 Score: 53.5286 bits (127), Expect = 1.422e-6
Identity = 67/248 (27.02%), Postives = 113/248 (45.56%), Query Frame = 3
Query: 1218 LNIPNPRL--SNC-----------SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPY-IPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LN+P P L  S C            +GL L  +   N+ N  I Q +    A  +G +Q GD ++ VDD +L G S      ++ S     +K  I R++      A   T R  +   + +S+     V      + +++SR ++  +L   P   P I   ET I  ++K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+  A++D  + +L+    +VRL + R
Sbjct: 1387 LNLPLPDLDMSKCVQHIILPVEESGVGLHLAED---NNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSS-VKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPIIPGCETTI-DISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFR 1629          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000037958.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000037958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 3.181e-31
Identity = 75/185 (40.54%), Postives = 118/185 (63.78%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
             I I +    LG+SI+GG DT +G +I+H+++  GA AKDGR+  GD+IL +N I L   T++E I +L +    + L +  ++    +++++++ + VE+ KKP + LG+S++GR    GV++ D+VKGGV + DGRL  GDQIL +NGED R+ TQE  A  LK  +G I  ++GR +    H
Sbjct: 1562 TIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFN-VELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFH 1745          

HSP 2 Score: 116.316 bits (290), Expect = 1.079e-25
Identity = 79/250 (31.60%), Postives = 136/250 (54.40%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            K++  +YG L G L ++ +   R     LGL L GN+D + M++F+  I P+  A  DGR+ VGDE+LE++  IL+GRSH NA+ +I+S   K +K +  R+ +  S+MAV       D I +                  Q      SS++L  +P +  +S    HI+ L     G+G  + E +  N  G+ ++ +  +GPA++EGS++PGD+L++++ + +   S + V+ LL + K+ V+L + R
Sbjct: 1273 KKVVERYGSLPGVLHMIELEKGR---SGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSK-VKIIFIRNTDALSQMAVGPMKEFGDTIDT------------------QTEPETCSSLNL-PLPDL-DMSKCVQHII-LPVEESGVGLHLAEDN--NGNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1494          

HSP 3 Score: 88.1965 bits (217), Expect = 4.156e-17
Identity = 103/382 (26.96%), Postives = 167/382 (43.72%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDT----PIPDQDIYEVVSTV---EITKKPSK---------GLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  Q LG +I+     N+TG+++  +   G    +G L  GD+++S+N +DV SA+ + V  LLK     +++ + R +           P H+   +R+S                    + SES +     K++ +S SG  +L     D   RR     + +SL          E D +T  +  K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I         + + +++L      + L++   DT    P PDQ      S++   ++     K         GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G I   +
Sbjct: 1664 KPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAG---------PFHSE--RRMSQ-----------------ASQLSESGN----CKITQQSFSGSGSL---QGDFEIRR-----SHESL----------EQDIRTVEL-CKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1992          

HSP 4 Score: 64.3142 bits (155), Expect = 8.177e-10
Identity = 59/213 (27.70%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQDIYEVVST--------------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTP 2804
            + E I +  +   LG  I+GG  T    VIV  I P G   +DGR+K GD IL I E  L    ++++  +L + G  + L I     +DT      +  V                 V +TK  ++GLGI++ G  G K     G+++  +  G   + DGR+  GDQI+ ++G D +  T + A   L+     +  K+ R   + +   P
Sbjct:  221 QVETIELVNDGSGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATVDDTSTLPSTLPTVTEQQGHEEEEEEHGAFDVSLTKN-AQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPP 429          

HSP 5 Score: 63.5438 bits (153), Expect = 1.176e-9
Identity = 55/225 (24.44%), Postives = 101/225 (44.89%), Query Frame = 3
Query: 1254 LGLKLTG--NKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGR-SHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LG  + G  N++   + IF+ +I   S+A  DG+L+ GD+IL ++   L    +H  A  +++  S + ++ ++ R    Q  ++ P+  R                    SA S  +    A+  +             +   + L  +  GLGF I+ G     TG+ +K +   G A Q+G L+ GD ++ I   D+     D V ++L+   N+V+LV++R
Sbjct:  115 LGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRAS-EHVQIIVARGPVPQ--LSSPVVSRTP------------------SAASTLSAHSSATHCT-------------QVETIELVNDGSGLGFGIVGG---KTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 6 Score: 56.6102 bits (135), Expect = 1.569e-7
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH-----EDTPIPDQDIYEVVSTVEITKKP 2555
            ++ + +N   LGI+I G    +IGD       + V  I    AV +DGRI VGD+I+ ++ + +   TN++ + +L   G  +HLK+       E+TP P      VV  V  TK P
Sbjct:  335 DVSLTKNAQGLGITIAG----YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPP------VVCVVTETKPP 441          

HSP 7 Score: 56.225 bits (134), Expect = 2.181e-7
Identity = 50/226 (22.12%), Postives = 94/226 (41.59%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ +G                  V + +   D                     DQ      SS+      +   +   +   + L +   GLGF+I+ G F +  G   IY+K +  +G A ++G L+ GD+++++N Q +   +++  + +LK  K  + L V
Sbjct: 1804 SLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTG-----------------TVQLQVVAGD-------------TTVTGPPPDQTPGLTTSSI------FHDDLGPPQCKTISLERGLDGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1992          

HSP 8 Score: 54.299 bits (129), Expect = 7.552e-7
Identity = 62/274 (22.63%), Postives = 108/274 (39.42%), Query Frame = 3
Query: 1677 VYLTKNAQGLGFAIME--GSFTNE-TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNE------------DALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            V LTKNAQGLG  I    G   +E +GI++K +       Q+G +  GD++I+++  D+   +    +E+L++    V L + R                   P+    P +  +      K P +  + +        + +    E  L       S   +      T  Q   I   +    E  EK +N     NE              LGIS+    +   G   +  + P G V + G++  GD +L +N I L  +T++E++++L E
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR---------------RGFMPEETPPPVVCVV---TETKPPILSLDSTLER-----VAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKE 582          

HSP 9 Score: 53.5286 bits (127), Expect = 1.484e-6
Identity = 67/248 (27.02%), Postives = 113/248 (45.56%), Query Frame = 3
Query: 1218 LNIPNPRL--SNC-----------SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPY-IPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LN+P P L  S C            +GL L  +   N+ N  I Q +    A  +G +Q GD ++ VDD +L G S      ++ S     +K  I R++      A   T R  +   + +S+     V      + +++SR ++  +L   P   P I   ET I  ++K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+  A++D  + +L+    +VRL + R
Sbjct: 1401 LNLPLPDLDMSKCVQHIILPVEESGVGLHLAED---NNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSS-VKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPIIPGCETTI-DISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFR 1643          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000021866.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000021866.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 3.836e-31
Identity = 75/185 (40.54%), Postives = 118/185 (63.78%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
             I I +    LG+SI+GG DT +G +I+H+++  GA AKDGR+  GD+IL +N I L   T++E I +L +    + L +  ++    +++++++ + VE+ KKP + LG+S++GR    GV++ D+VKGGV + DGRL  GDQIL +NGED R+ TQE  A  LK  +G I  ++GR +    H
Sbjct: 1445 TIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFN-VELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFH 1628          

HSP 2 Score: 115.931 bits (289), Expect = 1.140e-25
Identity = 79/250 (31.60%), Postives = 136/250 (54.40%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            K++  +YG L G L ++ +   R     LGL L GN+D + M++F+  I P+  A  DGR+ VGDE+LE++  IL+GRSH NA+ +I+S   K +K +  R+ +  S+MAV       D I +                  Q      SS++L  +P +  +S    HI+ L     G+G  + E +  N  G+ ++ +  +GPA++EGS++PGD+L++++ + +   S + V+ LL + K+ V+L + R
Sbjct: 1156 KKVVERYGSLPGVLHMIELEKGR---SGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSK-VKIIFIRNTDALSQMAVGPMKEFGDTIDT------------------QTEPETCSSLNL-PLPDL-DMSKCVQHII-LPVEESGVGLHLAEDN--NGNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1377          

HSP 3 Score: 88.1965 bits (217), Expect = 4.238e-17
Identity = 103/382 (26.96%), Postives = 167/382 (43.72%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDT----PIPDQDIYEVVSTV---EITKKPSK---------GLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  Q LG +I+     N+TG+++  +   G    +G L  GD+++S+N +DV SA+ + V  LLK     +++ + R +           P H+   +R+S                    + SES +     K++ +S SG  +L     D   RR     + +SL          E D +T  +  K   D+LGISI GG  + +GDV   +  + P G  A+  +++VGDRI+ I         + + +++L      + L++   DT    P PDQ      S++   ++     K         GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G I   +
Sbjct: 1547 KPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAG---------PFHSE--RRMSQ-----------------ASQLSESGN----CKITQQSFSGSGSL---QGDFEIRR-----SHESL----------EQDIRTVEL-CKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1875          

HSP 4 Score: 63.929 bits (154), Expect = 9.196e-10
Identity = 59/213 (27.70%), Postives = 95/213 (44.60%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTPIPDQDIYEVVST--------------VEITKKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTP 2804
            + E I +  +   LG  I+GG  T    VIV  I P G   +DGR+K GD IL I E  L    ++++  +L + G  + L I     +DT      +  V                 V +TK  ++GLGI++ G  G K     G+++  +  G   + DGR+  GDQI+ ++G D +  T + A   L+     +  K+ R   + +   P
Sbjct:  221 QVETIELVNDGSGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATVDDTSTLPSTLPTVTEQQGHEEEEEEHGAFDVSLTKN-AQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPP 429          

HSP 5 Score: 63.929 bits (154), Expect = 1.098e-9
Identity = 55/225 (24.44%), Postives = 101/225 (44.89%), Query Frame = 3
Query: 1254 LGLKLTG--NKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGR-SHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LG  + G  N++   + IF+ +I   S+A  DG+L+ GD+IL ++   L    +H  A  +++  S + ++ ++ R    Q  ++ P+  R                    SA S  +    A+  +             +   + L  +  GLGF I+ G     TG+ +K +   G A Q+G L+ GD ++ I   D+     D V ++L+   N+V+LV++R
Sbjct:  115 LGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRAS-EHVQIIVARGPVPQ--LSSPVVSRTP------------------SAASTLSAHSSATHCT-------------QVETIELVNDGSGLGFGIVGG---KTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 6 Score: 56.6102 bits (135), Expect = 1.665e-7
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGD-------VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH-----EDTPIPDQDIYEVVSTVEITKKP 2555
            ++ + +N   LGI+I G    +IGD       + V  I    AV +DGRI VGD+I+ ++ + +   TN++ + +L   G  +HLK+       E+TP P      VV  V  TK P
Sbjct:  335 DVSLTKNAQGLGITIAG----YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPP------VVCVVTETKPP 441          

HSP 7 Score: 56.225 bits (134), Expect = 2.057e-7
Identity = 50/226 (22.12%), Postives = 94/226 (41.59%), Query Frame = 3
Query: 1251 SLGLKLTGN--KDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETG---IYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            SLG+ + G     L  + IFI  + P  +A    +L+VGD I+ +      G +H  A  ++++ +G                  V + +   D                     DQ      SS+      +   +   +   + L +   GLGF+I+ G F +  G   IY+K +  +G A ++G L+ GD+++++N Q +   +++  + +LK  K  + L V
Sbjct: 1687 SLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTG-----------------TVQLQVVAGD-------------TTVTGPPPDQTPGLTTSSI------FHDDLGPPQCKTISLERGLDGLGFSIV-GGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1875          

HSP 8 Score: 54.6842 bits (130), Expect = 7.185e-7
Identity = 62/274 (22.63%), Postives = 108/274 (39.42%), Query Frame = 3
Query: 1677 VYLTKNAQGLGFAIME--GSFTNE-TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNE------------DALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHE 2453
            V LTKNAQGLG  I    G   +E +GI++K +       Q+G +  GD++I+++  D+   +    +E+L++    V L + R                   P+    P +  +      K P +  + +        + +    E  L       S   +      T  Q   I   +    E  EK +N     NE              LGIS+    +   G   +  + P G V + G++  GD +L +N I L  +T++E++++L E
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR---------------RGFMPEETPPPVVCVV---TETKPPILSLDSTLER-----VAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLSIEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKE 582          

HSP 9 Score: 53.5286 bits (127), Expect = 1.604e-6
Identity = 67/248 (27.02%), Postives = 113/248 (45.56%), Query Frame = 3
Query: 1218 LNIPNPRL--SNC-----------SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPY-IPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            LN+P P L  S C            +GL L  +   N+ N  I Q +    A  +G +Q GD ++ VDD +L G S      ++ S     +K  I R++      A   T R  +   + +S+     V      + +++SR ++  +L   P   P I   ET I  ++K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+  A++D  + +L+    +VRL + R
Sbjct: 1284 LNLPLPDLDMSKCVQHIILPVEESGVGLHLAED---NNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSS-VKLTICRADSTPVLNASNQTCRDLEPETTSLSNMLLFSVTPPETETIRSSSRSSTPATLVSDPVTCPIIPGCETTI-DISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFR 1526          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000052301.1 (discs large homolog 1-like protein [Source:NCBI gene;Acc:103032064])

HSP 1 Score: 91.6633 bits (226), Expect = 2.064e-18
Identity = 81/259 (31.27%), Postives = 132/259 (50.97%), Query Frame = 3
Query: 2034 SPTIQEEKSESSSPGIL--IKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDT-FIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK------GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGR 2774
            SP  Q + +  S+P I+  I +SP   +  A +    S  N      V NT+SLD    +    E D + E I ++R    LG SI GG+D   IG+   + +  + P GA A+DGR++V D IL +NE+ + + T+ + +  L EAG+ + L +R        + + E V  +++ K P KGLG S+ G  G +       +Y+  +++GG A  DGRL+ GD+++ +N       T E A T LK+    +  K+ +
Sbjct:  149 SPMKQTDAAPPSAPTIIPVIPISP-VPAETAVIPPPTSQANPP--PVVVNTESLDSAPYVNGT-EADYEYEEITLERGNSGLGFSIAGGTDNPHIGEDPSIFITKVIPGGAAAQDGRLQVNDVILRVNEVDVRDVTHSKAVEALKEAGSLVRLYVRRR------KSVSEKVVEIKLVKGP-KGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLMAVNSACLEEVTHEHAVTALKNTTDVVYLKVAK 396          

HSP 2 Score: 72.7886 bits (177), Expect = 1.358e-12
Identity = 87/413 (21.07%), Postives = 151/413 (36.56%), Query Frame = 3
Query: 1245 NCSLGLKLTGNKDLNHM----NIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEG----SFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAG 2459
            N  LG  + G  D  H+    +IFI +++P   A  DGRLQV D IL V++  +   +H  A   ++  +G L++  +                                              R+  SVS            E+   + L K  +GLGF+I  G        +  IY+  +   G A ++G L+ GDKL+++N   +   +++  +  LKN  + V L VA+              I N Y + +   HI+   + ++P  P          +P      +P+   G   L++                                 +   + + R    LG +I+GG D     + +  I   G     G ++ GDR++ +N + L + T+E+    L  AG
Sbjct:  223 NSGLGFSIAGGTDNPHIGEDPSIFITKVIPGGAAAQDGRLQVNDVILRVNEVDVRDVTHSKAVEALKE-AGSLVRLYV----------------------------------------------RRRKSVS------------EKVVEIKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLMAVNSACLEEVTHEHAVTALKNTTDVVYLKVAKPNSVFMNDSFAPPDITNSYSQHMEN-HISPPNFLSQPLPP----------APSGRFSPTPKPSHGEEDLSR---------------------------------EPRKVVLHRGATGLGFNIVGGEDG--EGIFISFILAGGPADLSGELRKGDRLVSVNGVDLRSATHEQAAAALKNAG 530          

HSP 3 Score: 65.855 bits (159), Expect = 2.287e-10
Identity = 59/231 (25.54%), Postives = 100/231 (43.29%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHM----NIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNN-SRKASSVSLGQIPYIPSIS------TEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV 1913
            LG  + G     H+    +I++ +I+    A  DGRLQ+GD+++ V+   L   +H +A   +++ +  +   V   ++ + +    P  I                     + +S  N  S+       G+    P  S      + E   V L + A GLGF I+ G   +  GI+I  +   GPA   G LR GD+L+S+N  D+ SA+++     LKN    V +V 
Sbjct:  321 LGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLMAVNSACLEEVTHEHAVTALKNTTDVVYLKVAKPNSVFMNDSFAPPDI------------TNSYSQHMENHISPPNFLSQPLPPAPSGRFSPTPKPSHGEEDLSREPRKVVLHRGATGLGFNIVGGE--DGEGIFISFILAGGPADLSGELRKGDRLVSVNGVDLRSATHEQAAAALKNAGQTVTIVA 537          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 3.337e-24
Identity = 62/158 (39.24%), Postives = 98/158 (62.03%), Query Frame = 3
Query: 2310 GDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-RHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            G +++H+++  GA AKDGR+  GD+IL +N   L + T+E+ I  L  +   + L + R E     D +    V TVE+ KK  +GLG+S++G++   GV++ +VV GG A+ DGRL  GDQIL ++GED R+ +QE  A  LK   G +  ++GR++
Sbjct:    2 GAIMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRASPQLVRLYVYRDEARYRGDDESALHVFTVELLKKAGRGLGLSIVGKKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRMK 159          

HSP 2 Score: 49.2914 bits (116), Expect = 6.534e-7
Identity = 50/209 (23.92%), Postives = 89/209 (42.58%), Query Frame = 3
Query: 1299 IFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVR 1925
            I I ++     A  DGRL  GD+IL+V+   L   +H +A   +R+ S +L++  ++R                 DE +                  D  ++    +V L                  L K  +GLG +I+     N  G+++  +   G A  +G L  GD+++S++ +DV SAS + V  +LK  +  V++ V R++
Sbjct:    4 IMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRA-SPQLVRLYVYR-----------------DEARYR---------------GDDESALHVFTVEL------------------LKKAGRGLGLSIVGKKSGN--GVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRMK 159          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 2.873e-12
Identity = 74/285 (25.96%), Postives = 113/285 (39.65%), Query Frame = 3
Query: 1638 PYIPSISTEETHIVYLTKNAQGLGFAIM--EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVK--NQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKS-----ESSSPGILIKLS-PESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGA 2462
            P +P   +     V L K  +GLGF++   +   +    +YIKH+  +G AI +G L  GD+LI +N  DVSS S D V+ +L+ V   + V L+V+R     +P       +   +P +                    Q E+S      +S P   + L    SE G A L  S+    SR                      D      IY+K        SII G                GA AKDGR+++GD+++ +N   L+ ++N   +  L    A
Sbjct:  375 PVVPRRHSGRRFRVQLQKGPEGLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHDALLTPPAQEARLVKQMHPDQ--------------------QAERSGGMIVTASGPCECLNLEIALSECGPAGLGVSVKGNRSR----------------------DGAHDLGIYVK--------SIIAG----------------GAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMA 593          

HSP 2 Score: 59.3066 bits (142), Expect = 3.692e-9
Identity = 57/217 (26.27%), Postives = 98/217 (45.16%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFI---GDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLH--EAGAELHLKIRHED---TPI-----------PDQDIYEVVSTVEITKKPSK--------------GLGISVIG---REGAK--GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            + +++  + LG S+    DT +   G V +  I P GA   DGR+  GDR++++N + + + + ++++++L     G+ + L +   D   TP            PDQ        +     P +              GLG+SV G   R+GA   G+Y+  ++ GG A  DGRL+ GDQ++ +N E     +   A   L+  M     + GRI 
Sbjct:  388 VQLQKGPEGLGFSLTS-RDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHDALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNLEIALSECGPAGLGVSVKGNRSRDGAHDLGIYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMATDGSERGRIH 603          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001444.1 (pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1 gene:ENSPMAG00000001288.1 transcript:ENSPMAT00000001444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 8.451e-11
Identity = 73/294 (24.83%), Postives = 131/294 (44.56%), Query Frame = 3
Query: 1653 ISTEETHIVYLTKNAQGLGFAIMEGSFTNE---TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSV---GSPIHNHYPKRLSAP---HITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXED--DEK------TENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIR 2483
            + TE   +   +    G G  +  G+F+ +     + I ++    PA + G L+PGD+++S+N   + +A    + E+ + +  Q  +  A +      + SV       H   PK+        IT+ P + +P  P +  E  + S    L  L P     L  +  +  + +S   +     QS D V L +   ED  DE+      + ++ ++R+   LGI+I  G+D     +++  + P+G   + G I VGD+IL I+ + L  K   E I +L  AG  + LKI+
Sbjct:  335 VHTESVALHLASDGGPGFGLHLQGGTFSTDVFGAPLLIGYIEPDSPAERCGLLQPGDRILSVN--GIPTAELGSLAEVSQYLHEQALVGSASLEVEFDVAESVIPSSGTFHVTLPKKKGVELGITITS-PTHRKPSEPLVITEIKKGSVAHRLGTLEPGDR--LLAINHTRLETSSVDETVHILQQSDDFVKLKVRKDEDNSDEQEASGAISYSVELRRHGGPLGITI-SGTDEPTDPILIASLTPDGLAERTGAIHVGDQILAIDGMSLKGKPLSEAIALLQRAGEIVALKIK 622          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005746.1 (pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 gene:ENSPMAG00000005206.1 transcript:ENSPMAT00000005746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.189e-10
Identity = 32/86 (37.21%), Postives = 50/86 (58.14%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH 2486
            E+TE+I +      +G  I+G   T I   IV  I P G   +DGR+  GDRIL I ++ +  K +EE+I++L + G+ +HL + H
Sbjct:  193 EQTESIELVTTGSGMGFGIVGNRATGI---IVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLVAH 275          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009934.1 (pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene:ENSPMAG00000008984.1 transcript:ENSPMAT00000009934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.860e-9
Identity = 34/95 (35.79%), Postives = 54/95 (56.84%), Query Frame = 3
Query: 1641 YIPSISTEETHIVYLTKN-AQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV 1922
            Y P +  E T    L K   +GLGF +  G  T +   YI+ + V+GPA+++G LR GD+LI++N  +V+  +Y   + +L++    V LVV R 
Sbjct:  364 YAPEVEVELT----LEKGPGEGLGFTVTRG--TEDGAAYIREV-VEGPALRDGRLRAGDRLIAVNGVEVAEMTYPRAVAMLRSTPQSVTLVVGRA 451          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 113.62 bits (283), Expect = 1.792e-25
Identity = 147/537 (27.37%), Postives = 230/537 (42.83%), Query Frame = 3
Query: 1251 SLGLKLTGNKDL-----NHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTE-ETHIVYLTKNA-QGLGFAIMEGSFT-----NETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSD----TFIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK------------GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
             LG+ + G K       N   IFI +I  N  A  DG L VGD+IL+V+   +   +H  A  V++S +GK I   + R  +   K  VP T +  DE                 +V ++    K + V     P +  I T  E   + L +   +GLGF+I  G  +      + GI+I  +A  G A ++G L+ GDK++SIN +D+ +A +D  + +L +  + V L+V R R  N               K+++ P   A   YN   SP+ +  K  + SP              A   K  S   +R                        E    I +K+  + LG SI+GGSD     F  D   + +  I P G VA    +K+GDR+L++N   + N T+++ +  L    + + L +RH+  P       + ++ V   K P + LGIS+  R GAK            G++I  V +G  A  DGRL  G +ILE+NG      T   A   L+S+  ++   +
Sbjct:  577 GLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKS-TGKDITLYVVREKQEIEKRTVPKTAK--DE-----------------SVKEEP---KKTGVRFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDRVIN---------------KKMT-PLTRAGKQYN--PSPS-RAGKQYNPSP--------------ARAGKQYSPSPARA-----------------------EINHEIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTG-VAATTNLKIGDRVLMVNGKDMRNATHQDAVAALIANVSLIKLLVRHDPPP-------KGLNDVNFHKSPGEKLGISI--RGGAKGHPGNPLDKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRALRSMGDRVTLLV 1024          

HSP 2 Score: 71.2478 bits (173), Expect = 1.750e-12
Identity = 96/406 (23.65%), Postives = 156/406 (38.42%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFT-----NETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNED-ALGISIIGGSDTFI---GD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHED-------TPI------------------------------PDQDIYEVVSTVEITKKPSKGLGISVIGRE---------GAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRL 2735
            ++ +GLG  I  G  +     N+ GI+I  ++  GPA ++G L  GDK++ +N  D+S+A++   +++LK+    + L V R +                  KR              PK+   +  K E    G  ++ +PE E         M D  +R                         + E I +KR  D  LG SI GG  +     GD  + +  I  +G   +DGR+KVGD++L IN   + N  +++ + ML  +G      I + D       TP+                              P     E+   + I KK +  LG S++G              G++I   +          LK GD++L +NG+D RN T + A   L
Sbjct:  573 RDTKGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREK--------------QEIEKR------------TVPKTAKDESVKEEPKKTG--VRFAPEPE---------MEDIETR------------------------PEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNML-TSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPARAEINHEI-ILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFIS-KIVPTGVAATTNLKIGDRVLMVNGKDMRNATHQDAVAAL 914          

HSP 3 Score: 68.5514 bits (166), Expect = 1.043e-11
Identity = 71/270 (26.30%), Postives = 119/270 (44.07%), Query Frame = 3
Query: 2250 IKRNEDALGISIIGGSDTFIGD-----VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI--------------------------PDQDIYEVVS-----TVEITKKPSKGLGISVIG-------REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARS-PLASPAHAR 2927
            I R+   LGI+I GG  +         + +  I  NG   +DG + VGD+IL +N + + N T+ + + +L   G ++ L +  E   I                          P+ ++ ++ +     T+ + +   KGLG S+ G       ++G  G++I  + K G A+ DGRLK GD++L IN  D +N   + A   L S    +   + R + + +  TP     K  N   +R  GK ++      SPAR+    SP+ AR
Sbjct:  571 IHRDTKGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKTGVRFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRA-GKQYNP-----SPARAGKQYSPSPAR 834          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 102.064 bits (253), Expect = 7.695e-22
Identity = 143/556 (25.72%), Postives = 239/556 (42.99%), Query Frame = 3
Query: 1254 LGLKLTGNK---DLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAV----SDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIME---GSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNV-KNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDG------NSRRRSSVTNTQSLDIVXXXXXXXEDD------------EKTENIYIKRNE-DALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIR--------HEDTP-------IPDQDIYEVVSTVEITKKPSKGLGISVIG--REGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            LG+ L G +   D +     I  + P      +G +Q GD ++EV+   +    H     +I+S   +  + V+ R  ++  +    +T+    E++S+ + + + V   + A        ++SR+  SVS        S+ + +   V L K  +GLGF+I++    S   +T I I+ L   G A Q+GSL PGD+L+S+N  ++  AS D  ++ LK   +  V + VA+             P+ + Y +   +    +LP   RP  PT                L  ES  G A +  S+ D       +S   S VT+ QS             D             + + I I+R     LG+S+ G  D      +V  +   GA+A DGRI VGD I+ +N+  LI  +      +L +   +  + +          ED+P       +P  +    +  VE+ ++P  GLGIS+ G  R   +GV++  V++       G LK GDQILE++G D RN + E A   ++     + F +  IQ
Sbjct:  797 LGISLEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEF-RLVVARKKDYPEEPETSVTM-SQSEVESLPTVQLDDVSSTIDAPVGTGPSPSSSRRQKSVS------DQSMWSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAKP-----------IPVPDDYEE--DSNQGESLPDTTRPFLPT--------------FDLDNESRPGKADI--SLMDNIENNGKDSDTDSMVTSEQSSKFDFGPPLLFSGDSLDLDNLPDSVKSRMQTITIRRQMVGKLGVSLKGDEDG--SGCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQSLQKDIVVSIDKQEASTREDSPAFLTPFDVPFVETESGLRVVELRREPEVGLGISIAGNKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVVRTIQ 1313          

HSP 2 Score: 89.3521 bits (220), Expect = 6.819e-18
Identity = 113/483 (23.40%), Postives = 200/483 (41.41%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLG----QIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNE--TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDV------------------SSASYDMVL----ELLKNVKNQVRLVVARVRCSNSPSH---------SVG----SPIHNHYPKRLSAPHITALPYYNR---PKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGD--VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI 2480
            + L  KY D+ GE +L+++      N  LGL + G K +    IFI  +     A+ DGR++  DEILEV+   + G SH  A+ V+++ +G  ++  + RS E    ++     R   +     +       +  +  S  + S +   V+ G      P  P  ST+      L +++   G   +  +   E   G  ++++      +++G LR GD+LI+++ Q +                   +A+ D  L    ++L+    +V L VAR++  NS             +G    S I N +P       I + P  N+   P  P  Q+  S+S           ESES L                                      +T+ I ++R  + LG SI+GG  +  GD  + V  +FP GA ++DGR+K GD+I+ +N   L+  ++E  ++ L +   ++ L +
Sbjct: 1412 RELQAKYPDVTGEHLLVSLSK---GNTGLGLSIAGGKGVAVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKN-TGTSVELALGRSREAAEYLS-----RTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDS-----LKRSSPQAGSVTVSPTLLAELSGGQLVEYIDF----VKDGRLRKGDQLIAVDDQAIVGLSHAEGTIVIHEVYEDGAAAKDGRLWAGDQILERTTGRVLLNVARLKPGNSSRPSSLSSLPQLQIGAESTSSIENSFPPVNYDLDIPSEPEANQRATPPLPVQQDSPSQSDD-------EEESESPL--------------------------------------QTKIIELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 3 Score: 77.0258 bits (188), Expect = 3.390e-14
Identity = 110/430 (25.58%), Postives = 176/430 (40.93%), Query Frame = 3
Query: 1659 TEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRP--KSPTIQ-EEKSESSSP-GILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENI-YIKRNEDALGISIIGGSDTFI-------GDVIVHDIFPNGAVAKDGRIKVGDRIL-------VIN-------------------EIQLINKTNEEIITMLHEAGAELHLKIRHE-------------DTPIPDQDIYEVVSTV-----EITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            T E  +V L+K   GLG +I  G       I+I  +   GPA Q+G ++  D+++ +N   V   S+     +LKN    V L + R R +                + LS     A P+   P  K   IQ  E + S SP G+ +   P           S    +S +RSS     S+ +   LL  L   +  E I ++K      G  +I   D  I       G +++H+++ +GA AKDGR+  GD+IL       ++N                   ++Q+  ++   I         +L +    E             D+P    D  E  S +     E+ + P +GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     + E A ++LK   G+I+  +
Sbjct: 1422 TGEHLLVSLSKGNTGLGLSIAGGKGVAVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAA---------------EYLSRTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPST---DSLKRSS-PQAGSVTVSPTLLAELSGGQLVEYIDFVKDGRLRKGDQLIAVDDQAIVGLSHAEGTIVIHEVYEDGAAAKDGRLWAGDQILERTTGRVLLNVARLKPGNSSRPSSLSSLPQLQIGAESTSSIENSFPPVNYDLDIPSEPEANQRATPPLPVQQDSPSQSDDEEESESPLQTKIIELERGP-EGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 4 Score: 59.6918 bits (143), Expect = 6.343e-9
Identity = 54/241 (22.41%), Postives = 103/241 (42.74%), Query Frame = 3
Query: 1254 LGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPY-IPSISTEET-HIVYLTKNAQ-GLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSH--SVGSP 1961
            LG+ L G++D +     +  ++      IDGR+ VGD I+ V+D  L G S   A  V+R  S                                          D + ++  Q  S +  S +    P+ +P + TE    +V L +  + GLG +I         G++++H+       + G L+ GD+++ ++  D+ +AS++  +E+++  ++ VR VV  ++    P    ++GSP
Sbjct: 1129 LGVSLKGDEDGS--GCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQS---------------------------------------LQKDIVVSIDKQEASTREDSPAF-LTPFDVPFVETESGLRVVELRREPEVGLGISIAGNKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVVRTIQDKEDPLSLDTMGSP 1327          

HSP 5 Score: 54.6842 bits (130), Expect = 2.324e-7
Identity = 68/283 (24.03%), Postives = 117/283 (41.34%), Query Frame = 3
Query: 1677 VYLTKNAQGLGFAIM----EGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLAT-LAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIF---PNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-RHEDTP 2498
            V L K  +GLG  I     E +     GI+IK +A    A  +G LR  D++I +    +   +    +E+LK     V L VAR                 H P + S P       ++ P SP  Q  +S S SP  +  +  + E  +A   A + ++   +R     +T+++      +     +     +        LGIS+ G      G +  H I    P G V K+G I+ GD ++ +N + +++  + E++T++     E  L + R +D P
Sbjct:  616 VDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVAR-----------------HIPGKHSRPETP----HSTPHSPGRQTPQS-SHSPRSVTPVVIQPEKSIAVESADAKAEAELQRELQTLDTEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYP 876          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 70.0922 bits (170), Expect = 1.575e-13
Identity = 60/202 (29.70%), Postives = 104/202 (51.49%), Query Frame = 3
Query: 2232 KTENIYIKRNEDALGISIIGGSDT-FIGD---VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAK------GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPS 2807
            +T  I ++R    LG SI GG+D   + D   + +  + P GA A+DGR++V D IL +N    ++  +++ +  L  AG+++ L    +    P ++  E+V       K SKGLG S+ G  G +      G+YI  +++GG A  DGRL+ GD+I+ +N ++  + + E A   LK+   ++   + R+       T S
Sbjct:    3 ETLEITLERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLVREKKRGNAPTRE--EIVLI-----KGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTAYYSEQTDS 197          

HSP 2 Score: 60.8474 bits (146), Expect = 1.972e-10
Identity = 33/88 (37.50%), Postives = 54/88 (61.36%), Query Frame = 3
Query: 1677 VYLTKNAQGLGFAIMEGS----FTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRC 1928
            + L K ++GLGF+I  GS       + GIYI  +   G A Q+G L+ GDK+IS+N Q++   S++  +++LK  K +V +VV+R+  
Sbjct:  102 IVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTA 189          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 64.3142 bits (155), Expect = 4.738e-11
Identity = 49/163 (30.06%), Postives = 84/163 (51.53%), Query Frame = 3
Query: 2256 RNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSL 2744
            + +  +G+ +IGG DT +G + + DI P     K G ++ GD++L +N+  L+  T+   + +L      + L +  +  P  D D++    TVE+ K     LGI V G  G   + +  VV  GVA  DGR++ GD++L +NG   +  T +     L++L
Sbjct:    4 KEDQGIGLMVIGGLDTPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKKDPDRDSDVF----TVELKKDSKGSLGIHVSGGVGTNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNL 162          

HSP 2 Score: 57.3806 bits (137), Expect = 7.969e-9
Identity = 60/189 (31.75%), Postives = 89/189 (47.09%), Query Frame = 3
Query: 2253 KRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHL----------KIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISV-IGREGAKG---VYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSL-MGQIVFKIGR 2774
            K ++ +LGI + GG  T   DV    + P G  AKDGRI+ GDR+L +N       T++E++ +L      + L          +I  +  P P       V  + + K PS GLG SV  GR+   G   +YI   V    A     L+ GD++LE+NG   R  T   A   +++L  G IV ++ R
Sbjct:   97 KDSKGSLGIHVSGGVGTNCIDV--RHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSGGNGKAFKEILQKTPPEPS------VKEITLEKGPS-GLGFSVGGGRDSLYGDTPIYI-KYVFKDSASSRSGLEIGDEVLEVNGRHMRGMTNVEALEAIRALPYGAIVIRVRR 275          

HSP 3 Score: 50.8322 bits (120), Expect = 1.237e-6
Identity = 29/79 (36.71%), Postives = 44/79 (55.70%), Query Frame = 3
Query: 1683 LTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            L K  QG+G  ++ G  T    +YIK +    PA + G LR GD+L+ +N + +   ++   LE+LKN    V+L VAR
Sbjct:    2 LLKEDQGIGLMVIGGLDTPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVAR 80          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO37479 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFK1])

HSP 1 Score: 63.5438 bits (153), Expect = 5.168e-11
Identity = 68/230 (29.57%), Postives = 101/230 (43.91%), Query Frame = 3
Query: 1242 SNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQG-LGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISI---NHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            SN  LGL L G  D    N ++  I+PNS A     +++GDE+LEV+ H L GR+H +A  + RS    +IK V+ R+ +    +    ++R   E                    D  N  +      G+  YI    T  T +V    N+ G  GF I  G  +    + I  L +Q P I  G LR GD++I     N +DV+    D V+   +  K   RL++ R
Sbjct:    5 SNGYLGLVLVGGADSPLKNHYVSDILPNSCASKCDCVRIGDELLEVNGHKLSGRTHADALTIFRSLP-SVIKLVVFRNKDGNKTLLG--SLRKPPE--------------------DVANRPEGDPNITGR--YITERKTITTEVV--KDNSTGEWGFIIGGGMCSPYGNLPIHILDIQNPGIS-GVLRKGDEIIDFNGDNFEDVTYLEADRVIRQYEGTK--ARLIIKR 204          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 147.517 bits (371), Expect = 2.502e-35
Identity = 139/541 (25.69%), Postives = 240/541 (44.36%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHM--------NIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGK---LIKFVIHRSNEWQSK---------------MAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            SLG+ + G + +            IFI  I+ +S A  +G L+ GD I+EVD   L   SH  A   IR        L++ ++ R    Q K               +A+P+     +     ++       +              S    G +P +        H++ L K   GLG ++      +   +++  +   G A ++G +  GD+L+ IN Q +   S+     ++K+  ++V+++                       K L+   ++ L Y       T+ +  ++ S       + P S      L  S        RSS  +T + D     +    +      I I +    LG+SI+GG DT +G +I+H+++  GA +KDGR+  GD+IL +N I L   ++++ I +L +    + L +  ++    ++D+++    VE+ KKP +GLG+S++GR    GV++ D+V GG+ D DGRL  GDQIL +NGED R+ TQE  A  LK  +G I  ++GR +    H
Sbjct:  954 SLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLVQSIVQRPRVSQLKQQPFGLSEISPTGTLLALPVVPHAGESDTDALAEAPAEAGEEGEEEKVDEFGYTWSDRRYGSLPGV-------LHMIELEKGQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFEGCMKPGD--------------KLLAVNGVSVLGY-------TVDKVLNDES------LVDPTSSCPFFWLGFS--------RSSTPSTLACDPATCPIIPGCE----TTIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFRDEGQYKEEDLWDSFD-VELHKKPGQGLGLSIVGRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPFH 1447          

HSP 2 Score: 103.99 bits (258), Expect = 4.903e-22
Identity = 74/251 (29.48%), Postives = 124/251 (49.40%), Query Frame = 3
Query: 1185 KYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKM----AVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSL--GQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            +YG L G L ++ +         LGL L GN+D + M++F+  I PN  A  DGR+ VGDE+LE++  +L+G+SH NA+ +I+S   K +K +     +   K+     V +     D++     S  +    C       + S   S+++      P IP   T     + + K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+ +AS+D  + +L+    +VRL V R
Sbjct: 1104 RYGSLPGVLHMIELEK---GQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSK-VKIIFEGCMKPGDKLLAVNGVSVLGYTVDKV-LNDESLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPIIPGCET----TIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFR 1345          

HSP 3 Score: 85.5001 bits (210), Expect = 2.410e-16
Identity = 99/382 (25.92%), Postives = 171/382 (44.76%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAK-SMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-RHEDTPI--PDQD------IYE------VVSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            K  QGLG +I+     N+TG+++  +   G    +G L  GD+++S+N +DV SA+ + V  LLK     ++L V R +           P H+   +RLS             + P ++           ++ L   SESG + +A+ S SD  +   +   + +++++                   K   D+LGISI GG  + +GD+   +  + P G  A+  ++KVGDRI+ I        ++ + +T+L      + L++    D+ +  P Q+      I++         T+ + + P  GLG S++G  G+      +Y+  V   G A  DGRLK GDQI+ +NG+     T E A   LK   G +   +
Sbjct: 1366 KPGQGLGLSIV--GRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAG---------PFHSE--RRLS----------QSSQVPCVE-----------ILTLLQISESGSSKVARPSSSDSGNLLSAEHQDVRTVELT------------------KGPSDSLGISIAGGVGSPLGDIPIFIAMMNPVGLAAQT-QLKVGDRIVSICGTSAEGMSHSQAVTLLKNTPGTIQLQVVAGGDSTVTGPSQEQLTPSCIFQDDIGPPQYKTITLERGPD-GLGFSIVGGHGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIIAVNGQTLEGVTHEEAVGILKRTKGTVTLTV 1693          

HSP 4 Score: 81.6481 bits (200), Expect = 3.305e-15
Identity = 103/424 (24.29%), Postives = 160/424 (37.74%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNH--MNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGR-SHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-----RHEDTP 2498
             LG  L G K  N   + IFI +I P S+AD DG+L+  D+IL ++   L    SH  A  +++S S + +   + R    Q  +  PI  R                   LSA S                      S +    + L  +  GLGF I+ G     TG+ +K +   G A Q+G LR GD ++ I   D+     + V ++L+   N+V+LVV R     +P                SA     LP  +  + P   +E+              E+ES    L K              N Q L I        ++ E +  I++K                         I  + AV +DGRI VGD+I  ++ + +   TN++ + +L   G  + LK+     R E+ P
Sbjct:  140 GLGFSLVGLKSENRGELGIFIQEIQPGSVADCDGKLKEADQILAINGQPLDQTVSHQQAIGLLQSASER-VHLTVARGPIPQ--LTSPIVSRTPS------------AASTLSANS----------------------SWQHVETIELVNDGTGLGFGIVGG---KTTGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAPVEETP----------------SAVMSVVLPTVSEQQVPKQNKEE--------------EAESFNVCLTK--------------NAQGLGITIAGYVGDKNSEPS-GIFVK------------------------SITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIRRGFRPEEIP 454          

HSP 5 Score: 74.7146 bits (182), Expect = 5.102e-13
Identity = 70/247 (28.34%), Postives = 107/247 (43.32%), Query Frame = 3
Query: 1251 SLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIME--GSFTNE-TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR-------VRCSNSPSHSVGSP 1961
             LG  + G K      + +  I+P  IAD DGRL+ GD IL + D  L G        V+R C G  +K V+ R+   ++  AV   +                    L  VS+Q            Q+P        E+  V LTKNAQGLG  I    G   +E +GI++K +       Q+G +  GD++ +++  ++   +    +ELL++    VRL + R       +  + SPS SV SP
Sbjct:  256 GLGFGIVGGKT---TGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQC-GNRVKLVVTRAPVEETPSAVMSVV--------------------LPTVSEQ------------QVPKQNKEEEAESFNVCLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIRRGFRPEEIPPAVSPSASVLSP 466          

HSP 6 Score: 68.1662 bits (165), Expect = 5.321e-11
Identity = 95/414 (22.95%), Postives = 162/414 (39.13%), Query Frame = 3
Query: 1257 GLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNET--------GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRL----VVARVRCSNSPSHSVGSPIHNHYPKRLS--APHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEA 2456
            G+ ++  KD   + + I  I+       DGRL VGD IL ++       S+  A  ++R  S         RSN +   +   IT   A+ ++             +S + ++ +     S S G          +   +    ++ + LG +I+ G              GI+IKH+    PA Q G+LR GD+++ ++  D+  AS++  +E ++   N V      +V R R S               P  LS  +P  T L     P  P   E  +++ +           E  +     + SD   RR  S+     +                  I +++ +  LG+S+ G  D     V V  I PNGA  +DGRI VGD +L IN   L  ++++   +++  A
Sbjct:  816 GMTVSAMKD--GLGMLIRSIIHGGSISRDGRLGVGDLILAINGEPTTNLSNAQARAMLRRHSLIGPDLGQRRSN-FCVFVGFSITYVPAEYLEEYKLQCLPPSSRMISTLPEREDGEGEESASYGNW-------NQPRKVELFREHGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLVQSIVQRPRVSQ----------LKQQPFGLSEISPTGTLLAL---PVVPHAGESDTDALAEAPAEAGEEGEEEKVDEFGYTWSD---RRYGSLPGVLHM------------------IELEKGQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSA 1185          

HSP 7 Score: 67.0106 bits (162), Expect = 1.111e-10
Identity = 60/216 (27.78%), Postives = 101/216 (46.76%), Query Frame = 3
Query: 2229 EKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRH---EDTP---------------IPDQDIYEVVSTVEIT-KKPSKGLGISVIGREGAK-----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTP 2804
            +  E I +  +   LG  I+GG  T    VIV  I P G   +DGR++ GD IL I +  L    +E++  +L + G  + L +     E+TP               +P Q+  E   +  +   K ++GLGI++ G  G K     G+++  + K    D DGR+  GDQI  ++G + +  T + A   L+   GQ V    R++ +++ + P
Sbjct:  243 QHVETIELVNDGTGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAPVEETPSAVMSVVLPTVSEQQVPKQNKEEEAESFNVCLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRH-TGQTV----RLKLIRRGFRP 450          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 131.724 bits (330), Expect = 7.548e-32
Identity = 73/185 (39.46%), Postives = 116/185 (62.70%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
             I I +    LG+SI+GG DT +G +I+H+++  GA +KDGR+  GD+IL +N I L   ++++ I +L +    + L +  ++    ++D+++    VE+ KKP +GLG+S++GR    GV++ D+V GG+ D DGRL  GDQIL +NGED R+ TQE  A  LK  +G I  ++GR +    H
Sbjct:  151 TIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFRDEGQYKEEDLWDSFD-VELHKKPGQGLGLSIVGRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPFH 334          

HSP 2 Score: 102.834 bits (255), Expect = 2.633e-22
Identity = 74/250 (29.60%), Postives = 123/250 (49.20%), Query Frame = 3
Query: 1176 LANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSL--GQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            ++ +YG L G L ++ +         LGL L GN+D + M++F+  I PN  A  DGR+ VGDE+LE++  +L+G+SH NA+ +I+S   K +K +              ++I   DE      S  +    C       + S   S+++      P IP   T     + + K   GLG +I+ G  T    I I  +  +G A ++G L  GD+++ +N  D+ +AS+D  + +L+    +VRL V R
Sbjct:   10 VSRRYGSLPGVLHMIELEK---GQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSK-VKIIF-------------VSISVNDE------SLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPIIPGCETT----IEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFR 232          

HSP 3 Score: 55.0694 bits (131), Expect = 3.102e-7
Identity = 60/200 (30.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAE------------------------LHLKIRHEDTP---IPDQDIYEVV----STVEITKKPSKGLGISVIGRE----GAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLK 2738
            I +++ +  LG+S+ G  D     V V  I PNGA  +DGRI VGD +L IN   L  ++++   +++  A ++                          L      TP     D     ++    +T+EI K    GLG+S++G      GA  + I +V + G A  DGRL  GDQILE+NG D R  + + A   L+
Sbjct:   24 IELEKGQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFVSISVNDESLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPIIPGCETTIEICKG-CTGLGLSIVGGCDTLLGA--IIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLR 220          

HSP 4 Score: 51.9878 bits (123), Expect = 2.889e-6
Identity = 30/87 (34.48%), Postives = 48/87 (55.17%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHS 1949
            K  QGLG +I+     N+TG+++  +   G    +G L  GD+++S+N +DV SA+ + V  LLK     ++L V R +    P HS
Sbjct:  253 KPGQGLGLSIV--GRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFK--AGPFHS 335          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain protein-like [Source:NCBI gene;Acc:101166191])

HSP 1 Score: 122.479 bits (306), Expect = 1.249e-27
Identity = 74/209 (35.41%), Postives = 122/209 (58.37%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH------YTPSYLIAKDDNDDNNRT 2849
             I I +    LG+SI+GG DT +G VI+H++   GA  +DGR++ GD+IL +N I L   T++E I +L     ++ L I        ++D+++V S ++++ +P +GLG + +G+    G+++ DV++GG AD DGRL PGDQIL ING D R  +Q+ A   L+S  G ++ ++ R +   Q+      Y     I  +D+D +  T
Sbjct: 1471 TIEIHKGNVGLGLSIVGGCDTLLGAVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLRLTTQQVRLCIFRHQEAYREEDLWDVFS-LKLSPRPGEGLGFTTVGKSNDTGIFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKARVQYSRQSQDYAKFCFIQHEDSDCSTLT 1678          

HSP 2 Score: 90.5077 bits (223), Expect = 8.177e-18
Identity = 106/388 (27.32%), Postives = 164/388 (42.27%), Query Frame = 3
Query: 1689 KNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDV--IVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEV----------------------VSTVEITKKPSKGLGISVIGREGAK----GVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKI 2768
            +  +GLGF  +  S  N+TGI++  +   G A  +G L PGD+++SIN  DV +AS D   +LL++    V L VAR +                Y ++            +  K   IQ E S+ S+      L+P S S          D +SR  +S     S           +D E  +    K   D+LGISI GG  +  G+V   +  +  NG  AK  +++ GD+IL IN++     T++E   +L  A   + L++  +      QD   V                        T+ + ++ S GLG S++G  G+      +Y+  +   G A  DGRLK GDQI+ +NG      T   A   LK   G +V  +
Sbjct: 1573 RPGEGLGFTTVGKS--NDTGIFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKA------------RVQYSRQ----------SQDYAKFCFIQHEDSDCST------LTPTSGS----------DTSSRGANSKAKCSS----------SQDREVRKVTVQKGPRDSLGISIAGGVGSPHGNVPLFIATMDTNGLAAKTEKLQTGDQILCINDVSTEGMTHDEAGALLKNAAGSVTLQVTADSGGGSRQDHSAVHAASSSQPGSLTWFHNNLCPRKYKTITL-ERGSSGLGFSIVGGFGSPHGDLPIYVKTIFNKGAAVEDGRLKRGDQIIAVNGHCLEGVTHAEAVDILKRTKGTVVLTL 1909          

HSP 3 Score: 75.485 bits (184), Expect = 2.614e-13
Identity = 65/258 (25.19%), Postives = 122/258 (47.29%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNI-PNPRLSNCSLGLKLTGNKDLNHMNIFIC--QIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHI-----VYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            K++  +YG L G+L ++ +  +P +    LG+ L G+KD +   + +C   + P     +DGR+QVGDE+LE++  IL+GRS+ NA+ +I +   K +K V+ R+   ++  AV                              + N  +   V    I + P  + EE        + LT++  GLG  ++E    +  G+ +  L   G A ++G ++ GD+++ +  + V+  S + V  L+   +  V+L + R
Sbjct: 1187 KKMLQRYGSLSGKLHMIELEKDPAVPG--LGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSK-VKIVLIRN---KAGKAV------------------------------KENRTEGEVV----IDWHPDAADEEESCSDLKRIVLTQDHAGLGIRLVED--PSWEGVVVGSLIQDGSASKDGRIKVGDRILEVGGEPVAGLSVEKVSSLISKQQVAVKLSIIR 1402          

HSP 4 Score: 70.4774 bits (171), Expect = 1.072e-11
Identity = 100/385 (25.97%), Postives = 171/385 (44.42%), Query Frame = 3
Query: 1650 SISTEETHIVYLTKNA-QGLGFAIMEGSFTNET--------GIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVV--ARVRC-SNSPSHSVGSPIHN-HYPKRLSAPHITALPYYNR-PKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNE--DALGISIIGGSDTFIG--DVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI------------RHEDTPI----PD-QDIYEVVSTVE--ITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGE 2693
            S S ++   V LT+ A Q LG +IM G              G++IKH++   PA   G+LR GD+++ ++  D+  AS++  +E ++   + V L+V   + RC S +P+    +P  N H  K   A     L   +R P +PT  +  S +S      ++           A +    ++ R+  +    SL              K   I ++++     LGI++ G  D       V V  + P G    DGRI+VGD +L IN   L  ++ +   T++  A +++ + +            R E   +    PD  D  E  S ++  +  +   GLGI ++     +GV +  +++ G A  DGR+K GD+ILE+ GE
Sbjct: 1008 SASWDQPRSVRLTRAAGQSLGISIMGGRGMGRRLSSGEMMRGVFIKHISPDSPAAHNGTLRAGDRILEVSGVDLRDASHEEAVEAIRRAGDSVVLLVRSGQDRCQSPAPTCRTPTPQSNSHSSKEEEALSSLFLSVSHRNPFTPTPFKAPSPTSD-----RMDGRIPVNATAAAAAEDGDDACRKKMLQRYGSL------------SGKLHMIELEKDPAVPGLGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSKVKIVLIRNKAGKAVKENRTEGEVVIDWHPDAADEEESCSDLKRIVLTQDHAGLGIRLVEDPSWEGVVVGSLIQDGSASKDGRIKVGDRILEVGGE 1375          

HSP 5 Score: 59.6918 bits (143), Expect = 1.858e-8
Identity = 63/216 (29.17%), Postives = 102/216 (47.22%), Query Frame = 3
Query: 2238 ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKI-------RHEDTPIPDQDI-----------YEVVSTVEITKKPSKGLGISVIGREG------AKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYL 2813
            E I +  +   LG  IIGG  + I   +V  I P GA  +D R++ GD+IL I +  L    +E+   +L  AG+++ L I        H  +P+  QD            YE   +++ TK  S+GLG +V    G      + GV +  + KG   D DGR+  GD IL ++G   +  +++ A   L+   G +V    R+ +  +  +PS+L
Sbjct:  165 EIIELTNDGKGLGFGIIGGRASGI---MVKTILPGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVLRNAGSKVKLLIARNVTKDNHLSSPVLSQDSSDDKIIDLNDDYEF--SLQFTKN-SRGLGFTVSSYVGDLNSVYSAGVMVKSIAKGSTVDQDGRMHIGDIILSVDGVSLQGCSEQRAMEVLRR-TGPLVRL--RLLRKAERLSPSFL 371          

HSP 6 Score: 56.225 bits (134), Expect = 1.981e-7
Identity = 33/107 (30.84%), Postives = 64/107 (59.81%), Query Frame = 3
Query: 1605 RKASSVSLGQIPYIPSISTEETH--IVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            R + ++SLG+   + +I+ E  H  I+ LT + +GLGF I+ G     +GI +K +   G A ++  LR GD+++ I   D++  + +   ++L+N  ++V+L++AR
Sbjct:  143 RISRTMSLGR--NLSAIAHERRHVEIIELTNDGKGLGFGIIGG---RASGIMVKTILPGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVLRNAGSKVKLLIAR 244          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: ENSORLT00000033630.1 (pep primary_assembly:ASM223467v1:4:6346408:6376678:1 gene:ENSORLG00000026891.1 transcript:ENSORLT00000033630.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 9.502e-19
Identity = 62/171 (36.26%), Postives = 97/171 (56.73%), Query Frame = 3
Query: 2244 IYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQI 2756
            + + ++   LG+S+ G  D     + V++    GA AKDGR+  GD+IL +N + L   ++EE I  L +  A++ L I  ++    D++  +V   VE+ K+  +GLG+S++G+    GV+I    + G A VDGRLK GDQIL +NGE  +  T E A T LK   G +
Sbjct:   42 VELDKDRHGLGLSLAGNRDRSCLSIFVYE---EGAAAKDGRLWAGDQILEVNGVDLRGASHEEAIAALRQTPAKVRLTILRDEAQDRDEENLDVFE-VELQKRSGRGLGLSIVGK---SGVFI---SEVGAAAVDGRLKRGDQILSVNGESLQGVTHEQAVTILKKQRGTV 202          

HSP 2 Score: 68.9366 bits (167), Expect = 4.312e-12
Identity = 61/262 (23.28%), Postives = 113/262 (43.13%), Query Frame = 3
Query: 1167 SKRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSV 1952
            ++R   +YGDL GEL+ + +   R     LGL L GN+D + ++IF+ +      A  DGRL  GD+ILEV+   L G SH  A   +R                       P  +R                   L+ + D+   R   ++ + ++                 ++ +GLG +I+      ++G++I  +   G A  +G L+ GD+++S+N + +   +++  + +LK  +  V L  A ++     SH++
Sbjct:   25 AERWCERYGDLHGELLCVELDKDRHG---LGLSLAGNRDRSCLSIFVYE---EGAAAKDGRLWAGDQILEVNGVDLRGASHEEAIAALRQ---------------------TPAKVR-------------------LTILRDEAQDRDEENLDVFEVE-------------LQKRSGRGLGLSIV-----GKSGVFISEV---GAAAVDGRLKRGDQILSVNGESLQGVTHEQAVTILKKQRGTVNLTDAGLKAFIKQSHNI 219          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: ptpn13 (protein tyrosine phosphatase non-receptor type 13 [Source:NCBI gene;Acc:101171683])

HSP 1 Score: 85.1149 bits (209), Expect = 3.552e-16
Identity = 66/259 (25.48%), Postives = 115/259 (44.40%), Query Frame = 3
Query: 1245 NCSLGLKLTGNKD--LNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAI-----MEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPH 2000
            + SLG+ +TG  D  + H  ++I  + P   AD+DGR+Q GD ++ V+   L G SH  A   +R  +G+ +   + +S+    +++ P+T RC               V  +++  D    R+ SS S  +  Y   ++ +    V L KN  GLGF+      + G     + + +K L    PA + G +R GD ++ +N   +   S   V+  L+    +V L++ R      P     S      P++  A H
Sbjct: 1199 DSSLGISVTGGVDTSVKHGGVYIKALTPKGAADLDGRIQKGDRVVAVNGKSLEGASHQQAVNALRD-TGQTVHLSLEKSHLPLDRVSAPVTPRCT--------------VRGINSEPDHAKDREKSSESKDKKDYF-FVTKDNVFEVRLLKNTSGLGFSFSRQEQVPGEAHGSSMVRVKKLFPGQPAAESGRIRVGDVILRVNQTPLKGLSQHEVISALRGTGQEVTLLLCRPEHGTLPEMDSSSLTPKPSPRKEPATH 1441          

HSP 2 Score: 58.151 bits (139), Expect = 5.924e-8
Identity = 28/89 (31.46%), Postives = 50/89 (56.18%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFI--GDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPI 2501
            +I + + + +LGIS+ GG DT +  G V +  + P GA   DGRI+ GDR++ +N   L   ++++ +  L + G  +HL +     P+
Sbjct: 1192 DIELSKIDSSLGISVTGGVDTSVKHGGVYIKALTPKGAADLDGRIQKGDRVVAVNGKSLEGASHQQAVNALRDTGQTVHLSLEKSHLPL 1280          

HSP 3 Score: 56.225 bits (134), Expect = 2.230e-7
Identity = 33/83 (39.76%), Postives = 51/83 (61.45%), Query Frame = 3
Query: 1677 VYLTKNAQG-LGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARV 1922
            V L K+ +G LGF + +GS   + G YI H  VQ PA  +G L+PGD++I++N+ DVS   +  V+ L++     V L+V R+
Sbjct: 1597 VSLVKSEKGSLGFTLTKGS---DHGCYI-HDIVQDPAKGDGRLKPGDRMIAVNNTDVSDMGHTEVVNLVRAAPPVVELLVGRI 1675          

HSP 4 Score: 53.5286 bits (127), Expect = 1.393e-6
Identity = 54/185 (29.19%), Postives = 84/185 (45.41%), Query Frame = 3
Query: 2241 NIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTP------------------------IPDQDIYEV------------VSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEIN 2687
            +I  K N + LG+ + GGSD+  G + V DI P    +K+G +K  D I  IN     + T  E   +L  +  +L LK      P                        I D+D  E+            +  V++ K  S GLG SVIG  G +G+++  +  GGVA++ G L+ GD++L++N
Sbjct: 1690 DICFKSNREPLGLVLDGGSDSMFGVLFVKDIHPGSLASKEGSLKPLDLIHYINGAPTQDLTLSESQRLLELSPKDLALKATRGGIPVYPQEKSVSFLDDNSKIPSSINGFIKDEDSREMKELEALCPSEEDIIKVDLEKSLSGGLGFSVIG--GERGIFVKSITPGGVAELSGILQVGDRLLKVN 1872          

HSP 5 Score: 51.2174 bits (121), Expect = 7.288e-6
Identity = 31/103 (30.10%), Postives = 54/103 (52.43%), Query Frame = 3
Query: 1611 ASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVAR 1919
            +SS+  G   Y+  +S + +     T +  G      E S   + G  I  L   GPA  +G L+PGD+LIS+N +++   S+   +++L+N  + V LVV++
Sbjct:  905 SSSMEDGGQAYVVGVSVQGSSGPPSTDSVTGFQVVGGENSGRKDLGTLISSLTPGGPADVDGCLKPGDRLISVNGKNLEGLSHSATVDVLQNTPDDVTLVVSQ 1007          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 792/804 (98.51%), Postives = 796/804 (99.00%), Query Frame = 3
Query:  516 MELCNKLCKKIFHNSFSGSDHNGNAEIQNIQLIHTVKMNSEFEAPKSVSMPPVNQSNDANSVLSVSTKQNDEENILKSNEIKIELLETNESENKIIQKLEDEERFIELEKVLMILDRSTEGNDDENSEKSNEILEKQIAEKLENSEMATEQSPVKDVTTSANPVSSTETDIQHSEAISVKTDSNLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR 2927
            MELCNKLCKKIFHNSFSGSDHNGNAEIQNIQLIHTVKMNSEFEAPKSVSMPPVNQSND NSVLSVSTKQNDEENILKSNEIKIELLETNESENKIIQKLEDE+RFIELEKVLMILDRSTEGNDDENSEKSNEILEKQIAEKLENSEMATEQ PVKDVTTSANPVSSTETDIQHSEAISVKTDSNLIVNEKDDNVDDEDNDDNDYD++D DD+     SKRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVNLLLNNLEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR
Sbjct:    1 MELCNKLCKKIFHNSFSGSDHNGNAEIQNIQLIHTVKMNSEFEAPKSVSMPPVNQSNDTNSVLSVSTKQNDEENILKSNEIKIELLETNESENKIIQKLEDEDRFIELEKVLMILDRSTEGNDDENSEKSNEILEKQIAEKLENSEMATEQPPVKDVTTSANPVSSTETDIQHSEAISVKTDSNLIVNEKDDNVDDEDNDDNDYDNDDDDDN-----SKRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVNLLLNNLEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR 799          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 1133.24 bits (2930), Expect = 0.000e+0
Identity = 585/586 (99.83%), Postives = 586/586 (100.00%), Query Frame = 3
Query: 1170 KRLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR 2927
            +RLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVNLLLNNLEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR
Sbjct:   13 ERLANKYGDLGGELILLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVNLLLNNLEDDEKTENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASPAHAR 598          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000053393.1 (SMESG000053393.1)

HSP 1 Score: 220.705 bits (561), Expect = 2.628e-58
Identity = 173/545 (31.74%), Postives = 280/545 (51.38%), Query Frame = 3
Query: 1215 LLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCS--GKLIKFVIHRSNEWQSKMA-VPITIRCADEIQXXXXXXXXXXXDCLSAVSDQNN-SRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGS---PIHNHYPKRLSAPHITALPYYNRPK--SPTIQEEKSESS-SPGIL-----IKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIVXXXXXXXEDDEKT--------ENIYIKRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 2780
            ++NI   +     +GL L GNKD + MN +IC    NS+A +DG+L +GDE+L+++   + G SH N  P+I+ C    + I   I R  +   KMA +P ++  +        +  E   + +   +D+N  S   +    G I +           V+L K+ QG GF IM+ +  +E GIY+K + V G A  EG+LR GD+++ IN + V +  YD VL+ L+  KN + +VV R+  S   + ++ +   PI     + +    I + P    P   SP I +++  S+  P I      I  S   +    ++ K +++ +  ++ SV N Q +  V       + +  T        E +     +  LG+SIIGGSDT +G V++H++    A A DGR+  GDRIL +N   L N T+++ I  L   G  + LKI  +  P+ +  +Y  +  V++ KK  KGLGI+++ +    GV I D+VKG +A+ DGRLK GD +LEIN  + R+ TQ+  AT LK   G +   +GR++
Sbjct: 1500 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTS-------VAPCEKSENAVETSTDENQISSNNNLQGYGDIFH-----------VHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDDRKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSV-NEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLK-VDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 2023          

HSP 2 Score: 56.9954 bits (136), Expect = 9.593e-8
Identity = 98/429 (22.84%), Postives = 174/429 (40.56%), Query Frame = 3
Query: 1698 QGLGFAIMEGSFTNE-------------TGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALPYYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSD--GNSRRRSSVTN---TQSLD----IVXXXXXXXEDDEKTENIYI-KRNEDALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAE---LHLKI-RHEDTPIPDQDIYEVVST-----------VEIT-----------------------KKPSKGLGISVI--GREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQLKQH 2795
            Q LG +I+ G   N              +GI+I H+    PA + G L  GD+L+S+N  D+   SYD  +  +KN  + +   +  +   +    S  + + N    +LS        Y +  + P     KS+     +   L+   ++    + ++ +D   NS   SS++N   T  L     I N   ++ ++  K  NI I K+ +  +G+ ++G  D    +  +     N   A DG++ +GD +L IN I ++  ++  +  ++ +   E   + L I RH D  +    I   V+T           VE +                       +K  +G G  ++        G+Y+  V   G+A  +G L+ GD+IL IN E   NE  +    RL+     +   +GRI   + H
Sbjct: 1309 QSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNC---QLS-------DYESHEQEPLSLNSKSDMLKKKLTTPLNSPDKATSNKINQNETDEKENSFSVSSLSNESVTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDH 1727          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000010833.1 (SMESG000010833.1)

HSP 1 Score: 88.1965 bits (217), Expect = 1.944e-17
Identity = 64/174 (36.78%), Postives = 104/174 (59.77%), Query Frame = 3
Query: 2244 IYIKRNEDA-LGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTN----EEIITMLHEAGAELHLKIRH---EDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKS 2741
            I I R+ ++ +GIS +GGSDT +  +++ +I+ +GAVAKDGR++ GD+I+ IN++ L   T+    +  +    + G    +  R    E T    ++I +      ++K+  K LGI ++G++   G+Y+ D+VKG  AD+DGRL   D+IL ING D R ETQ+ AA  + S
Sbjct:  481 IVIDRSTNSDMGISFVGGSDTPLQCIVIQEIYLDGAVAKDGRLRPGDQIISINDVDLNQATHLQARQAFLQAQQQPGVNRLMVYRERADESTFTEKEEILQ----FGLSKRTDKKLGIKLVGQKNKPGLYVLDLVKGSEADLDGRLHKNDRILNINGVDLRMETQDTAARVINS 650          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000010833.1 (SMESG000010833.1)

HSP 1 Score: 88.1965 bits (217), Expect = 2.152e-17
Identity = 64/174 (36.78%), Postives = 104/174 (59.77%), Query Frame = 3
Query: 2244 IYIKRNEDA-LGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTN----EEIITMLHEAGAELHLKIRH---EDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICXXXXXXXXXXXXRLKPGDQILEINGEDFRNETQEIAATRLKS 2741
            I I R+ ++ +GIS +GGSDT +  +++ +I+ +GAVAKDGR++ GD+I+ IN++ L   T+    +  +    + G    +  R    E T    ++I +      ++K+  K LGI ++G++   G+Y+ D+VKG  AD+DGRL   D+IL ING D R ETQ+ AA  + S
Sbjct:  468 IVIDRSTNSDMGISFVGGSDTPLQCIVIQEIYLDGAVAKDGRLRPGDQIISINDVDLNQATHLQARQAFLQAQQQPGVNRLMVYRERADESTFTEKEEILQ----FGLSKRTDKKLGIKLVGQKNKPGLYVLDLVKGSEADLDGRLHKNDRILNINGVDLRMETQDTAARVINS 637          
The following BLAST results are available for this feature:
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ2.655e-6131.00multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ4.399e-6131.00multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.498e-6031.00multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.658e-6031.00multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.807e-6031.00multiple PDZ domain crumbs cell polarity complex c... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-13.315e-2936.25Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-14.674e-2936.25Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-15.467e-2936.25Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-16.197e-2936.25Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-16.343e-2940.54Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrib2.310e-1927.32gene:FBgn0263289 transcript:FBtr0335522[more]
scrib6.968e-1927.32gene:FBgn0263289 transcript:FBtr0335521[more]
scrib1.098e-1826.77gene:FBgn0263289 transcript:FBtr0308620[more]
scrib1.098e-1826.77gene:FBgn0263289 transcript:FBtr0308621[more]
scrib1.406e-1826.77gene:FBgn0263289 transcript:FBtr0308627[more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
patj6.485e-2939.66PATJ crumbs cell polarity complex component [Sourc... [more]
patj1.106e-2541.21PATJ crumbs cell polarity complex component [Sourc... [more]
patj1.106e-2541.21PATJ crumbs cell polarity complex component [Sourc... [more]
si:dkey-92j12.52.859e-2332.65si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
si:dkey-92j12.53.079e-2332.65si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iffo23.363e-6132.05intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.443e-6032.04intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.455e-6032.97intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.642e-6032.04intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.678e-6032.97intermediate filament family orphan 2 [Source:Xenb... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpdz8.032e-6431.08multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz8.136e-6431.08multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz8.139e-6431.08multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz1.434e-6331.08multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Patj1.991e-3041.34PATJ, crumbs cell polarity complex component [Sour... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55164|MPDZ_RAT8.013e-6531.60Multiple PDZ domain protein OS=Rattus norvegicus O... [more]
sp|Q8VBX6|MPDZ_MOUSE5.691e-6331.08Multiple PDZ domain protein OS=Mus musculus OX=100... [more]
sp|O75970|MPDZ_HUMAN7.964e-6031.00Multiple PDZ domain protein OS=Homo sapiens OX=960... [more]
sp|F1MAD2|INADL_RAT2.319e-3828.62InaD-like protein OS=Rattus norvegicus OX=10116 GN... [more]
sp|Q8NI35|INADL_HUMAN7.664e-3041.90InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ ... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1R7T14.204e-7332.17Multiple PDZ domain protein OS=Crassostrea gigas O... [more]
T1JLQ12.780e-6932.38Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A131XBC01.382e-6732.49Putative multiple pdz domain protein (Fragment) OS... [more]
A0A210QCE84.192e-6732.71Multiple PDZ domain protein OS=Mizuhopecten yessoe... [more]
A0A1S3KGP41.163e-6633.95multiple PDZ domain protein isoform X1 OS=Lingula ... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
patj1.278e-3527.63PATJ crumbs cell polarity complex component [Sourc... [more]
ENSAMXT00000041966.13.119e-3140.54pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000037958.13.181e-3140.54pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000021866.23.836e-3140.54pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000052301.12.064e-1831.27discs large homolog 1-like protein [Source:NCBI ge... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004677.13.337e-2439.24pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
ENSPMAT00000002205.12.873e-1225.96pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
ENSPMAT00000001444.18.451e-1124.83pep scaffold:Pmarinus_7.0:GL476357:122445:266872:1... [more]
ENSPMAT00000005746.11.189e-1037.21pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 g... [more]
ENSPMAT00000009934.12.860e-935.79pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO334321.792e-2527.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337067.695e-2225.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460591.575e-1329.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456244.738e-1130.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374795.168e-1129.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ2.502e-3525.69multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ7.548e-3239.46multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ1.249e-2735.41multiple PDZ domain protein-like [Source:NCBI gene... [more]
ENSORLT00000033630.19.502e-1936.26pep primary_assembly:ASM223467v1:4:6346408:6376678... [more]
ptpn133.552e-1625.48protein tyrosine phosphatase non-receptor type 13 ... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056186.10.000e+098.51SMESG000056186.1[more]
SMESG000056186.10.000e+099.83SMESG000056186.1[more]
SMESG000053393.12.628e-5831.74SMESG000053393.1[more]
SMESG000010833.11.944e-1736.78SMESG000010833.1[more]
SMESG000010833.12.152e-1736.78SMESG000010833.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006093 ID=SMED30006093|Name=Multiple PDZ domain crumbs cell polarity complex component|organism=Schmidtea mediterranea sexual|type=transcript|length=3124bp
CGAAATAGAAAATAAAATCAGTTTCAATCATCCATTCACGAATAGATAAT
GGTTATTTAATATATAATTCGAAGTCCTGAAGAGCCAACGCCTAATTTTC
AATTTATACGCGGTCACTGATCGTAGGGCTACGATTCGTAGACGTCTCTG
GTGTGTCGGCTGTGGAACACACTAATTACATTCAATTATTCATGATATAA
AACTAGAATTTGATGACTGTTTTTAGTATCATCTAGTATTTTGTTACTGT
AGTAACCATTTTTTGCTTTCATTCTGGATTAGAGGAAATATTTCTCATAG
AAAATTGTGGTTATTTTCCATCTCACTCTACGACTCTAATAGGTGGAGTT
CTGTCATAGTGTTGGATTGAAATAAACAGAGTCTACTTACAAACTGAAAA
CTCTTTTGTGTGAAATAGATCATCGACATTTGAGAACGGTTCACAGATCT
GATCAGATATTGATGTTGACATTGACCAATCGGATTCTCTGATCGTTGTT
CATTTTAATAAAAAAATGGAATTGTGCAATAAATTGTGTAAAAAGATTTT
TCATAACAGTTTTTCGGGATCCGATCACAATGGAAATGCTGAAATTCAAA
ATATACAATTAATTCACACTGTTAAAATGAATTCTGAATTTGAAGCCCCT
AAATCGGTTTCTATGCCCCCTGTTAACCAATCTAATGATGCCAATTCCGT
GCTTTCAGTGTCAACAAAGCAAAATGACGAAGAAAATATTTTGAAAAGTA
ATGAAATAAAAATTGAATTACTAGAAACAAATGAAAGTGAAAATAAGATT
ATACAAAAACTGGAAGACGAAGAGCGTTTTATTGAATTAGAAAAAGTTCT
GATGATTTTAGATCGTTCCACTGAGGGAAATGATGATGAGAATTCAGAAA
AATCGAATGAAATTTTAGAAAAACAAATCGCTGAGAAATTAGAAAATAGC
GAAATGGCTACTGAACAATCACCAGTCAAAGATGTGACGACAAGCGCAAA
TCCAGTCAGTTCAACTGAAACCGACATTCAACACTCAGAAGCCATTTCTG
TCAAAACTGACAGCAATTTAATTGTCAACGAAAAGGATGACAATGTTGAC
GATGAAGACAACGACGATAACGACTACGACGATAACGACTACGACGATGA
CGATGATGATGACAATTCTAAAAGGCTAGCGAATAAATATGGTGATCTTG
GTGGTGAGCTTATATTATTAAATATACCAAATCCTCGTTTGTCAAATTGC
TCATTGGGTCTTAAGCTTACTGGAAATAAAGATTTGAATCATATGAATAT
ATTCATTTGTCAAATCGTACCAAATTCCATAGCAGACATTGACGGTCGAC
TGCAAGTCGGGGATGAAATCCTCGAAGTAGATGATCATATTTTATTTGGA
CGCAGTCATTTAAATGCTACCCCCGTAATCAGATCCTGCAGCGGAAAACT
GATTAAATTTGTCATTCATAGGTCTAACGAATGGCAATCAAAAATGGCTG
TCCCAATTACAATTCGATGCGCTGATGAAATTCAGTCGGTTGTAAGCTCT
AGACGAGAAAGTGTCGTTGATTGTCTGTCCGCAGTCTCAGATCAGAATAA
TTCTAGGAAGGCTTCCTCAGTGTCTTTGGGTCAAATTCCGTACATTCCAT
CGATTTCAACCGAAGAAACCCATATTGTTTATTTGACAAAGAATGCTCAA
GGACTTGGCTTTGCGATTATGGAAGGCAGTTTCACAAATGAAACTGGTAT
ATACATCAAGCATTTAGCAGTGCAAGGACCAGCAATTCAAGAAGGATCAT
TGCGCCCCGGGGATAAATTGATTAGTATTAACCATCAGGATGTTTCAAGT
GCTTCATATGATATGGTTTTGGAATTGCTCAAGAATGTCAAAAATCAAGT
TCGATTAGTTGTAGCAAGAGTAAGATGCTCGAATTCCCCATCACATTCCG
TTGGTTCTCCTATTCACAATCATTATCCTAAACGGTTATCCGCACCTCAC
ATTACAGCCTTACCGTATTATAACAGACCCAAATCACCAACGATTCAGGA
AGAAAAGTCAGAATCGAGTTCTCCTGGAATATTAATAAAATTGAGCCCAG
AATCAGAAAGCGGTCTTGCCACGTTAGCTAAGTCAATGAGTGATGGAAAT
TCGCGTCGTAGAAGCAGCGTTACAAATACACAATCACTTGATATTGTAAA
TCTCTTATTAAATAATCTAGAAGATGATGAAAAGACGGAAAATATTTATA
TTAAACGAAATGAAGATGCCTTAGGAATATCAATAATTGGAGGTTCTGAT
ACATTTATAGGCGACGTTATTGTTCATGACATATTTCCAAATGGTGCTGT
TGCAAAAGATGGAAGAATAAAAGTTGGTGATCGAATCCTTGTGATCAATG
AAATTCAACTAATAAATAAAACAAATGAGGAAATCATAACAATGCTTCAT
GAAGCAGGAGCTGAATTACATTTAAAGATACGTCATGAAGATACTCCAAT
TCCAGATCAAGACATTTATGAGGTTGTATCAACTGTTGAAATAACAAAAA
AACCTTCAAAGGGTCTCGGAATAAGTGTAATTGGAAGAGAAGGTGCCAAA
GGTGTTTATATTTGTGATGTTGTGAAAGGTGGAGTGGCAGATGTTGATGG
TCGTTTGAAACCAGGAGATCAGATATTGGAAATAAATGGTGAAGACTTTA
GAAATGAAACACAAGAGATTGCTGCAACAAGACTGAAAAGTTTAATGGGC
CAAATTGTTTTCAAAATTGGTCGAATTCAACAACTAAAACAGCATTACAC
TCCGTCATATTTGATTGCAAAGGATGACAATGACGATAACAACCGAACTC
TAGGTAAGGCTTTCTCTGCTAATGGCCATGGACATTCACCAGCACGTTCA
CCTTTGGCAAGTCCTGCTCATGCTCGGTGATAGACAATATTTTGAGAAAA
AAATACTTACACAAGGCTGTGCACATCTAGAAGTCTGAATTGACTATTTC
CTATCATCAATTAGAACCGTTTACTATGACTGCCACACGCAACACTTGTA
TAAAAAAATTAAAATTTAAAATATAAGATTTATTTATTTACTTTTTGAAA
TACAATCCTGAAATTAGATTAAAA
back to top

protein sequence of SMED30006093-orf-1

>SMED30006093-orf-1 ID=SMED30006093-orf-1|Name=SMED30006093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=805bp
MELCNKLCKKIFHNSFSGSDHNGNAEIQNIQLIHTVKMNSEFEAPKSVSM
PPVNQSNDANSVLSVSTKQNDEENILKSNEIKIELLETNESENKIIQKLE
DEERFIELEKVLMILDRSTEGNDDENSEKSNEILEKQIAEKLENSEMATE
QSPVKDVTTSANPVSSTETDIQHSEAISVKTDSNLIVNEKDDNVDDEDND
DNDYDDNDYDDDDDDDNSKRLANKYGDLGGELILLNIPNPRLSNCSLGLK
LTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLN
ATPVIRSCSGKLIKFVIHRSNEWQSKMAVPITIRCADEIQSVVSSRRESV
VDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFA
IMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDM
VLELLKNVKNQVRLVVARVRCSNSPSHSVGSPIHNHYPKRLSAPHITALP
YYNRPKSPTIQEEKSESSSPGILIKLSPESESGLATLAKSMSDGNSRRRS
SVTNTQSLDIVNLLLNNLEDDEKTENIYIKRNEDALGISIIGGSDTFIGD
VIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAE
LHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYIC
DVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFK
IGRIQQLKQHYTPSYLIAKDDNDDNNRTLGKAFSANGHGHSPARSPLASP
AHAR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016327apicolateral plasma membrane
GO:0031410cytoplasmic vesicle
GO:0043220Schmidt-Lanterman incisure
GO:0005622intracellular
GO:0005886plasma membrane
GO:0005923bicellular tight junction
GO:0012505endomembrane system
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
GO:0030425dendrite
GO:0042995cell projection
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0035556intracellular signal transduction
GO:0042552myelination
Vocabulary: molecular function
TermDefinition
GO:0008022protein C-terminus binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 131..151
NoneNo IPR availableCOILSCoilCoilcoord: 82..102
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 142..213
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 191..208
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 151..184
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 778..799
NoneNo IPR availablePANTHERPTHR19964:SF10MULTIPLE PDZ DOMAIN PROTEINcoord: 361..474
coord: 160..364
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 572..748
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 160..364
NoneNo IPR availablePANTHERPTHR19964:SF10MULTIPLE PDZ DOMAIN PROTEINcoord: 572..748
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 361..474
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 668..746
e-value: 3.89565E-19
score: 80.3034
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 575..651
e-value: 6.19911E-15
score: 68.3622
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 235..307
e-value: 2.59649E-13
score: 63.7398
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 380..462
e-value: 8.38659E-15
score: 67.977
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 677..750
e-value: 2.2E-18
score: 77.1
coord: 390..465
e-value: 8.9E-16
score: 68.4
coord: 579..654
e-value: 3.7E-14
score: 63.1
coord: 240..316
e-value: 1.4E-15
score: 67.8
IPR001478PDZ domainPFAMPF00595PDZcoord: 670..742
e-value: 1.3E-14
score: 54.3
coord: 238..307
e-value: 3.1E-10
score: 40.2
coord: 575..651
e-value: 3.7E-10
score: 40.0
coord: 388..461
e-value: 2.5E-12
score: 47.0
IPR001478PDZ domainPROSITEPS50106PDZcoord: 571..654
score: 18.335
IPR001478PDZ domainPROSITEPS50106PDZcoord: 229..315
score: 14.576
IPR001478PDZ domainPROSITEPS50106PDZcoord: 668..750
score: 19.642
IPR001478PDZ domainPROSITEPS50106PDZcoord: 382..465
score: 18.697
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 665..766
e-value: 1.1E-26
score: 94.7
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 210..317
e-value: 1.3E-19
score: 72.2
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 561..662
e-value: 4.8E-21
score: 76.7
coord: 369..472
e-value: 1.5E-22
score: 81.5
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 659..751
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 361..463
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 569..653
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 239..316