Nucleolar protein 6

Overview
NameNucleolar protein 6
Smed IDSMED30006086
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar protein 6 (SMED30006086) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar protein 6 (SMED30006086) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar protein 6 (SMED30006086) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar protein 6 (SMED30006086) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006086

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006086SMESG000071649.1 SmedASXL_014935SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006086SMESG000071649.1 SmedASXL_014935SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
head regionSMED30006086SMESG000071649.1 SMESG000055481.1 OX_Smed_1.0.08132ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar protein 6 vs. Ensembl Human
Match: NOL6 (nucleolar protein 6 [Source:HGNC Symbol;Acc:HGNC:19910])

HSP 1 Score: 92.0485 bits (227), Expect = 6.239e-19
Identity = 106/427 (24.82%), Postives = 173/427 (40.52%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLED----CKISSK---VLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSF-VNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQ---DLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CHL     E + +WP +    Q ++  + L+L+E+L +     C+ ++    VL+DG +            +  ++E  ILK ++     +  G +  + TA S  +  ++  +P      LLT        + +  L  Q    F    RL KRW   Q                             L G  F++ +++L+  ++F+HP  +     P S   GF+RFL L+S FDW + PL VN+N EL+ +   E+   F A      +LP  VI TP DR  + WT  GP+  +L  +  L+  A    E  L+  +   D+  +F      +DVLI L P  +  +      PA S  + +                S   P    D P + L  Q+R    + A+   DQ     +G+ W
Sbjct:  739 CHL-----EGSGQWPQDAEAVQRVRAAFQLRLAELLTQQHGLQCRATATHTDVLKDGFVFRIR--------VAYQREPQILKEVQ-----SPEGMISLRDTAASLRLERDTRQLP------LLT--------SALHGLQQQH-PAFSGVARLAKRWVRAQ-----------------------------LLGEGFADESLDLVAAALFLHPEPFTP---PSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAAR---AQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGP----------SSLMPVLGYDPPQLYL-TQLREAFGDLALFFYDQHGGEVIGVLW 1086          
BLAST of Nucleolar protein 6 vs. Ensembl Human
Match: NOL6 (nucleolar protein 6 [Source:HGNC Symbol;Acc:HGNC:19910])

HSP 1 Score: 83.9593 bits (206), Expect = 1.921e-16
Identity = 82/318 (25.79%), Postives = 132/318 (41.51%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLED----CKISSK---VLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLI 987
            CHL     E + +WP +    Q ++  + L+L+E+L +     C+ ++    VL+DG +            +  ++E  ILK ++     +  G +  + TA S   E      +  R+  L    L  +         Q    F    RL KRW   Q                             L G  F++ +++L+  ++F+HP  +     P S   GF+RFL L+S FDW + PL VN+N EL+ +   E+   F A      +LP  VI TP DR  + WT  GP+  +L  +  L+  A    E  L+
Sbjct:  739 CHL-----EGSGQWPQDAEAVQRVRAAFQLRLAELLTQQHGLQCRATATHTDVLKDGFVFRIR--------VAYQREPQILKEVQ-----SPEGMISLRDTAASLRLE------RDTRQLPLLTSALHGLQ--------QQHPAFSGVARLAKRWVRAQ-----------------------------LLGEGFADESLDLVAAALFLHPEPFTP---PSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAAR---AQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLM 989          
BLAST of Nucleolar protein 6 vs. Ensembl Fly
Match: Mat89Ba (gene:FBgn0261286 transcript:FBtr0083275)

HSP 1 Score: 60.077 bits (144), Expect = 3.169e-9
Identity = 70/337 (20.77%), Postives = 135/337 (40.06%), Query Frame = 1
Query:   85 NNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFV-NENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPID--RFGNHWTT-VGPNKFLLDTVKSLSKRAYLCCEHLLISQQDL-----TPIFSLDRAEFDVLIHLKPSVL 1068
            + KWP+E+   + +K  +++++ E L   C++   +  DG + +             K+ AL+ + +              +R   +++ N  S S+ +Q       H  L  ++  +  L   +   F  +  L KRW A Q                             L+   + ++A EL+V  +F        I  P++   GFIRFL+L+S  D+  +  ++N N    + +  +L   + +N   +   P   + T  D    G  WT+   P++ +L  V  L++ A    E  L+S +DL       +F      +D++I  KP ++
Sbjct:  740 SGKWPTELGALRALKTAFLIEIGEKLEAQCRLHWVMSADGLLVLKQGYCFLIELAHNKELALLKQEVT-------------ERGITTYIDNAASRSLERQ-------HYILPKVSGALHSLHQTYS-AFGSTVLLAKRWLATQ----------------------------LLDDGLWPDMATELLVAHLFQQRYAPQSIAAPQT---GFIRFLQLLSHSDFNGELFLLNFNNSWQEQQIADLEHNYRSNRQSY---PPLAVATSYDMQHAGRLWTSDQSPSQRVLGHVTRLARHALEIIETSLMS-KDLRFVRPAQLFRASNEGYDLVIQFKPDLV 1020          
BLAST of Nucleolar protein 6 vs. Ensembl Zebrafish
Match: nol6 (nucleolar protein 6 (RNA-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-6294])

HSP 1 Score: 87.0409 bits (214), Expect = 1.697e-17
Identity = 71/232 (30.60%), Postives = 109/232 (46.98%), Query Frame = 1
Query:  421 INTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLI---SQQDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPS 1107
            + + +  L  Q G  F   CRL KRW A Q +                          D+      E A +LIV S+F+HP+ +     P S   GF+RFL L+S FDW + PL+VN+NG+L+     ++   F ++      LP+  I +P D+  + WT   P+  +L     L+  +    E+ LI    +QD+  +F      +DVLIHL P  + L L K++D AP+
Sbjct:  842 LTSTLHGLQQQHG-CFGAVCRLAKRWLASQFLL------------------------EDVR-----EEAADLIVASLFLHPAPFTP---PSSPQVGFLRFLHLLSSFDWKNNPLIVNLNGKLTVADTTDIKNEFVSSRE---SLPTMFIASPNDKKVSIWTKKVPSVQMLQRAVMLAAESLRVLENQLIDSSQKQDVRVVFRPPLDAYDVLIHLIPQQVPL-LAKAVD-APA 1035          
BLAST of Nucleolar protein 6 vs. Ensembl Zebrafish
Match: nol6 (nucleolar protein 6 (RNA-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-6294])

HSP 1 Score: 87.0409 bits (214), Expect = 1.697e-17
Identity = 71/232 (30.60%), Postives = 109/232 (46.98%), Query Frame = 1
Query:  421 INTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLI---SQQDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPS 1107
            + + +  L  Q G  F   CRL KRW A Q +                          D+      E A +LIV S+F+HP+ +     P S   GF+RFL L+S FDW + PL+VN+NG+L+     ++   F ++      LP+  I +P D+  + WT   P+  +L     L+  +    E+ LI    +QD+  +F      +DVLIHL P  + L L K++D AP+
Sbjct:  842 LTSTLHGLQQQHG-CFGAVCRLAKRWLASQFLL------------------------EDVR-----EEAADLIVASLFLHPAPFTP---PSSPQVGFLRFLHLLSSFDWKNNPLIVNLNGKLTVADTTDIKNEFVSSRE---SLPTMFIASPNDKKVSIWTKKVPSVQMLQRAVMLAAESLRVLENQLIDSSQKQDVRVVFRPPLDAYDVLIHLIPQQVPL-LAKAVD-APA 1035          
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Match: ttc39b (tetratricopeptide repeat domain 39B [Source:Xenbase;Acc:XB-GENE-1016436])

HSP 1 Score: 78.9518 bits (193), Expect = 8.722e-15
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHL-LISQQDLTPIFSLDRAE--------FDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEV 1143
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL    + E+   F +      +LP   I TP D+  + WT   P      T + L +   LC E L  + QQ + P  S D           +D+LI L P  +  + +    PA S  + + +  A+V
Sbjct:  830 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGELKGPDYTEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQP------TAQILQRLIVLCLESLRALEQQLMDPSGSQDYKMTFRPPLDLYDILIRLNPKQIPRHREAVDQPAKSFFRGLLKEGAQV 1010          
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Match: ttc39b (tetratricopeptide repeat domain 39B [Source:Xenbase;Acc:XB-GENE-1016436])

HSP 1 Score: 78.5666 bits (192), Expect = 9.858e-15
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHL-LISQQDLTPIFSLDRAE--------FDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEV 1143
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL    + E+   F +      +LP   I TP D+  + WT   P      T + L +   LC E L  + QQ + P  S D           +D+LI L P  +  + +    PA S  + + +  A+V
Sbjct:  829 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGELKGPDYTEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQP------TAQILQRLIVLCLESLRALEQQLMDPSGSQDYKMTFRPPLDLYDILIRLNPKQIPRHREAVDQPAKSFFRGLLKEGAQV 1009          
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Match: ttc39b (tetratricopeptide repeat domain 39B [Source:Xenbase;Acc:XB-GENE-1016436])

HSP 1 Score: 78.5666 bits (192), Expect = 1.005e-14
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHL-LISQQDLTPIFSLDRAE--------FDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEV 1143
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL    + E+   F +      +LP   I TP D+  + WT   P      T + L +   LC E L  + QQ + P  S D           +D+LI L P  +  + +    PA S  + + +  A+V
Sbjct:  832 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGELKGPDYTEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQP------TAQILQRLIVLCLESLRALEQQLMDPSGSQDYKMTFRPPLDLYDILIRLNPKQIPRHREAVDQPAKSFFRGLLKEGAQV 1012          
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Match: ttc39b (tetratricopeptide repeat domain 39B [Source:Xenbase;Acc:XB-GENE-1016436])

HSP 1 Score: 62.3882 bits (150), Expect = 1.233e-9
Identity = 46/128 (35.94%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCE 975
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL     +E+   F +      +LP   I TP D+  + WT   P          +S    LC E
Sbjct:  820 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGEL-----KEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQP-------TAQVSASGVLCNE 929          
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Match: ttc39b (tetratricopeptide repeat domain 39B [Source:Xenbase;Acc:XB-GENE-1016436])

HSP 1 Score: 62.003 bits (149), Expect = 1.568e-9
Identity = 42/109 (38.53%), Postives = 60/109 (55.05%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPN 918
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL     +E+   F +      +LP   I TP D+  + WT   P 
Sbjct:  835 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGEL-----KEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQPT 932          
BLAST of Nucleolar protein 6 vs. Ensembl Mouse
Match: Nol6 (nucleolar protein family 6 (RNA-associated) [Source:MGI Symbol;Acc:MGI:2140151])

HSP 1 Score: 101.679 bits (252), Expect = 3.484e-22
Identity = 104/422 (24.64%), Postives = 175/422 (41.47%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-RLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHD--WLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQ---DLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CHL     E + +WP +    Q ++  + L+L+E+L ++ ++                       DV K+  + + R+    +P  +  ++     VS  +      P  LR   L  D   L  + + +  L  Q+   +    RL KRW   Q                             L G  F++ +++L+  S+F+HP  +     P+    GF+RFL L+S FDW + PL+VN+NGEL+ +    +   F A     T+LP  VI TP DR  + WT  GP+  +L  + SL+  A    E  L+  +   D+  +F      +DVLIHL P  +  +  +++DP  +   R   + AE    S   +     P+ Y        + Q+R    + A+   DQ     +G+ W
Sbjct:  745 CHL-----EGSGQWPQDAEAVQRVRAAFQLRLAEVLTQEHRLQC--------------CATATHTDVLKDGFVFRIRVAYQREPQILKEVRSPEGMVSLRD-----TPASLR---LERDTKLLPLLTSALHGLQQQY-PAYSGVARLAKRWVRAQ-----------------------------LLGEGFTDESLDLLAASLFLHPEPFTPPSVPQ---VGFLRFLYLVSTFDWKNNPLIVNLNGELTAEEQVGIRSSFLAAR---TQLPVMVIITPQDRRSSVWTQDGPSAQILQQLVSLAAEALPILEKQLMDPRGPGDIRTVFRPPFDMYDVLIHLTPRHIPRH-RQAVDPPVASFCR--GLLAEPGPSSLMPVLGYDPPQLY--------LAQLREAFEDLALFFYDQHGGEVIGVLW 1092          
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Match: sp|Q8R5K4|NOL6_MOUSE (Nucleolar protein 6 OS=Mus musculus OX=10090 GN=Nol6 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 2.437e-21
Identity = 104/422 (24.64%), Postives = 175/422 (41.47%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-RLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHD--WLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQ---DLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CHL     E + +WP +    Q ++  + L+L+E+L ++ ++                       DV K+  + + R+    +P  +  ++     VS  +      P  LR   L  D   L  + + +  L  Q+   +    RL KRW   Q                             L G  F++ +++L+  S+F+HP  +     P+    GF+RFL L+S FDW + PL+VN+NGEL+ +    +   F A     T+LP  VI TP DR  + WT  GP+  +L  + SL+  A    E  L+  +   D+  +F      +DVLIHL P  +  +  +++DP  +   R   + AE    S   +     P+ Y        + Q+R    + A+   DQ     +G+ W
Sbjct:  745 CHL-----EGSGQWPQDAEAVQRVRAAFQLRLAEVLTQEHRLQC--------------CATATHTDVLKDGFVFRIRVAYQREPQILKEVRSPEGMVSLRD-----TPASLR---LERDTKLLPLLTSALHGLQQQY-PAYSGVARLAKRWVRAQ-----------------------------LLGEGFTDESLDLLAASLFLHPEPFTPPSVPQ---VGFLRFLYLVSTFDWKNNPLIVNLNGELTAEEQVGIRSSFLAAR---TQLPVMVIITPQDRRSSVWTQDGPSAQILQQLVSLAAEALPILEKQLMDPRGPGDIRTVFRPPFDMYDVLIHLTPRHIPRH-RQAVDPPVASFCR--GLLAEPGPSSLMPVLGYDPPQLY--------LAQLREAFEDLALFFYDQHGGEVIGVLW 1092          
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Match: sp|Q6NRY2|NOL6_XENLA (Nucleolar protein 6 OS=Xenopus laevis OX=8355 GN=nol6 PE=2 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.681e-19
Identity = 94/374 (25.13%), Postives = 153/374 (40.91%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAI--QPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHL-LISQQDLTP--------IFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEV 1143
            CH+     E + KWP + +  + +K  + ++LSE+L    ++                       DV K+  +  R++ A   +P  +         + +  +   SM  ++    L H     +++ +  L  Q    F  + RL KRW   Q                             L G  FSE  ++L+V  +F+HP+ Y     P SA+ GF+RFL L++ FDW + PL+VN+NGEL    + E+   F +      +LP   I TP D+  + WT   P      T + L +   LC E L  + QQ + P        IF      +DVLI L P  +  + +    PA S  + + +  A+V
Sbjct:  738 CHM-----EGSGKWPQDKDAIKRLKAAFQIRLSELLSSQHQL--------------LCNPSATHTDVYKDGYVF-RVQVAYHREPQYMKEFVTPEGMLKY-QDTEESMQLEMETNHLPH-----LSSTLHGLHQQH-PAFGGTSRLAKRWIQSQ-----------------------------LLGDSFSEECLDLLVAHLFLHPAPYSP---PSSALVGFLRFLHLVATFDWKNSPLIVNLNGELKGSEYTEIQNDFISAR---AQLPVMFIATPKDKKDSVWTKNQP------TAQMLQRLIVLCLESLRALEQQLMDPRGNHDYKMIFRPPLDLYDVLIRLNPKQISRHREAVDQPAKSFFRGMLKEGAQV 1043          
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Match: sp|Q9H6R4|NOL6_HUMAN (Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL6 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 2.996e-18
Identity = 106/427 (24.82%), Postives = 173/427 (40.52%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLED----CKISSK---VLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSF-VNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQ---DLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CHL     E + +WP +    Q ++  + L+L+E+L +     C+ ++    VL+DG +            +  ++E  ILK ++     +  G +  + TA S  +  ++  +P      LLT        + +  L  Q    F    RL KRW   Q                             L G  F++ +++L+  ++F+HP  +     P S   GF+RFL L+S FDW + PL VN+N EL+ +   E+   F A      +LP  VI TP DR  + WT  GP+  +L  +  L+  A    E  L+  +   D+  +F      +DVLI L P  +  +      PA S  + +                S   P    D P + L  Q+R    + A+   DQ     +G+ W
Sbjct:  739 CHL-----EGSGQWPQDAEAVQRVRAAFQLRLAELLTQQHGLQCRATATHTDVLKDGFVFRIR--------VAYQREPQILKEVQ-----SPEGMISLRDTAASLRLERDTRQLP------LLT--------SALHGLQQQH-PAFSGVARLAKRWVRAQ-----------------------------LLGEGFADESLDLVAAALFLHPEPFTP---PSSPQVGFLRFLFLVSTFDWKNNPLFVNLNNELTVEEQVEIRSGFLAAR---AQLPVMVIVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPMLEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRHIPRHRQAVDSPAASFCRGLLSQPGP----------SSLMPVLGYDPPQLYL-TQLREAFGDLALFFYDQHGGEVIGVLW 1086          
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Match: sp|Q5M7P5|NOL6_XENTR (Nucleolar protein 6 OS=Xenopus tropicalis OX=8364 GN=nol6 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.010e-14
Identity = 63/193 (32.64%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  592 SDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHL-LISQQDLTPIFSLDRAE--------FDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEV 1143
            S L G  FSE  V+L+V  +F+HP+ Y     P+    GF+RFL L++ FDW + PL+VN+NGEL    + E+   F +      +LP   I TP D+  + WT   P      T + L +   LC E L  + QQ + P  S D           +D+LI L P  +  + +    PA S  + + +  A+V
Sbjct:  861 SQLLGDSFSEECVDLLVAHLFLHPAPYSPPSSPQ---VGFLRFLHLLATFDWKNSPLIVNLNGELKGPDYTEIQNDFISAR---AQLPVMFIATPKDKKDSLWTKTQP------TAQILQRLIVLCLESLRALEQQLMDPSGSQDYKMTFRPPLDLYDILIRLNPKQIPRHREAVDQPAKSFFRGLLKEGAQV 1041          
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Match: sp|B4NIM9|NOL6_DROWI (Nucleolar protein 6 OS=Drosophila willistoni OX=7260 GN=Mat89Ba PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.433e-11
Identity = 77/346 (22.25%), Postives = 141/346 (40.75%), Query Frame = 1
Query:   52 HCHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDR--FGNHWTT-VGPNKFLLDTVKSLSKRAYLCCEHLLISQ--QDLTP--IFSLDRAEFDVLIHLKPSVL 1068
            H   V +    + KWP+E+   + +K  +++++ E L E C ++  +  +G              L +K+    L  L  + +   +     +R   ++V +N  S   + R Y+L       ++  +  L  Q    +  +  + K+W A Q I+                               +S +A EL+V  ++           P++   GFIR L+LMS  DW  +  ++N N    D +  +L   F ++   +   P   + T  D+   G  WTT   PN+ +L+ V  L++ A    E  L+S+  Q L P  +F      +D++I LKP +L
Sbjct:  729 HVLRVVIQLGQSGKWPNELAALRALKTAFLIEIGEKLKEQCHLNWSLTSEGL-------------LIIKRGYCFLIELAHSKESALLKQQINERGITTYV-DNPQSRDLERRHYILP-----KVSGALHSL-HQSHSAYGPTVLIAKQWLASQLID----------------------------DGLWSPMATELLVAYLYQQRHAPFITAAPQT---GFIRLLQLMSLSDWQGELFLLNFNNSWEDQQIADLEHSFRSDRESY---PPLALATSYDQQHAGRLWTTDETPNRLVLNHVSKLARHALELIETNLMSKSLQFLRPAQLFRASNEGYDLVIQLKPELL 1020          
BLAST of Nucleolar protein 6 vs. TrEMBL
Match: A0A0R3X043 (Nucleolar protein 6 OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS6452 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.076e-25
Identity = 112/460 (24.35%), Postives = 207/460 (45.00%), Query Frame = 1
Query:   79 EANNKWPSE-INEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-----RLEPAIQPTTIGNLKRKRTAVSFVNENSHSM--PKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNG-WC-FSELAVELIVTSIFIHPSDY-------GYIG----------FPRSAVCGFIRFLKLMSEFDWCSKPLVVNIN----GELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ---QDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSID-----------PAPSDIKRISRMKAEVTRK------STNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSV--DQFQPRFVGLR 1299
            E +++WP +    F  MK+L++L++ E+L+    + S+++  G              +D+    ++L+      LE ++     G  K++    SF ++ +H    P+ +R +L+ + WL  +   +  +       F ++CRL KRWF+  G  +I   D         ++ +    D+DL    C FSE+AVEL+V    +H   +        Y               S++  F+RFL+L+  FDW +  L+V++N    G+   +R   +   F  N    TELP+ VI TP+D  G  WT  GP+   L  ++ L+ ++Y     +L++     DL  +F  D +E DV+I L+PSV    + +++D           P  +D  + +     VT +            +  WPK Y  +P+  ++  ++  ++   +     D+   R++GLR
Sbjct:  228 ETSSRWPRDNYLAFFHMKRLFLLRIKELLVY-IGVPSRIVSSGL-------------IDIFINGIVLRIGFCQPLELSLLRQFSGLNKQEGVKASFQSDQNHPTKEPEAIRRWLVFNQWLPTVAAHLVAISRSHSHTFPEACRLAKRWFSAHGYPVIQCPDLCTEPCGLDSQLVHLG-DADLGSTQCRFSEIAVELLV----VHAGGFTPAVQTQSYSACLPGATEDNFVSSSSMATFLRFLRLLYTFDWTNDILLVDLNDGFSGKDGQERAGAIVTTFKVNPR--TELPAMVIATPLDPSGTQWTLQGPSAEGLKRLQRLAMQSYELLRAMLVAGANISDLKAVFRPDLSEMDVVIKLRPSVYKTRILEAVDLEVPSWVLKKTPFTNDKSKAAPKGTVVTEEPDPVTLDLPHPGASYWPKGYLCDPVTWILRHVQAALDKWELFEYMWDRHSGRWIGLR 666          
BLAST of Nucleolar protein 6 vs. TrEMBL
Match: A0A5K3EJ11 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 4.404e-25
Identity = 120/457 (26.26%), Postives = 211/457 (46.17%), Query Frame = 1
Query:   64 VALITEANNKWPSE-INEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKR-----LEPAIQPTTIG-NLKRKRTAVSFVNENSHSMPKQ-LREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLN-GWC-FSELAVELIVTSI--FIHP---SDY--GYIG------FPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFT---ELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ---QDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSID---PA-----PSDIKRISRMKAEVTRKSTNQMQ-----SRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSV--DQFQPRFVGLRW 1302
            V L  E + KWP +    F  MK+L++L++ E+L+    + S+V+  G              LD+    ++++      LE  +   ++  N ++   A S  N+    +    L E+LL +D L  + +++  +   +   F ++CRL KRW +  G  +I   D         +   +   D+DL    C  SE+AVELI+  +  F  P   S Y  G  G         S +  F+RFL+ +  FDW  +PL++++N   S+    E +   +    + T   +LP+ V+ TP+D  G  WT+ GP    L  +++L+K +Y     +L++     DL  +F  D ++ DVLI LKP+V    L +++D   P+      SD    ++  A +   S   ++     +R WPK Y  +P+   + QI L +    +     D+   R++GLR+
Sbjct:  260 VILNLETSGKWPRDNYQAFLHMKRLFLLRIHELLIHK-GVPSRVIASGM-------------LDIFVNGIVIRTSFCQPLEQTLLSRSLAVNHQKFTKATSESNQPFFPVASDDLHEWLLFNDRLPAVTSQLVGISRSYLNSFPEACRLAKRWLSAHGFPVIQCPDPCTEPGGLTSHSFD-QGDADLGVAECRLSEIAVELIIVHVGSFTPPVRTSSYTAGLFGTNSENFASSSPLATFLRFLRFLYSFDWARQPLLIDLNEGFSEGEGREKAD-IAVTTFKVTPREDLPAMVLVTPLDLSGTDWTSRGPTVSGLKRLQTLAKHSYDLLRAMLVAGARLSDLKAVFRPDLSKMDVLITLKPAVYKTRLLEAVDIDLPSWTHKRSSDRSNGAQPSASIKEPSPVTLELPNPGARFWPKGYLCDPVTWSLRQIHLKLGRLDLFEYLWDRHSGRWIGLRF 700          
BLAST of Nucleolar protein 6 vs. TrEMBL
Match: A0A0X3PFW4 (Nucleolar protein 6 (Fragment) OS=Schistocephalus solidus OX=70667 GN=NOL6 PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.202e-25
Identity = 121/457 (26.48%), Postives = 214/457 (46.83%), Query Frame = 1
Query:   79 EANNKWPSE-INEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSM--PKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEAS-SDSDLNG-WCFSELAVELIV--TSIFIHP------------SDYGYIG----FPR-SAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSA--------NENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ---QDLTPIFSLDRAEFDVLIHLKPSV--------LDL----YLDKSIDP-APSDIKRISRMKAEVTRKSTNQMQ--SRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLR 1299
            E++ KWP + ++ F  MK+L++L+++E+L     I S+V+++G +DIF+   + R       E L+LKR         + N K+ R+    +     ++  P  L+ +LL ++ L  + +++  +      +F ++CRL KRW +  G+ ++   +              +   D+D +  +  SE+AVEL++     F  P              +G  G     P  S +  F+RFL+L+S FDW  +PLV+++N     D F E   P           N  R  +LP+ VI TP+D  G  WT  GP+   L  ++ L+KR++     +L++     DL  +F  D +E DVL+  KP V        LD+    YL K   P  P+D+  + + + E    S   +   +  WP  Y  +P++ L+ Q++    +      D+   R++GL+
Sbjct:  295 ESSGKWPRDNLDAFLHMKRLFLLRVNELLCPK-GIPSRVVDNGMLDIFLGGLVLRVSFYQPLELLLLKRAT-----GLLPNSKQARSKQESLPGTDATLRTPADLQRWLLFNERLPAVTSQLNTISRVHLNIFPEACRLAKRWLSGHGLPVVRCPELGSEPRGLPASRPPSLLGDNDFSADFRLSEIAVELMIVYAGFFTKPVRGTLHEEEEEEGPFGVGGDEAALPSASPLATFLRFLRLLSTFDWVKRPLVIDLN-----DDFIEGDGPLKVEAALKDFYNTPR-GDLPAVVIITPLDLAGTDWTQSGPSIEGLARLQLLAKRSHDLLRAMLVAGAHLADLKAVFRPDLSEMDVLLTTKPPVFQTRLLENLDVDTPTYLSKVFRPNRPADLSSLKQARKEPPPVSLEILDPGAGYWPDGYLCDPLLWLMRQLKTKFGDLFHFFWDRHSARWLGLK 739          
BLAST of Nucleolar protein 6 vs. TrEMBL
Match: A0A068Y952 (Nucleolar protein 6 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000864200 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.431e-24
Identity = 120/482 (24.90%), Postives = 219/482 (45.44%), Query Frame = 1
Query:   28 VKSPYCNLHCHLVALIT----EANNKWP-SEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRK---------RTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNG-WC-FSELAVELIVTSIFIHPSDY-----------GYIGFPR------SAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFT-----ELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ---QDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSID-PAPS--------DIKRISRMKAEVTRKSTNQMQ-------SRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSV--DQFQPRFVGL 1296
            +KS + ++H  L  L      E ++KWP  +   F  MK+L++L++ E+L+    + S+++  G              LD+    ++L+      QP  +  L+R          +T+      +S   P+ +R +L+ ++WL  + +++  +       + ++CRLVKRW +  G  +I   D         ++ +    D+DL    C  SE+AVEL+V    +H   +           G  G  R      S +  F+RFL+L+  FDW +  L+V++N        +E +   SA    F      +LP+ V+ TP+D  G HWT  GP+   L  +++L+ +++     +L++     DL  +F  D ++ DVLI L+PSV    + ++ID   PS        D K  +  K  V  K ++ +        +R WP  Y  +P+  ++ QI+  ++   +     D+   R++GL
Sbjct:  167 MKSSWHDIHHTLRPLYATINIETSSKWPRDDYRAFFHMKRLFLLRIKELLVH-IGVPSRIVSSGM-------------LDIFINGIVLR--IGFCQPLELSLLRRNCDLNERRSLKTSSQINQNDSVKEPETIRRWLVFNEWLPAVASQLMAISRSHLHTYPEACRLVKRWLSAHGYPVIQCPDPCTEPHGLDSQLVHL-GDADLGASQCRLSEIAVELLV----VHAGGFTPAVQTLSYSAGLPGATRENFVSSSPLATFLRFLRLLCVFDWTNDVLLVDLNDGFVGKEGQEKA---SAAVTTFKVTPRDKLPAMVVATPLDLSGTHWTLQGPSVEGLKRLRTLAMQSHELLRAMLVAGAELSDLKAVFRPDLSQMDVLIKLRPSVSKTRILEAIDLEVPSWALRKTSLDEKLKADPKGTVLIKESDPVTLDLPHPGARYWPTGYLCDPVTWILRQIQAKIDKWDLFEYMWDRHSGRWIGL 624          
BLAST of Nucleolar protein 6 vs. TrEMBL
Match: A0A5K3EKN7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 7.683e-24
Identity = 114/433 (26.33%), Postives = 200/433 (46.19%), Query Frame = 1
Query:   64 VALITEANNKWPSE-INEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKR-----LEPAIQPTTIG-NLKRKRTAVSFVNENSHSMPKQ-LREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLN-GWC-FSELAVELIVTSI--FIHP---SDY--GYIG------FPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFT---ELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ---QDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSID---PA-----PSDIKRISRMKAEVTRKSTNQMQ-----SRRWPKDYNDNPMVKLVNQIRL 1236
            V L  E + KWP +    F  MK+L++L++ E+L+    + S+V+  G              LD+    ++++      LE  +   ++  N ++   A S  N+    +    L E+LL +D L  + +++  +   +   F ++CRL KRW +  G  +I   D         +   +   D+DL    C  SE+AVELI+  +  F  P   S Y  G  G         S +  F+RFL+ +  FDW  +PL++++N   S+    E +   +    + T   +LP+ V+ TP+D  G  WT+ GP    L  +++L+K +Y     +L++     DL  +F  D ++ DVLI LKP+V    L +++D   P+      SD    ++  A +   S   ++     +R WPK Y  +P+   + QI +
Sbjct:  260 VILNLETSGKWPRDNYQAFLHMKRLFLLRIHELLIHK-GVPSRVIASGM-------------LDIFVNGIVIRTSFCQPLEQTLLSRSLAVNHQKFTKATSESNQPFFPVASDDLHEWLLFNDRLPAVTSQLVGISRSYLNSFPEACRLAKRWLSAHGFPVIQCPDPCTEPGGLTSHSFD-QGDADLGVAECRLSEIAVELIIVHVGSFTPPVRTSSYTAGLFGTNSENFASSSPLATFLRFLRFLYSFDWARQPLLIDLNEGFSEGEGREKAD-IAVTTFKVTPREDLPAMVLVTPLDLSGTDWTSRGPTVSGLKRLQTLAKHSYDLLRAMLVAGARLSDLKAVFRPDLSKMDVLITLKPAVYKTRLLEAVDIDLPSWTHKRSSDRSNGAQPSASIKEPSPVTLELPNPGARFWPKGYLCDPVTWSLRQIHV 676          
BLAST of Nucleolar protein 6 vs. Ensembl Cavefish
Match: nol6 (nucleolar protein 6 [Source:NCBI gene;Acc:103030742])

HSP 1 Score: 88.5817 bits (218), Expect = 4.189e-18
Identity = 100/440 (22.73%), Postives = 175/440 (39.77%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-----RLEPAIQPTTIGNLKRKRTAVSFV----NENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQ-------QDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRWIKREVDRE 1326
            CH+     E + KWP+E    + +K  + L+L E+L +    + +                   LDV K+ L+ +       EP +       L+ K T    +    N  + ++  + +        L  +  +  C    FG V    CRL KRW   Q                             L      E AV+L+V  +F+ P+ +     P S   G +RFL L+S FDW   PLVVN+NG+L+     E+   F A+      LP   I TP D   + WT  GP+  +L  + +++  +     H+L +Q        D+  +F      +DVLIHLK   + L   +++DP+P    R       +++     +       D+  +P+   ++++R    + A+   D F  + + + W  +  +++
Sbjct:  728 CHM-----EGSGKWPNERLAIRHIKAAFHLRLGELLKQQHDYTCQA--------------TPAHLDVWKDGLLFRIQVAYHREPQV-------LREKVTPEGLLIVRDNPEAQALEVETQHKPFLTSTLHGLQQQHPC----FGAV----CRLAKRWLGAQ-----------------------------LFMGEIGEDAVDLLVAFLFLQPAPFTP---PSSLQVGLLRFLHLLSSFDWRINPLVVNLNGKLTASDCTEIKNHFIASRE---SLPVMFIATPNDHKASIWTKTGPSVPVLQRMVTVAAESL----HVLEAQFAQPSQNHDIRVVFRPPLEAYDVLIHLKTKQVPLAA-QAVDPSPITFPR------GISKGEGGSLGGAFPVMDF--DPVKLYLSELRDAFGDLALFFYDPFGGKVIAVLWKPKAFEQQ 1085          
BLAST of Nucleolar protein 6 vs. Ensembl Nematostella
Match: EDO40309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H5])

HSP 1 Score: 100.138 bits (248), Expect = 2.890e-22
Identity = 60/182 (32.97%), Postives = 101/182 (55.49%), Query Frame = 1
Query:  628 VELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQ--DLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQM 1167
            VEL+V S+F+ P+    +  P SA+CGF+RFL +++  DW + P++VN N +L+ + ++E+S  FS+N      LP   I TP DRF + WT   P+  +L  V+ L++ +Y   +  L S +  DL PIF      +DV+I L   +L    D+++     D+ +  + KA   R   +++
Sbjct:  861 VELLVASLFLSPAP---LTPPHSALCGFMRFLHVLATCDWKTTPIIVNFNNDLTAENYQEISSKFSSNR---AHLPPLFISTPKDRFDSKWTRNAPSSMILQRVRVLAQESYNVMKETLESTEPPDLKPIFRPPIDGYDVIITLHSRMLP-RRDEAV-----DVDKPLKKKAHSARNKADEL 1030          
BLAST of Nucleolar protein 6 vs. Ensembl Medaka
Match: nol6 (nucleolar protein 6 [Source:NCBI gene;Acc:101162846])

HSP 1 Score: 95.1301 bits (235), Expect = 3.124e-20
Identity = 103/428 (24.07%), Postives = 169/428 (39.49%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-----RLEPAIQPTTIGNLKRKRTAVSFV----NENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLDRA---EFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CH+     E + KWP +    + ++  + ++L+E+L +    + +                   LDV KE L  +       EP +       L+   T    +    NE +  +        L    L  +     C    FG V    CRL KRW A Q                         SD        +E   +L+V S+F+ P+ +   G P+    GF+RFL L+S F+W + PL+VN+N EL+   + E+   F A+      LP   I TP D+  + WT   P   +L  V +++  +    E  L+  + L  +  + R     +DVLIHL P  + L L +++DP   +  R       VT +S  Q        DY  NP+   + ++R    + A+   D +    + + W
Sbjct:  721 CHM-----EGSGKWPHDRLAIRHIRAAFHIRLAELLKKQHNYTCRACPS--------------HLDVWKEGLAFRIQVAYHREPQV-------LRESVTPEGLLVLRDNEEAQQLEVATIHKPLLTSTLHGLQQEYSC----FGAV----CRLAKRWLAAQLF-----------------------SDD------ITEDTADLLVASLFLQPAPFTPPGSPQ---VGFLRFLHLLSSFEWRNNPLIVNLNNELTAADYTEIKNGFMASRE---SLPVMFIATPKDKKSSMWTKRAPTVQMLQRVMTVAAESLKVLERQLMDGKQLQDVRVVMRPPLDAYDVLIHLNPKQVPL-LSQAVDPPSVNFSR------GVTAQSAAQSGGSLPVIDY--NPVFLYLLELREAFGDLALFFCDPYGGTVIAVLW 1070          
BLAST of Nucleolar protein 6 vs. Ensembl Medaka
Match: nol6 (nucleolar protein 6 [Source:NCBI gene;Acc:101162846])

HSP 1 Score: 95.1301 bits (235), Expect = 3.454e-20
Identity = 103/428 (24.07%), Postives = 169/428 (39.49%), Query Frame = 1
Query:   55 CHLVALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILK-----RLEPAIQPTTIGNLKRKRTAVSFV----NENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLDRA---EFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRW 1302
            CH+     E + KWP +    + ++  + ++L+E+L +    + +                   LDV KE L  +       EP +       L+   T    +    NE +  +        L    L  +     C    FG V    CRL KRW A Q                         SD        +E   +L+V S+F+ P+ +   G P+    GF+RFL L+S F+W + PL+VN+N EL+   + E+   F A+      LP   I TP D+  + WT   P   +L  V +++  +    E  L+  + L  +  + R     +DVLIHL P  + L L +++DP   +  R       VT +S  Q        DY  NP+   + ++R    + A+   D +    + + W
Sbjct:  728 CHM-----EGSGKWPHDRLAIRHIRAAFHIRLAELLKKQHNYTCRACPS--------------HLDVWKEGLAFRIQVAYHREPQV-------LRESVTPEGLLVLRDNEEAQQLEVATIHKPLLTSTLHGLQQEYSC----FGAV----CRLAKRWLAAQLF-----------------------SDD------ITEDTADLLVASLFLQPAPFTPPGSPQ---VGFLRFLHLLSSFEWRNNPLIVNLNNELTAADYTEIKNGFMASRE---SLPVMFIATPKDKKSSMWTKRAPTVQMLQRVMTVAAESLKVLERQLMDGKQLQDVRVVMRPPLDAYDVLIHLNPKQVPL-LSQAVDPPSVNFSR------GVTAQSAAQSGGSLPVIDY--NPVFLYLLELREAFGDLALFFCDPYGGTVIAVLW 1077          
BLAST of Nucleolar protein 6 vs. Planmine SMEST
Match: SMESG000071649.1 (SMESG000071649.1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 442/442 (100.00%), Postives = 442/442 (100.00%), Query Frame = 1
Query:   64 VALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGXXXXXXXXXXXXXXLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIAXXXXXXXXXXXXXXXIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRWIKREVDREFLLKCIATEGQNFVDKFEIIE 1389
            VALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGKIDIFIRKFIFRCFLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIADDDDRLSSDSCLNRDIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRWIKREVDREFLLKCIATEGQNFVDKFEIIE
Sbjct:  112 VALITEANNKWPSEINEFQLMKKLYILKLSEILLEDCKISSKVLEDGKIDIFIRKFIFRCFLDVKKEALILKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDINTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIADDDDRLSSDSCLNRDIEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFLKLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRTPIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLDRAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQSRRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRWIKREVDREFLLKCIATEGQNFVDKFEIIE 553          
The following BLAST results are available for this feature:
BLAST of Nucleolar protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NOL66.239e-1924.82nucleolar protein 6 [Source:HGNC Symbol;Acc:HGNC:1... [more]
NOL61.921e-1625.79nucleolar protein 6 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mat89Ba3.169e-920.77gene:FBgn0261286 transcript:FBtr0083275[more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol61.697e-1730.60nucleolar protein 6 (RNA-associated) [Source:ZFIN;... [more]
nol61.697e-1730.60nucleolar protein 6 (RNA-associated) [Source:ZFIN;... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc39b8.722e-1532.64tetratricopeptide repeat domain 39B [Source:Xenbas... [more]
ttc39b9.858e-1532.64tetratricopeptide repeat domain 39B [Source:Xenbas... [more]
ttc39b1.005e-1432.64tetratricopeptide repeat domain 39B [Source:Xenbas... [more]
ttc39b1.233e-935.94tetratricopeptide repeat domain 39B [Source:Xenbas... [more]
ttc39b1.568e-938.53tetratricopeptide repeat domain 39B [Source:Xenbas... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nol63.484e-2224.64nucleolar protein family 6 (RNA-associated) [Sourc... [more]
back to top
BLAST of Nucleolar protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R5K4|NOL6_MOUSE2.437e-2124.64Nucleolar protein 6 OS=Mus musculus OX=10090 GN=No... [more]
sp|Q6NRY2|NOL6_XENLA1.681e-1925.13Nucleolar protein 6 OS=Xenopus laevis OX=8355 GN=n... [more]
sp|Q9H6R4|NOL6_HUMAN2.996e-1824.82Nucleolar protein 6 OS=Homo sapiens OX=9606 GN=NOL... [more]
sp|Q5M7P5|NOL6_XENTR5.010e-1432.64Nucleolar protein 6 OS=Xenopus tropicalis OX=8364 ... [more]
sp|B4NIM9|NOL6_DROWI2.433e-1122.25Nucleolar protein 6 OS=Drosophila willistoni OX=72... [more]
back to top
BLAST of Nucleolar protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3X0433.076e-2524.35Nucleolar protein 6 OS=Hydatigena taeniaeformis OX... [more]
A0A5K3EJ114.404e-2526.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PFW47.202e-2526.48Nucleolar protein 6 (Fragment) OS=Schistocephalus ... [more]
A0A068Y9522.431e-2424.90Nucleolar protein 6 OS=Echinococcus multilocularis... [more]
A0A5K3EKN77.683e-2426.33Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nol64.189e-1822.73nucleolar protein 6 [Source:NCBI gene;Acc:10303074... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403092.890e-2232.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleolar protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol63.124e-2024.07nucleolar protein 6 [Source:NCBI gene;Acc:10116284... [more]
nol63.454e-2024.07nucleolar protein 6 [Source:NCBI gene;Acc:10116284... [more]
back to top
BLAST of Nucleolar protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000071649.10.000e+0100.00SMESG000071649.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006086 ID=SMED30006086|Name=Nucleolar protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
CCAGATTAATAAAGTCTATTCCGGTAAGTAAAATCGCCGTATTGCAATTT
ACATTGCCATTTAGTTGCCCTTATCACCGAAGCCAACAACAAATGGCCAT
CCGAAATCAATGAATTCCAATTGATGAAGAAATTGTACATATTAAAACTG
TCTGAAATCCTATTAGAAGATTGCAAAATCTCATCGAAAGTTCTCGAGGA
TGGAAAAATCGATATTTTCATAAGGAAATTCATTTTCCGATGCTTTCTCG
ACGTGAAAAAGGAAGCTCTGATATTAAAACGCCTCGAACCGGCGATCCAG
CCGACAACAATTGGGAATTTGAAACGTAAACGCACAGCTGTGAGTTTTGT
GAATGAAAATTCCCACTCGATGCCAAAACAGTTGCGAGAGTATTTGCTGA
CTCATGATTGGCTGATGGATATAAATACACGCATTCGGTGTTTGTGTGCG
CAATTCGGTCAGGTTTTCATTGACAGCTGCCGATTGGTTAAGCGCTGGTT
TGCGTGCCAGGGGATTGAGCTGATTGCCGACGATGACGATCGATTGAGTA
GTGATTCGTGTCTCAATCGCGACATCGAAGCCTCATCCGATAGCGATTTA
AACGGCTGGTGTTTCTCTGAGTTGGCGGTCGAATTGATTGTTACCAGCAT
ATTTATCCATCCGTCAGATTATGGATATATCGGGTTTCCCAGATCTGCCG
TTTGTGGATTCATTCGATTTCTGAAACTGATGTCGGAATTTGATTGGTGC
TCGAAACCGCTCGTTGTCAATATCAACGGGGAATTGTCCGATGATCGGTT
TGAGGAATTATCGAAACCGTTTAGCGCAAACGAGAACCGATTCACCGAGT
TGCCGAGTGCCGTTATTCGAACCCCGATTGACAGATTCGGCAATCACTGG
ACAACAGTCGGACCAAATAAGTTTCTATTGGATACGGTGAAATCGCTCTC
GAAACGAGCGTATCTGTGTTGCGAGCATTTATTGATTTCCCAGCAGGATT
TAACTCCGATTTTCTCATTGGATAGAGCGGAATTCGATGTTTTAATCCAT
TTGAAACCGTCGGTGCTCGATTTGTACCTGGACAAATCGATCGATCCCGC
CCCATCGGACATCAAGCGGATCAGCAGGATGAAAGCGGAAGTCACGCGGA
AATCCACCAATCAGATGCAATCCAGGCGATGGCCGAAGGATTACAATGAT
AATCCTATGGTAAAGCTGGTCAATCAGATTCGGCTGATCGTCAACAATGA
AGCCGTTTGCTCGGTCGATCAGTTCCAGCCGAGATTTGTCGGATTGAGAT
GGATAAAACGGGAGGTCGACAGGGAATTCCTACTCAAATGCATCGCTACC
GAGGGCCAGAATTTCGTTGACAAGTTCGAAATTATTGAATGAATCAGGAA
ATCCCTTGAAATTGATTTTATGAAAGAAATGTATAAATTTTATGTAAAAT
TGATTTTTATTGAC
back to top

protein sequence of SMED30006086-orf-1

>SMED30006086-orf-1 ID=SMED30006086-orf-1|Name=SMED30006086-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=423bp
MKKLYILKLSEILLEDCKISSKVLEDGKIDIFIRKFIFRCFLDVKKEALI
LKRLEPAIQPTTIGNLKRKRTAVSFVNENSHSMPKQLREYLLTHDWLMDI
NTRIRCLCAQFGQVFIDSCRLVKRWFACQGIELIADDDDRLSSDSCLNRD
IEASSDSDLNGWCFSELAVELIVTSIFIHPSDYGYIGFPRSAVCGFIRFL
KLMSEFDWCSKPLVVNINGELSDDRFEELSKPFSANENRFTELPSAVIRT
PIDRFGNHWTTVGPNKFLLDTVKSLSKRAYLCCEHLLISQQDLTPIFSLD
RAEFDVLIHLKPSVLDLYLDKSIDPAPSDIKRISRMKAEVTRKSTNQMQS
RRWPKDYNDNPMVKLVNQIRLIVNNEAVCSVDQFQPRFVGLRWIKREVDR
EFLLKCIATEGQNFVDKFEIIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035370Nrap_D5
IPR005554NOL6/Upt22
Vocabulary: cellular component
TermDefinition
GO:0000794condensed nuclear chromosome
GO:0005634nucleus
GO:0005694chromosome
GO:0005730nucleolus
GO:0005739mitochondrion
GO:0032040small-subunit processome
GO:0032545CURI complex
GO:0034456UTP-C complex
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0006409tRNA export from nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR035370Nrap protein, domain 5PFAMPF17406Nrap_D5coord: 163..297
e-value: 1.7E-21
score: 76.7
IPR005554NOL6/Upt22PANTHERPTHR17972NUCLEOLAR RNA-ASSOCIATED PROTEINcoord: 1..397