Abnormal spindle-like microcephaly-associated protein homolog

Overview
NameAbnormal spindle-like microcephaly-associated protein homolog
Smed IDSMED30006065
Length (bp)7397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Abnormal spindle-like microcephaly-associated protein homolog (SMED30006065) t-SNE clustered cells

Violin plots show distribution of expression levels for Abnormal spindle-like microcephaly-associated protein homolog (SMED30006065) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Abnormal spindle-like microcephaly-associated protein homolog (SMED30006065) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Abnormal spindle-like microcephaly-associated protein homolog (SMED30006065) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006065

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006065 SmedASXL_038678SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_038679SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_052056SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_012873SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_079453SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_002298SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006065 SmedASXL_052055SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30006065 dd_Smed_v4_15726_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30006065 dd_Smed_v6_15726_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30006065 SMED30006065smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30006065 SMED30006065smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30006065 SMED30006065smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30006065 dd_Smed_v4_15726_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006065 SMED30006065smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30006065 SMED_23948_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006065 SMED_23948_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Match: ASPM (abnormal spindle microtubule assembly [Source:HGNC Symbol;Acc:HGNC:19048])

HSP 1 Score: 568.54 bits (1464), Expect = 1.864e-163
Identity = 594/2185 (27.19%), Postives = 1011/2185 (46.27%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQK----YIRGFINRRNFLKFKSAVNILEHYF------------------MGYLRRKQ----FLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRY-FAKKEFVA---KKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQK-HTKGFLVXXXXXXXXXXXXXC---QSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQC----RQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKE--KKQIILNNQAATVVQKYFKSY----ICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKK----YLSYRHSV-----------------------IVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRK---IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF---------ICQKNAAIK------------------LQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF---NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHF---RKYLIIRRIDLEQK-AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRN----RFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY----ICISKFKMIKSATLIIQKHIRGIFVRLKYK---------KIIKLVVFIQKNIRANIVRTRFL---NIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFL----IRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVL-----------KRSAVVIQR 6351
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +    +      +SL  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF V+NL+ D+  GVRL R  ++L  N D+  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   I+Q  V  FL  ++ +      ++ Q   +R LA+ ++             K+A LIQ  +RRY  R R+ K+K  +++LQS  R  +   +Y +   + + IQ + R YL R      Y+ ++ ST IIQ   + +  R K     KA V++Q AFR +  R+    +  +A+IIQS+YR     R Y+ +R  V+IIQK       ++  ++R  S + IQK    Y++G I R N+L+ ++A   L+  F                    Y R +Q    FL ++ ++I  Q ++R    R  +   +K+A+IIQ  F+ Y FA K   +    +SA I++Q+  R +  R+ + ++  + I IQ  +R Y  +K+FL    + I +Q  V+    +K YL ++ + L IQ+ +    +  +  ++ +     C   Q+ VR YL++KQ    RK+ I +Q +FR   AR+ +L   K  IV+Q Y   ++     R+ FL++K     +Q   R    R+   +   A + IQ  FR   +  K Q +L  Q+   +Q+++++Y      +  F K K +V  +Q   R    RKQ ++E +  + +QS  RM   +K+++    A L I +  + + A +K    Y+  RH+V                       I+IQ+ +R  + +K +  +K +A++IQKY R + I R+   +Y     A+  +Q   RG  VRK +   +++A  IQ  YR+YK +K +   R +AI+IQ+ +R     ++  ++Y   +K  I IQS+ R     +  + M +AAT+I+ + K +  R  Y T R++A++IQ   R Y   K                   + R  Y   L A  ++Q   RG  VR+ +   Q A  +IQ+ YR +  +++F         + Q+  A+K                  +Q   RG   R++         L+Q   +  + R+ +  L+ ++I++Q+ +R       H +FL+++NA I IQ + RR+   K  R+   A+  IQ   R     ++YQ    A++++Q+ +   R   + R+  L Q+ +A I+Q  +RG   R H     +S   IQ+ F++ L+R++++ +++ TIF+Q   R  I       +FL L+ + I IQ   R     +K  + ++A + IQ  FR +    TFQ  K+ASI+IQ+++R Y   +  K +R+N      YIR++    +  + +K +K+  L+ +KH   I ++  Y+         K+      IQ+  RAN  + +      +KK       F  M+ + K  Q   Q+  +IQK+C+ F  RK +L +++ ++ IQ+ +R+  A R+       +I +QS  RG   +   Q M  A  LIQ   + +  +  Y+  + +++ +Q + R ++     RK FL ++ +   I    RG+ VR       Q +K  ++E +     A+I  Q+   CY  K +Y  ++S  ++IQ+ ++   L            R+AV IQ+
Sbjct:  692 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGEL--ISLEDNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKTDLKRH-QEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQR-KMQSQVKATVILQRAFREWHLRKQ-AKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRCFQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVL--QSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGK-------------------MQREKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTY---RAAKLQREN------YIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIK-KQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVR-------QKLKNVSEEKM-----AAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQK 2823          

HSP 2 Score: 380.563 bits (976), Expect = 4.010e-105
Identity = 501/1967 (25.47%), Postives = 886/1967 (45.04%), Query Frame = 1
Query: 2014 RAASCIQRVWR----KYRTFYLYKT--HFIAHY-------------KEVIIVQSIVRRFL----CLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIR----GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVV--HKV--LFKR-------------------KLEKRLRSCIIIQKYIRGF----INRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKK----EFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVR--SIICQKN--YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQK-----------------------YIKMHQCRQKFLKLKSQVITIQKNIRAL----LQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKE-SVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRH-SVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS----QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQF---------RKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGY----LIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR----------------RYCQMKLYRDT---------RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR----------------RIDLE--QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRR--------------------------YISRNRFLRLKMSVIIIQKVTRGYF----THRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL-----VVFIQKNIRANIVRTRFLNIKKSII----------------------NIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFL-AKRSYQRNLSI-----IIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY----------------CLLK--SYTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSV-SKYRQQLSSRCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNSLQENNLS 7125
            RAA  IQ  WR    + R   L KT   F AH              K  +I+Q+  R ++     L  ++  +  +I+ QS  +   AR     +  S I IQ  YR Y+ +  +  +K+AT+ LQS  +    +K YL +  + L IQ   R        R  Y ++R+S   +Q +V+GYL RK+     KA++ +QS FR    R+ Y    KA ++IQ++Y +       R+ +L ++K+   +Q     +KV  L K+                   K +  L+S I IQ++ R +      R +FLK K+AV  L+  + G+  RKQ  +   + + +Q   RM   +  F + + +A++IQ++F+ + A +    E++  + A +++Q+  +    RR+ Q     AIIIQ  +R +  +KK+ I   +A++IQK  R  SI  ++N  YLK K +V+ +Q   +G  V+K  K      +  QS  R Y  +K+Y   R S IIIQ+ +R I       K++LN +K  I +Q                          KMHQ R  +  ++   I IQ   RA     +QR +Y+   KAV  +Q  FR  + ++ +     AAT++Q  ++ Y  +  F K+K+ + TV Q+Y        QFQ                    RY K   + + I    +G  AR ++L   H +  +IQ  FR  M R+ FLS+K +AI+IQ+  R  +  K +      Q   IK IQ + R +++RK +   H++AT IQ  +R +++   +   + A++VIQ+Q+         R+HY+RQ     R   + +Q+  R     +  K M  +AT IQ   +  ++R+++++ +++ + +Q+  R  +                   +  L + ++ RK  AA  IQ   R  +V+K++   Q+A  +IQ  +R +     F   K+A+I +Q++ R Y    L R+N+    +  +++Q+  KG  AR+  ++   +SI++Q  +R +  +  + KL+ A+  IQ+  R                  C    ++D            A+I+IQK+ + F  R  Y       + +QR +RK   +R                R D++   +AA +IQ+FYR +  +  +  +K + V IQNY++ Y+     RK +L +++    IQ   R                           Y S+ ++  ++   ++IQ+  +          +Y  Q +A + IQK F R    K  +  K A++ IQ   +  + R+ F ++++  + +Q Y R +    +F + + A +++Q H R  F+  K+++ + L     V+ IQ   +  I + +F  IK S I                       IQ++YR    +K Y  + +++ +IQ      + R RFL ++++ IIIQ+ +R  L AK +++  L I        +Q+  RG   +  + + ++A ++IQK ++     KH +I     +KS + LQ  +RG+L+RK FL+ +    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++R+                CL +      +IQ+  R  +L++      S ++ IQ +WRG   R   +  K    I  IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR +  +EV+   + V  N+ K       V   E  I ++  LL  YR    +K   KG +IF  TC LL +L+K      +N    +   S + D + S Y+  L++    +     N+++IL + + N S  +   F P +  +  + ++L     L+ +N+ 
Sbjct: 1561 RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQREKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQ--------------------RYNKLRHSVIYIQAIFRGKKAR-RHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIK-IQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQ-----RHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATIC-----------------AKHKLYQFLHLRK--AAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAAKLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKNVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFCRMVTRK-LETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRA-FLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTK----IKAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNKVADKGGSIFTKTCCLLAILLK-----TTNRASDVRSRSKVVDRIYSLYK--LTAHKHKM-----NTERILYKQKKNSSISIP--FIPETPVRTRIVSRLKPDWVLRRDNME 3457          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Match: ASPM (abnormal spindle microtubule assembly [Source:HGNC Symbol;Acc:HGNC:19048])

HSP 1 Score: 271.937 bits (694), Expect = 1.647e-73
Identity = 256/903 (28.35%), Postives = 411/903 (45.51%), Query Frame = 1
Query:  712 ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKM---------KKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK------KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLF-KRKLEKRLR--------------SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQ-KNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKK 3114
            A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +    +      +SL  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF V+NL+ D+  GVRL R  ++L  N D+  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   I+Q  V  FL  ++ +      ++ Q   +R LA+ ++  +          K+A LIQ  +RRY  +    K+K+A  + Q+ +R +   K YL I +++ IIQ      L R+ +  +R S  IIQ+  +  L  K        +K  +A  +IQ+ +RGY  R+ +  Q  AA+IIQ + R+       R  Y+  +KS +I+Q +V   L  KR LE+R +              + + IQ+  + ++  +N  K  ++V  ++ +F   L+ K+F++  +S+  ++ +    LS RN                              A  +IQ  VR  + R+K +   +  I IQ  +R YS RKK
Sbjct:   19 ACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGE--LISLEDNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKTDLKRH-QEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKKYLCKVKAACKI-QAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRN-----------------------------RAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 888          

HSP 2 Score: 102.064 bits (253), Expect = 9.495e-21
Identity = 145/560 (25.89%), Postives = 255/560 (45.54%), Query Frame = 1
Query: 5329 KQKKAVINIQKNFRRF---SELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFL-AKRSYQRNLSI-----IIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY----------------CLLK--SYTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            K+ +A   IQ  +R++   ++LK  Q  + A+ IIQ     ++ ++  +K+    + IQ Y RR +   K  M+K   L   ++           K   L+  + +  RA     ++L   K+   IQ++YR    +K Y  + +++ +IQ      + R RFL ++++ IIIQ+ +R  L AK +++  L I        +Q+  RG   +  + + ++A ++IQK ++     KH +I     +KS + LQ  +RG+L+RK FL+ +    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++R+                CL +      +IQ+  R  +L++      S ++ IQ +WRG   R     K    +I  IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR +  +EV+   + V  N+ K       V   E  I ++  LL  YR    +K   KG +IF  TC LL +L+K   ++
Sbjct:  515 KEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQN-----------KAASLIQAMWRRYRAK----KYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWR----KKNDCTKIKAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNKVADKGGSIFTKTCCLLAILLKTTNRA 1051          

HSP 3 Score: 100.523 bits (249), Expect = 3.320e-20
Identity = 111/452 (24.56%), Postives = 204/452 (45.13%), Query Frame = 1
Query: 3511 LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK---------EMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKK 4839
            LL  R+ I+  + +    RK++   + K+     +AA ++Q    +++ K++ RK   +  VIQKY RR++ +++            + K   L+Q+  R    KK Y  K+ A   I  + + + A K+YL+   +V +IQ  F   + R  FL+++ SAI+IQ+  R  +  KI       IK                  H++A LIQ  YR YK R+ F+ +++AA++IQK     YIR +     +++              KY + KK+   +Q + +G+++RK+++ QR    ++                             F   + Y    L A  IQ+  + YL  K    +  +V  IQ ++RA      FI + ++  K++   +  L ++N   +     ++Q  ++ F+ RK  +K  S  I +Q ++RG++  KK
Sbjct:  510 LLDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIK-----------------RHRAACLIQAHYRGYKGRQVFLRQKSAALIIQK-----YIRAREAGKHERI--------------KYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLH----------------------------FTAAAYYH---LNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAAS-----VIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 888          

HSP 4 Score: 94.7449 bits (234), Expect = 2.109e-18
Identity = 110/406 (27.09%), Postives = 191/406 (47.04%), Query Frame = 1
Query: 4858 ASICIQKNVRRY---CQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRID---------LEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFT------HRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVR---LKYKKIIKLVVFIQKN-IRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRK 6009
            A+  IQ   R+Y     +K +++   A+ +IQ  V  FL + + ++++ AA+++Q+++R+ L  R++          ++ KAA +IQ  +R Y  +  +LC+  +   IQ +++ +   K+YL I +    IQ      + R RFL ++ S IIIQ+  R          H   +K+ +A   IQ ++R +   + F   K+A++IIQK    YI  +E  K  +                K+   K +T+I+Q  +RG  VR   L+ +  I+L+ F        N VR            IQ  Y+++   KN      S+  IQ+  R  +  KRF++   +I  I+   +  L++R+  R  S+I   Q  VR  L + K +K  +  I IQ   +GY  RK
Sbjct:  519 AARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQK----YIRAREAGKHER---------------IKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVR------------IQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRN--RAASVI---QKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRK 887          

HSP 5 Score: 79.337 bits (194), Expect = 8.708e-14
Identity = 117/416 (28.12%), Postives = 186/416 (44.71%), Query Frame = 1
Query: 3064 AAIIIQKTFRCYSVR---KKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVX---------XXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQK--YIKMHQCRQKFLKLKSQVITIQKNIRALLQRR------RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFR----KMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI-ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTT------AIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ 4218
            AA +IQ T+R Y ++   K+   +  +A +IQ  V + + ++   K   + LVIQK+ +  L +         K  K       + Q++ R+Y  +K   KV K+   IQ  +R   A K++L   K   ++Q   Y K+   R +FL +++  I IQ+  RA+L  +        IK  +A   IQ  +R  K ++  +    AA ++QKY ++    K  R    + K+S  ++Q   R  + RK+F ++       ++KIR++  T   Y    A  + I +  K Y A K      +SVI IQ  FR  +  K F         IQKY    IK+  +  Q        A  VIQK +R FL+RK           IQ  +R Y  RK   C +  AI +  Q     IR++
Sbjct:  519 AARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKKYLCKV-KAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLE--RTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQ-------RAKIRLLHFTAAAYYHLNA--VRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRF---------IQKY--HSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVNREIREE 911          

HSP 6 Score: 78.1814 bits (191), Expect = 1.959e-13
Identity = 115/402 (28.61%), Postives = 174/402 (43.28%), Query Frame = 1
Query: 4030 AIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFI---------CKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSH----FICQKNAAIKLQKNIRGYLIRKNFTETRNKIIL---------------VQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQ 5151
            A ++IQ  +  FL ++ L     +A +IQ ++R    ++  +          +  AA +IQ  +R+ Y  ++Y    K    IQ+  R + A ++Y  + KA   IQ      + R +++  R SA+IIQ+  R  L  K                  FLM   ++    AA LIQ   RGY  R+  + ++ A  IIQ + RA     H    +I  K + + LQ  +RG+L+RK F E R KI L               +Q   K ++A K   K  +S I +Q+ FR     K+F++ K  SI   K +    Q  L +  R AS VIQK VR FL R K Q +  + II                       IQ  +RGY+ R     +KN C  I+
Sbjct:  545 AARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRR-YRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAH-------------EHFLMIKRHR----AACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQ-KYHSI---KKIEHEGQECLSQRNRAAS-VIQKAVRHFLLR-KKQEKFTSGIIK----------------------IQALWRGYSWR-----KKNDCTKIK 895          

HSP 7 Score: 67.781 bits (164), Expect = 2.762e-10
Identity = 109/416 (26.20%), Postives = 190/416 (45.67%), Query Frame = 1
Query: 2572 QIKAAVIIQSFYRSSVCR---RTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSI----ICQKNYLKIK--QSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQ----YLKVRKSTIIIQKHFRAISARKQFLNFRK------FT---------IVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQ 3735
            +I+AA +IQ+ +R    +   + +    K+  IIQ  V   L K++L KR+ + ++IQKY R                                      +L Q+ L ML       ++ K+A +IQ  ++RY AKK ++ K  A   IQ   R     +++  +  A  IIQ  F     R +FL    SAI+IQ+  R+I    I  +++L IK  ++  +IQ H +G+  ++ + +     +I Q  +R     K     Y++ +KST+I+Q   R    RK+FL  R       FT         + +Q+  K++   +   K  + VI IQ+  RA LQ +R+I+   ++  I+ + + C  ++     N+AA+V+QK  + ++ +K+  K    +  IQ   R    RK+
Sbjct:  516 EIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRR-------------------------------------VLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQR-----NRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 888          

HSP 8 Score: 60.077 bits (144), Expect = 6.325e-8
Identity = 51/169 (30.18%), Postives = 87/169 (51.48%), Query Frame = 1
Query: 2080 FIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYA-KRRNYTIQIKA 2583
            +I   K  +I+Q++VR +L  K+F   + +I +       Y           +A+ IQ+ Y+ YL      K  ++ + +Q  FR  L +K +++ Y SI  I++   G  C S   R   +  +IQK V+ +L RKK  K T  I+ IQ+ +RGY+ +++N   +IKA
Sbjct:  741 YIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAY--------YHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHE--GQECLSQRNR---AASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKA 896          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Match: ASPM (abnormal spindle microtubule assembly [Source:HGNC Symbol;Acc:HGNC:19048])

HSP 1 Score: 269.626 bits (688), Expect = 1.141e-71
Identity = 270/980 (27.55%), Postives = 430/980 (43.88%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK------KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLF-KRKLEKRLR--------------SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQ-KNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKK 3114
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +    +      +SL  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF V+NL+ D+  GVRL R  ++L  N D+  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   I+Q  V  FL  ++ +      ++ Q   +R LA+ ++             K+A LIQ  +RRY  +    K+K+A  + Q+ +R +   K YL I +++ IIQ      L R+ +  +R S  IIQ+  +  L  K        +K  +A  +IQ+ +RGY  R+ +  Q  AA+IIQ + R+       R  Y+  +KS +I+Q +V   L  KR LE+R +              + + IQ+  + ++  +N  K  ++V  ++ +F   L+ K+F++  +S+  ++ +    LS RN                              A  +IQ  VR  + R+K +   +  I IQ  +R YS RKK
Sbjct:  692 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGE--LISLEDNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKTDLKRH-QEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKKYLCKVKAACKI-QAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRN-----------------------------RAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 1638          

HSP 2 Score: 102.449 bits (254), Expect = 1.126e-20
Identity = 145/560 (25.89%), Postives = 255/560 (45.54%), Query Frame = 1
Query: 5329 KQKKAVINIQKNFRRF---SELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFL-AKRSYQRNLSI-----IIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY----------------CLLK--SYTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            K+ +A   IQ  +R++   ++LK  Q  + A+ IIQ     ++ ++  +K+    + IQ Y RR +   K  M+K   L   ++           K   L+  + +  RA     ++L   K+   IQ++YR    +K Y  + +++ +IQ      + R RFL ++++ IIIQ+ +R  L AK +++  L I        +Q+  RG   +  + + ++A ++IQK ++     KH +I     +KS + LQ  +RG+L+RK FL+ +    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++R+                CL +      +IQ+  R  +L++      S ++ IQ +WRG   R     K    +I  IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR +  +EV+   + V  N+ K       V   E  I ++  LL  YR    +K   KG +IF  TC LL +L+K   ++
Sbjct: 1265 KEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQN-----------KAASLIQAMWRRYRAK----KYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWR----KKNDCTKIKAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNKVADKGGSIFTKTCCLLAILLKTTNRA 1801          

HSP 3 Score: 101.293 bits (251), Expect = 2.525e-20
Identity = 111/452 (24.56%), Postives = 204/452 (45.13%), Query Frame = 1
Query: 3511 LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK---------EMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKK 4839
            LL  R+ I+  + +    RK++   + K+     +AA ++Q    +++ K++ RK   +  VIQKY RR++ +++            + K   L+Q+  R    KK Y  K+ A   I  + + + A K+YL+   +V +IQ  F   + R  FL+++ SAI+IQ+  R  +  KI       IK                  H++A LIQ  YR YK R+ F+ +++AA++IQK     YIR +     +++              KY + KK+   +Q + +G+++RK+++ QR    ++                             F   + Y    L A  IQ+  + YL  K    +  +V  IQ ++RA      FI + ++  K++   +  L ++N   +     ++Q  ++ F+ RK  +K  S  I +Q ++RG++  KK
Sbjct: 1260 LLDLRKEIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIK-----------------RHRAACLIQAHYRGYKGRQVFLRQKSAALIIQK-----YIRAREAGKHERI--------------KYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLH----------------------------FTAAAYYH---LNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAAS-----VIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 1638          

HSP 4 Score: 96.6709 bits (239), Expect = 5.398e-19
Identity = 110/406 (27.09%), Postives = 191/406 (47.04%), Query Frame = 1
Query: 4858 ASICIQKNVRRY---CQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRID---------LEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFT------HRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVR---LKYKKIIKLVVFIQKN-IRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRK 6009
            A+  IQ   R+Y     +K +++   A+ +IQ  V  FL + + ++++ AA+++Q+++R+ L  R++          ++ KAA +IQ  +R Y  +  +LC+  +   IQ +++ +   K+YL I +    IQ      + R RFL ++ S IIIQ+  R          H   +K+ +A   IQ ++R +   + F   K+A++IIQK    YI  +E  K  +                K+   K +T+I+Q  +RG  VR   L+ +  I+L+ F        N VR            IQ  Y+++   KN      S+  IQ+  R  +  KRF++   +I  I+   +  L++R+  R  S+I   Q  VR  L + K +K  +  I IQ   +GY  RK
Sbjct: 1269 AARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQK----YIRAREAGKHER---------------IKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVR------------IQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRN--RAASVI---QKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRK 1637          

HSP 5 Score: 80.1073 bits (196), Expect = 5.594e-14
Identity = 117/416 (28.12%), Postives = 186/416 (44.71%), Query Frame = 1
Query: 3064 AAIIIQKTFRCYSVR---KKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVX---------XXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQK--YIKMHQCRQKFLKLKSQVITIQKNIRALLQRR------RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFR----KMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI-ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTT------AIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ 4218
            AA +IQ T+R Y ++   K+   +  +A +IQ  V + + ++   K   + LVIQK+ +  L +         K  K       + Q++ R+Y  +K   KV K+   IQ  +R   A K++L   K   ++Q   Y K+   R +FL +++  I IQ+  RA+L  +        IK  +A   IQ  +R  K ++  +    AA ++QKY ++    K  R    + K+S  ++Q   R  + RK+F ++       ++KIR++  T   Y    A  + I +  K Y A K      +SVI IQ  FR  +  K F         IQKY    IK+  +  Q        A  VIQK +R FL+RK           IQ  +R Y  RK   C +  AI +  Q     IR++
Sbjct: 1269 AARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQAMWRRYRAKKYLCKV-KAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLE--RTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQ-------RAKIRLLHFTAAAYYHLNA--VRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRF---------IQKY--HSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVNREIREE 1661          

HSP 6 Score: 79.337 bits (194), Expect = 1.213e-13
Identity = 116/416 (27.88%), Postives = 171/416 (41.11%), Query Frame = 1
Query: 3961 SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSH----FICQKNAAIKLQKNIRGYLIRKNFTETRNKIIL---------------VQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQ 5151
            +A+VIQKY R  + ++             +N              ++A+LIQ  +R Y+ +K ++CK  AA  IQ  +R     ++Y    K V  IQ           Y +++               R +++  R SA+IIQ+  R  L  K                  FLM   ++    AA LIQ   RGY  R+  + ++ A  IIQ + RA     H    +I  K + + LQ  +RG+L+RK F E R KI L               +Q   K ++A K   K  +S I +Q+ FR     K+F++ K  SI   K +    Q  L +  R AS VIQK VR FL R K Q +  + II                       IQ  +RGY+ R     +KN C  I+
Sbjct: 1318 AALVIQKYWRRVLAQRKLLMLKKEKLEKVQN--------------KAASLIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCF--------YTKLE---------------RTRFLNVRASAIIIQRKWRAILPAKIAH-------------EHFLMIKRHR----AACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQ-KYHSI---KKIEHEGQECLSQRNRAAS-VIQKAVRHFLLR-KKQEKFTSGIIK----------------------IQALWRGYSWR-----KKNDCTKIK 1645          

HSP 7 Score: 69.3218 bits (168), Expect = 1.291e-10
Identity = 107/417 (25.66%), Postives = 190/417 (45.56%), Query Frame = 1
Query: 2572 QIKAAVIIQSFYRSSVCR---RTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRN-SVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSI----ICQKNYLKIK--QSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQK----QYLKVRKSTIIIQKHFRAISARKQFLNFRK------FTIV---------VQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQ 3735
            +I+AA +IQ+ +R    +   + +    K+  IIQ  V   L K++L KR+ + ++IQKY R                +L    +  L++++  K++N +  L+Q   R                       RY AKK ++ K  A   IQ   R     +++  +  A  IIQ  F     R +FL    SAI+IQ+  R+I    I  +++L IK  ++  +IQ H +G+  ++ + +     +I Q  +R     K    +Y++ +KST+I+Q   R    RK+FL  R       FT           +Q+  K++   +   K  + VI IQ+  RA LQ +R+I+   ++  I+ + + C  ++     N+AA+V+QK  + ++ +K+  K    +  IQ   R    RK+
Sbjct: 1266 EIRAARLIQTTWRKYKLKTDLKRHQEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWR---------------RVLAQRKLLMLKKEKLEKVQNKAASLIQAMWR-----------------------RYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQR-----NRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 1638          

HSP 8 Score: 62.7734 bits (151), Expect = 1.294e-8
Identity = 60/211 (28.44%), Postives = 102/211 (48.34%), Query Frame = 1
Query: 2011 YRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLK----KFKSIKMRIIICQSVVKRYLARHRISKMKK---------------SAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYA-KRRNYTIQIKA 2583
            +RAA  IQ  +R Y+   +    F+      +I+Q  +R     K    K+   K   +I Q++V+ +L R R  + +                +A+ IQ+ Y+ YL      K  ++ + +Q  FR  L +K +++ Y SI  I++   G  C S   R   +  +IQK V+ +L RKK  K T  I+ IQ+ +RGY+ +++N   +IKA
Sbjct: 1445 HRAACLIQAHYRGYKGRQV----FLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEH--EGQECLSQRNR---AASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKA 1646          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 75.0998 bits (183), Expect = 1.937e-12
Identity = 51/202 (25.25%), Postives = 106/202 (52.48%), Query Frame = 1
Query: 5143 TIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSE--LKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMI--KSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKN 5736
            T +N  +  ++ K   +  +  IF +     Y+ + R  +L+ + I IQK  RG+   +KY++ +KA I +Q+  R +       F     A+ IIQK +R Y++R+ +K +R   + +QSY+R ++  ++++ I  +   +IIQK +RG   R  YK+ +  ++++Q   R  + +     +K    +++ + ++H   +N
Sbjct:  726 TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMEN 927          

HSP 2 Score: 74.3294 bits (181), Expect = 3.670e-12
Identity = 69/260 (26.54%), Postives = 123/260 (47.31%), Query Frame = 1
Query: 2113 QSIVRRFLCLKKFKSI-KMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLAR--KKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKS--VIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQK 2877
            Q    R+  L K K +   R   C++V+++ +      +  K+ I  +     YL ++R +K+++A + +Q   R +L++K YL                       R+RK+   +Q+YV+GY AR   KF++ TKA  +IQ  +R Y  RR Y I+  A +++QS+ R  + R  Y  + +    +IIQK V   L +   ++ + + I +Q   R  + +R   K K     +E Y      +K  + M N ++ LQ+
Sbjct:  704 QEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYL-----------------------RMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERY------KKLHIGMENKIMQLQR 934          

HSP 3 Score: 71.2478 bits (173), Expect = 2.833e-11
Identity = 54/166 (32.53%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR--AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRL--KMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK 5406
            R A I IQK +RG+L R KY R   AAI +QR                       + RGY  R  A FL +  +   IQ Y++ Y++R++Y   R  TI +Q  +R +++RNR+ ++  +   +IIQK  RG+     Y +   A+I +Q  FRR    +  + LK
Sbjct:  767 RAACIRIQKTIRGWLLRKKYLRMRKAAITMQR-----------------------YVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 4 Score: 68.5514 bits (166), Expect = 1.801e-10
Identity = 50/175 (28.57%), Postives = 94/175 (53.71%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEK--KQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKY 3984
            KL++  I IQK IR  L R++Y++ +KA I +QR  R  + +   + +   +AAT++QKY++ Y+ +++++  + +  V+Q Y R  + R +++K     IL + K   +I +KR              V+G+ AR  Y    H++I +Q  FR  M ++    +K  A  +++Y
Sbjct:  765 KLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK-----ILREHKA--VIIQKR--------------VRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERY 918          

HSP 5 Score: 67.781 bits (164), Expect = 3.807e-10
Identity = 46/138 (33.33%), Postives = 78/138 (56.52%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL---RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT--RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRI 5049
            A I++QK IRG+L+RK +   R   I +Q  ++G+ AR CY K      ++ I+QK +R +   +++   + A+I +Q  +R +     YR     + +++IQK VRG+L R  Y+R + A I LQ  FR+ +  R +
Sbjct:  769 ACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQAR-CYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKREL 905          

HSP 6 Score: 66.2402 bits (160), Expect = 9.204e-10
Identity = 58/176 (32.95%), Postives = 87/176 (49.43%), Query Frame = 1
Query: 5860 LAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIR--KIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCH 6381
            L K  YQ   + I F    V   L KL+  K+R A I IQKT++G+ +RK Y  ++K+ I +QR++RG+  R    FL+   A+ II K+ R  +VR  +       KI        R  A+I +Q+Y R ++ + RY              R I+ +  AV+IQ+  RG   R H
Sbjct:  736 LDKDKYQFGKTKIFFRAGQV-AYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRY-------KI--------RRAATIVLQSYLRGFLARNRY--------------RKILREHKAVIIQKRVRGWLARTH 881          

HSP 7 Score: 66.2402 bits (160), Expect = 1.018e-9
Identity = 58/201 (28.86%), Postives = 93/201 (46.27%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNA--HKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
             YL +    + R   I +Q  ++G++ RK Y ++R ++I +Q+  RG+ A  + KFL+   A+  IQK  R Y   + Y+  R A+IV+Q Y+RGFL R +Y++      IL+ H                A IIQ   RG+  R H+   K S   I                    I++QC  RR +++    +LK+  
Sbjct:  756 AYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK------ILREH---------------KAVIIQKRVRGWLARTHY---KRSMHAI--------------------IYLQCCFRRMMAKRELKKLKIEA 912          

HSP 8 Score: 63.929 bits (154), Expect = 4.548e-9
Identity = 47/169 (27.81%), Postives = 91/169 (53.85%), Query Frame = 1
Query: 4291 KQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYK--RKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR 4785
             +++ A   IQK  +G+++RKKY+  R++A+ +Q+                       YVR +  R   K  R+  AAT+IQK  R Y+VR+R  + + A  ++Q++ R    R+ +  I +++ A+ +QK +RG+L R ++  + + II +Q   +  +A++  +KL+
Sbjct:  764 DKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQR-----------------------YVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 9 Score: 58.151 bits (139), Expect = 3.043e-7
Identity = 38/110 (34.55%), Postives = 64/110 (58.18%), Query Frame = 1
Query: 4042 IQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIR--KNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQM--KKAATYIQKIAKGYIIRKKY 4359
            IQK IRG+L+RK      ++A  +Q + R Y+ R    F+ +  AA +IQK +R + +R++Y   R   I +QS +R F+A  +Y+++  +  A  IQK  +G++ R  Y
Sbjct:  773 IQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHY 882          

HSP 10 Score: 57.3806 bits (137), Expect = 5.528e-7
Identity = 46/171 (26.90%), Postives = 87/171 (50.88%), Query Frame = 1
Query: 5590 RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYE--YKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLK 6096
            +L+  K+    + IQK IR  ++R ++L ++K+ I +Q + R +    Y  +    ++ T+IQK  R ++ R+R+   ++  I++Q + R FLA+  Y++          ++R   A           ++IQK V+G+  R HYK    ++I LQ   R  + ++   KLK
Sbjct:  760 KLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK----------ILREHKA-----------VIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 11 Score: 56.6102 bits (135), Expect = 8.852e-7
Identity = 55/180 (30.56%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQ--CRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVV-QKYFKSYICKKQFRKM--KESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK-KIAA 3825
            YL + +  K+R + I IQK  R    RK++L  RK  I +Q+Y++ +Q  C  KFL+       IQK  R  + RRRY            K R            +AAT+V Q Y + ++ + ++RK+  +    +IQK  R  + R  +++ M  +I LQ   R ++ K+  +K KI A
Sbjct:  757 YLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRY------------KIR------------RAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEA 912          

HSP 12 Score: 55.8398 bits (133), Expect = 1.325e-6
Identity = 37/110 (33.64%), Postives = 64/110 (58.18%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFAR--KKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIY---CSQTTAIKVIQKNIRGFLVR 4074
            I +Q  IR  + +K+Y +   A +T+ ++V+GY AR   K+L    +  +IQ  +R ++ R+ +   + + IV+Q YLRGF+ R  Y     +  A+ +IQK +RG+L R
Sbjct:  771 IRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAV-IIQKRVRGWLAR 879          

HSP 13 Score: 53.9138 bits (128), Expect = 5.867e-6
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query: 3952 IKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGF-------LVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNET--RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
            ++ + I IQK +RG++ RK Y     A   +Q+ +RG+        +R+T     ++AT+IQ ++R Y +R+ +  +R A IV+Q   R    R +Y +     K + IQ  +R ++A   YK+   A  Y+Q
Sbjct:  766 LRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRT-----KAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQ 893          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Match: MYO5A (myosin VA [Source:HGNC Symbol;Acc:HGNC:7602])

HSP 1 Score: 75.0998 bits (183), Expect = 2.003e-12
Identity = 51/202 (25.25%), Postives = 106/202 (52.48%), Query Frame = 1
Query: 5143 TIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSE--LKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMI--KSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKN 5736
            T +N  +  ++ K   +  +  IF +     Y+ + R  +L+ + I IQK  RG+   +KY++ +KA I +Q+  R +       F     A+ IIQK +R Y++R+ +K +R   + +QSY+R ++  ++++ I  +   +IIQK +RG   R  YK+ +  ++++Q   R  + +     +K    +++ + ++H   +N
Sbjct:  726 TCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERYKKLHIGMEN 927          

HSP 2 Score: 74.3294 bits (181), Expect = 3.670e-12
Identity = 69/260 (26.54%), Postives = 123/260 (47.31%), Query Frame = 1
Query: 2113 QSIVRRFLCLKKFKSI-KMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLAR--KKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKS--VIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQK 2877
            Q    R+  L K K +   R   C++V+++ +      +  K+ I  +     YL ++R +K+++A + +Q   R +L++K YL                       R+RK+   +Q+YV+GY AR   KF++ TKA  +IQ  +R Y  RR Y I+  A +++QS+ R  + R  Y  + +    +IIQK V   L +   ++ + + I +Q   R  + +R   K K     +E Y      +K  + M N ++ LQ+
Sbjct:  704 QEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRADKLRAACIRIQKTIRGWLLRKKYL-----------------------RMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERY------KKLHIGMENKIMQLQR 934          

HSP 3 Score: 71.2478 bits (173), Expect = 2.785e-11
Identity = 54/166 (32.53%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR--AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRL--KMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK 5406
            R A I IQK +RG+L R KY R   AAI +QR                       + RGY  R  A FL +  +   IQ Y++ Y++R++Y   R  TI +Q  +R +++RNR+ ++  +   +IIQK  RG+     Y +   A+I +Q  FRR    +  + LK
Sbjct:  767 RAACIRIQKTIRGWLLRKKYLRMRKAAITMQR-----------------------YVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 4 Score: 68.5514 bits (166), Expect = 1.863e-10
Identity = 50/175 (28.57%), Postives = 94/175 (53.71%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEK--KQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKY 3984
            KL++  I IQK IR  L R++Y++ +KA I +QR  R  + +   + +   +AAT++QKY++ Y+ +++++  + +  V+Q Y R  + R +++K     IL + K   +I +KR              V+G+ AR  Y    H++I +Q  FR  M ++    +K  A  +++Y
Sbjct:  765 KLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK-----ILREHKA--VIIQKR--------------VRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEARSVERY 918          

HSP 5 Score: 67.781 bits (164), Expect = 3.904e-10
Identity = 46/138 (33.33%), Postives = 78/138 (56.52%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL---RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT--RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRI 5049
            A I++QK IRG+L+RK +   R   I +Q  ++G+ AR CY K      ++ I+QK +R +   +++   + A+I +Q  +R +     YR     + +++IQK VRG+L R  Y+R + A I LQ  FR+ +  R +
Sbjct:  769 ACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQAR-CYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKREL 905          

HSP 6 Score: 66.2402 bits (160), Expect = 9.051e-10
Identity = 58/176 (32.95%), Postives = 87/176 (49.43%), Query Frame = 1
Query: 5860 LAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIR--KIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCH 6381
            L K  YQ   + I F    V   L KL+  K+R A I IQKT++G+ +RK Y  ++K+ I +QR++RG+  R    FL+   A+ II K+ R  +VR  +       KI        R  A+I +Q+Y R ++ + RY              R I+ +  AV+IQ+  RG   R H
Sbjct:  736 LDKDKYQFGKTKIFFRAGQV-AYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRY-------KI--------RRAATIVLQSYLRGFLARNRY--------------RKILREHKAVIIQKRVRGWLARTH 881          

HSP 7 Score: 66.2402 bits (160), Expect = 1.053e-9
Identity = 58/201 (28.86%), Postives = 93/201 (46.27%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNA--HKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
             YL +    + R   I +Q  ++G++ RK Y ++R ++I +Q+  RG+ A  + KFL+   A+  IQK  R Y   + Y+  R A+IV+Q Y+RGFL R +Y++      IL+ H                A IIQ   RG+  R H+   K S   I                    I++QC  RR +++    +LK+  
Sbjct:  756 AYLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK------ILREH---------------KAVIIQKRVRGWLARTHY---KRSMHAI--------------------IYLQCCFRRMMAKRELKKLKIEA 912          

HSP 8 Score: 63.929 bits (154), Expect = 4.586e-9
Identity = 47/169 (27.81%), Postives = 91/169 (53.85%), Query Frame = 1
Query: 4291 KQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYK--RKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR 4785
             +++ A   IQK  +G+++RKKY+  R++A+ +Q+                       YVR +  R   K  R+  AAT+IQK  R Y+VR+R  + + A  ++Q++ R    R+ +  I +++ A+ +QK +RG+L R ++  + + II +Q   +  +A++  +KL+
Sbjct:  764 DKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQR-----------------------YVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 9 Score: 58.151 bits (139), Expect = 2.943e-7
Identity = 38/110 (34.55%), Postives = 64/110 (58.18%), Query Frame = 1
Query: 4042 IQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIR--KNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQM--KKAATYIQKIAKGYIIRKKY 4359
            IQK IRG+L+RK      ++A  +Q + R Y+ R    F+ +  AA +IQK +R + +R++Y   R   I +QS +R F+A  +Y+++  +  A  IQK  +G++ R  Y
Sbjct:  773 IQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHY 882          

HSP 10 Score: 56.9954 bits (136), Expect = 5.622e-7
Identity = 46/171 (26.90%), Postives = 87/171 (50.88%), Query Frame = 1
Query: 5590 RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYE--YKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLK 6096
            +L+  K+    + IQK IR  ++R ++L ++K+ I +Q + R +    Y  +    ++ T+IQK  R ++ R+R+   ++  I++Q + R FLA+  Y++          ++R   A           ++IQK V+G+  R HYK    ++I LQ   R  + ++   KLK
Sbjct:  760 KLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRK----------ILREHKA-----------VIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLK 909          

HSP 11 Score: 56.6102 bits (135), Expect = 8.704e-7
Identity = 55/180 (30.56%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQ--CRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVV-QKYFKSYICKKQFRKM--KESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK-KIAA 3825
            YL + +  K+R + I IQK  R    RK++L  RK  I +Q+Y++ +Q  C  KFL+       IQK  R  + RRRY            K R            +AAT+V Q Y + ++ + ++RK+  +    +IQK  R  + R  +++ M  +I LQ   R ++ K+  +K KI A
Sbjct:  757 YLEKLRADKLRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRY------------KIR------------RAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQCCFRRMMAKRELKKLKIEA 912          

HSP 12 Score: 55.8398 bits (133), Expect = 1.348e-6
Identity = 37/110 (33.64%), Postives = 64/110 (58.18%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFAR--KKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIY---CSQTTAIKVIQKNIRGFLVR 4074
            I +Q  IR  + +K+Y +   A +T+ ++V+GY AR   K+L    +  +IQ  +R ++ R+ +   + + IV+Q YLRGF+ R  Y     +  A+ +IQK +RG+L R
Sbjct:  771 IRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRTKAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAV-IIQKRVRGWLAR 879          

HSP 13 Score: 53.9138 bits (128), Expect = 5.917e-6
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query: 3952 IKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGF-------LVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNET--RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
            ++ + I IQK +RG++ RK Y     A   +Q+ +RG+        +R+T     ++AT+IQ ++R Y +R+ +  +R A IV+Q   R    R +Y +     K + IQ  +R ++A   YK+   A  Y+Q
Sbjct:  766 LRAACIRIQKTIRGWLLRKKYLRMRKAAITMQRYVRGYQARCYAKFLRRT-----KAATIIQKYWRMYVVRRRYKIRRAATIVLQSYLRGFLARNRYRKILREHKAVIIQKRVRGWLARTHYKRSMHAIIYLQ 893          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 81.2629 bits (199), Expect = 9.726e-15
Identity = 55/185 (29.73%), Postives = 105/185 (56.76%), Query Frame = 1
Query: 2233 KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLC--RSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQI---KAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEK---RLRSCIIIQKYIRGFINR 2763
            K+ I ++      L R+R + + +A  V+Q  ++ +L ++ Y  + RS+LI+Q +++ +L   R  Y ++ ++  ++Q  V+GYL R+K+ ++  +I+ IQ+ F+    RR Y  ++   K+A+ IQ+ +R  + RR  +  RK V+++Q  V K L KR+L +     RS   +QK   G  N+
Sbjct:  758 KTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRR-YVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTGLENK 941          

HSP 2 Score: 71.2478 bits (173), Expect = 1.082e-11
Identity = 56/178 (31.46%), Postives = 101/178 (56.74%), Query Frame = 1
Query: 2383 IIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLA--RKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVI-IQSFYRSSVCRRTYLNLR--KSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLR 2901
            +IQ   +G+L R  Y+ +R+S  I+Q  +K +LA  R K++++ +A++V+QSA RGY +RR Y  QI+ ++I IQ+ ++++  RR    LR  KS I IQ      L +R+     +  +++Q  +R ++ +R   + K     +E   +G+L +K    + N +I LQ  L + + R
Sbjct:  785 VIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYE-QIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELK-----IEARSVGHL-QKLNTGLENKIIELQMRLDIANAR 955          

HSP 3 Score: 68.5514 bits (166), Expect = 6.943e-11
Identity = 52/204 (25.49%), Postives = 110/204 (53.92%), Query Frame = 1
Query: 3751 KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFM-YRKM-FLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICK---RNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMK---KAATYIQKIAKG 4338
            K  I L++    ++ + R     AA   I K  KG+ AR+KY + R S++++Q S + F+ +R++ +L +  + IV+Q  +RG+++R+ Y       + I+ +I G                IQ  +++ ++R+ ++ K     +AI IQ  +R +  R++    RKKV+ +Q  +R+++A ++ +++K   ++  ++QK+  G
Sbjct:  758 KTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKY-------EQIRDSIIG----------------IQAMFKANRVRR-YVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 4 Score: 67.0106 bits (162), Expect = 1.986e-10
Identity = 63/291 (21.65%), Postives = 142/291 (48.80%), Query Frame = 1
Query: 5134 SCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYIS--RNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNF-----RRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQ-KNIRANIVRTRFLNIKKSIINIQSFYRMH-------YEYKN-YQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR 5958
            +   IQ  +K +L R+KY  +R+  + +Q  ++ +++  R ++L++  +VI++Q   RGY   RKY + + ++I IQ  F     RR+ E   ++    ++I IQ  +R Y+ R+E    RK  V +Q  +R+++   + + +K     +  H++ +   L+  KII+L + +   N R      +F    K++   ++   M         E +N  +++++ +  ++  C    A++  +E K  ++ +Q    +F  +   +   +I+   + L + K  ++ + + R
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYE---KSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSV-GHLQKLNTGLE-NKIIELQMRLDIANARTKEEAEKFATASKNLQKTKADLAMMEAERLTLLEARNRVEVLQEEVERLETECDLKEAQRGGMETK--MVELQSRLDQF--QMQSESGQTIVELTEQLEKAKADRVLWDEER 1063          

HSP 5 Score: 67.0106 bits (162), Expect = 2.493e-10
Identity = 57/195 (29.23%), Postives = 96/195 (49.23%), Query Frame = 1
Query: 4729 LVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKM---SVIIIQKVTRG 5304
            ++Q + KGF+AR+ Y+ +R S +IVQ   + F A ++                +Y QM        A IV+Q  VRG+L R KY++   + I +Q  F             KA R+     R Y  +  +   + S +TIQ  ++ YL R++ +  R+K + +QC VR+++++ R   LK+   SV  +QK+  G
Sbjct:  785 VIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRI---------------KYLQM------HRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMF-------------KANRV-----RRYVEKLRY---EKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 6 Score: 64.6994 bits (156), Expect = 1.032e-9
Identity = 45/169 (26.63%), Postives = 93/169 (55.03%), Query Frame = 1
Query: 1999 LMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMR--IIICQSVVKRYLARHRISKMKKSAILIQKNY-----RRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIR---KSTKIIQKYVKG 2475
            L T   AA+ IQ++W+ +     Y+T      + ++IVQ+ ++ FL  ++ K ++M   +I+ QS V+ YL R +  +++ S I IQ  +     RRY+ ++RYEK   + + +Q+ +R YL ++  +   + ++++Q  +R +L +   + ++   +S   +QK   G
Sbjct:  776 LDTLAAAATVIQKMWKGFLARRKYET----MRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEK---SAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 7 Score: 60.8474 bits (146), Expect = 1.548e-8
Identity = 39/115 (33.91%), Postives = 69/115 (60.00%), Query Frame = 1
Query: 5746 MKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR--SYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKIL--QKSVIQLQRFIRGFLIRK 6078
            +  + TVIQK  + F+AR+++  ++ +++I+Q   + FLA R   Y +    +I +QS VRG L + KY+++R + I IQ   K   +R++ + L  +KS I +Q   RG+L R+
Sbjct:  779 LAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARR 893          

HSP 8 Score: 60.8474 bits (146), Expect = 1.831e-8
Identity = 45/165 (27.27%), Postives = 89/165 (53.94%), Query Frame = 1
Query: 4297 MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR 4785
            +  AAT IQK+ KG++ R+KY T RRS +I+Q +++ +L+                  RR     +++    A  ++Q   RGYL R++    + ++  IQ  ++A+ +R +   +  + +AI +Q   RGYL R+     R K+++VQ  ++ ++A++  ++L+
Sbjct:  779 LAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLA-----------------FRRIKYLQMHR----AVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELK 922          

HSP 9 Score: 58.151 bits (139), Expect = 1.089e-7
Identity = 37/122 (30.33%), Postives = 68/122 (55.74%), Query Frame = 1
Query: 5791 IARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLA--KLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKL--KNASIIISKHVRGVLVR 6144
            + R R   + +   +IQK ++ FLA+R Y+     ++ VQ+ ++  LA  ++KY +M  A I++Q  V+GY  R+ Y+ ++ S+I +Q   +   +R+   KL  + ++I I    RG L R
Sbjct:  771 LERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLAR 892          

HSP 10 Score: 55.8398 bits (133), Expect = 4.862e-7
Identity = 48/190 (25.26%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 3001 ILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQK--NYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQ 3564
            I ++T   A+++R +   L  AA +IQK ++ +  R+K+     S +++Q ++++ +  +   YL++ ++V+V+                       QS VR YL +++Y ++R S I IQ  F+A   R              +Y++        L+ +   ITIQ   R  L RR  I N+K V+ +Q
Sbjct:  761 IFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVM-----------------------QSAVRGYLERRKYEQIRDSIIGIQAMFKANRVR--------------RYVEK-------LRYEKSAITIQAAWRGYLARREQIANRKKVVMVQ 906          

HSP 11 Score: 55.4546 bits (132), Expect = 7.528e-7
Identity = 40/160 (25.00%), Postives = 79/160 (49.38%), Query Frame = 1
Query: 3616 AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLIC--RKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKF--SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTL 4083
            AATV+QK +K ++ ++++  M+ S+ ++Q   +  +   R ++ +  + VI++QS +R                       GY  R+KY   R S+I IQ  F+    R+    +++  SAI IQ   RG++ R+   +    + ++Q  +R +L ++ L
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVR-----------------------GYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRL 918          

HSP 12 Score: 53.5286 bits (127), Expect = 2.463e-6
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIA--RKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQ-----KNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRI 5049
            AA  +QK  +G+L R+ +   R  +++VQ+ +K F+A  R  Y ++  + I++Q   RG+   +K+ +++++ I IQ       VRRY +   Y     ++I IQ   RG+L R +        +++Q   RK+L  RR+
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRY---EKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRL 918          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Match: hum-2 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:A0A168H5A5])

HSP 1 Score: 81.2629 bits (199), Expect = 9.972e-15
Identity = 55/185 (29.73%), Postives = 105/185 (56.76%), Query Frame = 1
Query: 2233 KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLC--RSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQI---KAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEK---RLRSCIIIQKYIRGFINR 2763
            K+ I ++      L R+R + + +A  V+Q  ++ +L ++ Y  + RS+LI+Q +++ +L   R  Y ++ ++  ++Q  V+GYL R+K+ ++  +I+ IQ+ F+    RR Y  ++   K+A+ IQ+ +R  + RR  +  RK V+++Q  V K L KR+L +     RS   +QK   G  N+
Sbjct:  758 KTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRR-YVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTGLENK 941          

HSP 2 Score: 71.2478 bits (173), Expect = 1.073e-11
Identity = 56/178 (31.46%), Postives = 101/178 (56.74%), Query Frame = 1
Query: 2383 IIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLA--RKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVI-IQSFYRSSVCRRTYLNLR--KSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLR 2901
            +IQ   +G+L R  Y+ +R+S  I+Q  +K +LA  R K++++ +A++V+QSA RGY +RR Y  QI+ ++I IQ+ ++++  RR    LR  KS I IQ      L +R+     +  +++Q  +R ++ +R   + K     +E   +G+L +K    + N +I LQ  L + + R
Sbjct:  785 VIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYE-QIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELK-----IEARSVGHL-QKLNTGLENKIIELQMRLDIANAR 955          

HSP 3 Score: 68.5514 bits (166), Expect = 6.769e-11
Identity = 52/204 (25.49%), Postives = 110/204 (53.92%), Query Frame = 1
Query: 3751 KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFM-YRKM-FLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICK---RNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMK---KAATYIQKIAKG 4338
            K  I L++    ++ + R     AA   I K  KG+ AR+KY + R S++++Q S + F+ +R++ +L +  + IV+Q  +RG+++R+ Y       + I+ +I G                IQ  +++ ++R+ ++ K     +AI IQ  +R +  R++    RKKV+ +Q  +R+++A ++ +++K   ++  ++QK+  G
Sbjct:  758 KTKIFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKY-------EQIRDSIIG----------------IQAMFKANRVRR-YVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 4 Score: 67.0106 bits (162), Expect = 2.513e-10
Identity = 40/144 (27.78%), Postives = 80/144 (55.56%), Query Frame = 1
Query: 5134 SCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYIS--RNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNF-----RRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIK 5544
            +   IQ  +K +L R+KY  +R+  + +Q  ++ +++  R ++L++  +VI++Q   RGY   RKY + + ++I IQ  F     RR+ E   ++    ++I IQ  +R Y+ R+E    RK  V +Q  +R+++   + + +K
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYE---KSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELK 922          

HSP 5 Score: 66.6254 bits (161), Expect = 2.577e-10
Identity = 57/195 (29.23%), Postives = 96/195 (49.23%), Query Frame = 1
Query: 4729 LVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKM---SVIIIQKVTRG 5304
            ++Q + KGF+AR+ Y+ +R S +IVQ   + F A ++                +Y QM        A IV+Q  VRG+L R KY++   + I +Q  F             KA R+     R Y  +  +   + S +TIQ  ++ YL R++ +  R+K + +QC VR+++++ R   LK+   SV  +QK+  G
Sbjct:  785 VIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRI---------------KYLQM------HRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMF-------------KANRV-----RRYVEKLRY---EKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 6 Score: 64.6994 bits (156), Expect = 1.041e-9
Identity = 45/169 (26.63%), Postives = 93/169 (55.03%), Query Frame = 1
Query: 1999 LMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMR--IIICQSVVKRYLARHRISKMKKSAILIQKNY-----RRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIR---KSTKIIQKYVKG 2475
            L T   AA+ IQ++W+ +     Y+T      + ++IVQ+ ++ FL  ++ K ++M   +I+ QS V+ YL R +  +++ S I IQ  +     RRY+ ++RYEK   + + +Q+ +R YL ++  +   + ++++Q  +R +L +   + ++   +S   +QK   G
Sbjct:  776 LDTLAAAATVIQKMWKGFLARRKYET----MRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEK---SAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELKIEARSVGHLQKLNTG 937          

HSP 7 Score: 60.8474 bits (146), Expect = 1.535e-8
Identity = 39/115 (33.91%), Postives = 69/115 (60.00%), Query Frame = 1
Query: 5746 MKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR--SYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKIL--QKSVIQLQRFIRGFLIRK 6078
            +  + TVIQK  + F+AR+++  ++ +++I+Q   + FLA R   Y +    +I +QS VRG L + KY+++R + I IQ   K   +R++ + L  +KS I +Q   RG+L R+
Sbjct:  779 LAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARR 893          

HSP 8 Score: 60.8474 bits (146), Expect = 1.862e-8
Identity = 45/165 (27.27%), Postives = 89/165 (53.94%), Query Frame = 1
Query: 4297 MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR 4785
            +  AAT IQK+ KG++ R+KY T RRS +I+Q +++ +L+                  RR     +++    A  ++Q   RGYL R++    + ++  IQ  ++A+ +R +   +  + +AI +Q   RGYL R+     R K+++VQ  ++ ++A++  ++L+
Sbjct:  779 LAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLA-----------------FRRIKYLQMHR----AVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRLRELK 922          

HSP 9 Score: 58.151 bits (139), Expect = 1.098e-7
Identity = 37/122 (30.33%), Postives = 68/122 (55.74%), Query Frame = 1
Query: 5791 IARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLA--KLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKL--KNASIIISKHVRGVLVR 6144
            + R R   + +   +IQK ++ FLA+R Y+     ++ VQ+ ++  LA  ++KY +M  A I++Q  V+GY  R+ Y+ ++ S+I +Q   +   +R+   KL  + ++I I    RG L R
Sbjct:  771 LERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLAR 892          

HSP 10 Score: 55.8398 bits (133), Expect = 5.070e-7
Identity = 48/190 (25.26%), Postives = 89/190 (46.84%), Query Frame = 1
Query: 3001 ILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQK--NYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQ 3564
            I ++T   A+++R +   L  AA +IQK ++ +  R+K+     S +++Q ++++ +  +   YL++ ++V+V+                       QS VR YL +++Y ++R S I IQ  F+A   R              +Y++        L+ +   ITIQ   R  L RR  I N+K V+ +Q
Sbjct:  761 IFLRTGQVAVLERVRLDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVM-----------------------QSAVRGYLERRKYEQIRDSIIGIQAMFKANRVR--------------RYVEK-------LRYEKSAITIQAAWRGYLARREQIANRKKVVMVQ 906          

HSP 11 Score: 55.4546 bits (132), Expect = 7.590e-7
Identity = 40/160 (25.00%), Postives = 79/160 (49.38%), Query Frame = 1
Query: 3616 AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLIC--RKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKF--SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTL 4083
            AATV+QK +K ++ ++++  M+ S+ ++Q   +  +   R ++ +  + VI++QS +R                       GY  R+KY   R S+I IQ  F+    R+    +++  SAI IQ   RG++ R+   +    + ++Q  +R +L ++ L
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVR-----------------------GYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYEKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRL 918          

HSP 12 Score: 53.5286 bits (127), Expect = 2.526e-6
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIA--RKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQ-----KNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRI 5049
            AA  +QK  +G+L R+ +   R  +++VQ+ +K F+A  R  Y ++  + I++Q   RG+   +K+ +++++ I IQ       VRRY +   Y     ++I IQ   RG+L R +        +++Q   RK+L  RR+
Sbjct:  782 AATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLAFRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRY---EKSAITIQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKRRL 918          

HSP 13 Score: 52.7582 bits (125), Expect = 5.075e-6
Identity = 39/165 (23.64%), Postives = 85/165 (51.52%), Query Frame = 1
Query: 5392 FQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFY-----RMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR 5871
               L  A+ +IQK ++ ++ R++++  R++ + +Q+ ++ ++                      F R+KY ++ + V+ +Q  +R  + R ++  I+ SII IQ+ +     R + E   Y+  K +IT IQ   R ++AR+  +  +  ++++Q   R++LAKR
Sbjct:  776 LDTLAAAATVIQKMWKGFLARRKYETMRRSLLIVQASLKAFLA---------------------FRRIKYLQMHRAVIVMQSAVRGYLERRKYEQIRDSIIGIQAMFKANRVRRYVEKLRYE--KSAIT-IQAAWRGYLARREQIANRKKVVMVQCAVRKWLAKR 916          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 53.1434 bits (126), Expect = 3.915e-6
Identity = 36/100 (36.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query: 2425 YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKL-EKRLRS 2721
            Y+ ++    +IQK V+ +L RK F K  +A V IQ+A+RG+ +R+ Y   I     +Q+  RS      Y  LRK++I  Q V    L +R++ EKR R 
Sbjct:  732 YRILKDKAIVIQKNVRRWLVRKDFEKQRQAAVTIQTAWRGFDQRKRYRQIISGFSRLQAVLRSRQLVSHYQTLRKTIIQFQAVCRGSLVRRQVGEKRKRG 831          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Match: hum-7 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:H2L082])

HSP 1 Score: 52.373 bits (124), Expect = 6.902e-6
Identity = 44/168 (26.19%), Postives = 77/168 (45.83%), Query Frame = 1
Query: 5578 GIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFL-EIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRK 6078
            G  VR++Y   ++    + +N R + V            +++ +   H    N  +   +  +  ++  K I        I  +I  +Q++FR  LA++ Y R    II +Q+L+RG  A+ + +K   A   IQ   K Y  R+ Y  +++SVI LQ   RG  +RK
Sbjct:  882 GYSVRIEYPSFVQQYRILLRNGRDSTVD-----------DVKEYIHSHASIDNDNIQYGTNKIFMRDAEKLILDDHLHRTIMQSIDTLQRWFRTMLARKRYLRMKEGIIKIQALIRGSFARAEVRKKALAAQTIQCNWKKYKQRQKYLSIRESVIALQSAYRGASVRK 1038          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Match: hum-7 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:H2L082])

HSP 1 Score: 51.9878 bits (123), Expect = 7.252e-6
Identity = 44/168 (26.19%), Postives = 77/168 (45.83%), Query Frame = 1
Query: 5578 GIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFL-EIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRK 6078
            G  VR++Y   ++    + +N R + V            +++ +   H    N  +   +  +  ++  K I        I  +I  +Q++FR  LA++ Y R    II +Q+L+RG  A+ + +K   A   IQ   K Y  R+ Y  +++SVI LQ   RG  +RK
Sbjct:  882 GYSVRIEYPSFVQQYRILLRNGRDSTVD-----------DVKEYIHSHASIDNDNIQYGTNKIFMRDAEKLILDDHLHRTIMQSIDTLQRWFRTMLARKRYLRMKEGIIKIQALIRGSFARAEVRKKALAAQTIQCNWKKYKQRQKYLSIRESVIALQSAYRGASVRK 1038          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Match: asp (gene:FBgn0000140 transcript:FBtr0084692)

HSP 1 Score: 114.005 bits (284), Expect = 1.504e-24
Identity = 248/1053 (23.55%), Postives = 448/1053 (42.55%), Query Frame = 1
Query: 3943 FLSIKF--SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKN---FICKRN-AAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTI----RSHFICQKNAAIKLQKNIRGYLI----RKNFTETRNKIILVQSLMKGFIA-RKC---YQKLRSSSIIVQKIFRGFNAHKK-----FLKLKNASICIQKNVRRYCQMKLYRDT----RNASIVIQK--------------YVRGFLCRIKYQRQLLAAIILQRHFRKYL----IIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVK-IQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKN----YQLMKQSITVIQKNCRKF----IARKRFLEIKSNIIIIQKFFRRFL-AKRSYQRNLSIII---FVQSLVRGKL----AKLKYQKMRTATILIQKTVKGYFI----RKHYKILQKSVIQLQRFIRGF----LIRKIFLKLKNASIIISKHVRG----VLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHE-ISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIE---SDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSEFIKLVKNLLYRNINSKRGTKGITIFCHTCLLL 6843
            F S KF  +A V+QK+ R   +  ++        VIQ+ IR     K L   H++AT+IQ  +R +++RK    F  +R  AAI++QK  R++  ++Q  ++   +I IQ   R                  Q++ + +  R+++V  R +A+ +Q                           R   R ++ +KLLAA    ++ R          +Q A   IQ  +R++ +    R  F+ Q++  + +Q+ +R        RK F + +   I +Q   +  ++ RKC   Y  LRSS + VQ  +R      +     +  L+   IC+Q+ +R   +M+  R+     RNASI++QK              Y+R   C I  QR+  A + ++R  + YL      +RI ++ +A R ++        RA FL  K   + +Q   +A L     R++YL +R+ TI +Q   RR+ +              QK  R  F   KY   + AV  +Q ++R    R  E  +F  L+ A+I +Q+ +R           R N +K ++SY +          +K A + IQ   R        K + K VV  QK              +++II +Q  YR + E +     YQ  +Q++  +QK  R      + +  +  I+ + + IQ+ +R  + A+R  +  LS I     +Q+ +R  L     + +++  R A ++IQ+  +        R+ Y+++Q SVI +QR  R        R+ F++L+  ++ + +  RG    +  RN FQ  +  M  F               QA  R ++ ++R+  L +  ++       I  KR+A VIQR WRG     +L  ++  H+ + +IR R  +  +     N+VR   ++A+  L+      +  L  L+ L+ ++     +  W  E   +  Y I+ + +    R   D +++ +   +  NL +      +      +  +  +L R  +     K   IF   C L+
Sbjct:  967 FRSPKFHAAATVLQKWWR---RHWLHV-------VIQRRIR----HKELMRRHRAATVIQAVFRGHQMRKYVKLFKTERTQAAIILQKFTRRYLAQKQLYQSYHSIITIQRWWR-----------------AQQLGRQH--RQRFVELREAAIFLQ---------------------------RIWRRRLFAKKLLAAAETARLQRSQ-------KQQAAASYIQMQWRSYQLGRIQRQQFLRQRDLIMFVQRRMRSKWSMLEQRKEFQQLKRAAINIQQRWRAKLSMRKCNADYLALRSSVLKVQ-AYRKATIQMRIDRNHYYSLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRMRQQMIQDRNAYLRTRKCIINVQRRWRATLQMRRERKNYLHLQTTTKRIQIKFRAKREMKK------QRAEFLQLKKVTLVVQKRRRALLQMRKERQEYLHLREVTIKLQ---RRFHA--------------QKSMR--FMRAKYRGTQAAVSCLQMHWRNHLLRKRERNSFLQLRQAAITLQRRYRA----------RLNMIKQLKSYAQ----------LKQAAITIQTRYRA------KKAMQKQVVLYQKQ-------------REAIIKVQRRYRGNLEMRKQIEVYQKQRQAVIRLQKWWRSIRDMRLCKAGYRRIRLSSLSIQRKWRATVQARRQREIFLSTIRKVRLMQAFIRATLLMRQQRREFEMKRRAAVVIQRRFRARCAMLKARQDYQLIQSSVILVQRKFRANRSMKQARQEFVQLRTIAVHLQQKFRGKRLMIEQRNCFQLLRCSMPGF---------------QARARGFMARKRFQALMTPEMM-----DLIRQKRAAKVIQRYWRG-----YLIRRRQKHQGLLDIRKRIAQLRQEAKAVNSVRCKVQEAVRFLR-GRFIASDALAVLSRLDRLSRTVPHLLMWCSEFMSTFCYGIMAQAI----RSEVDKQLIERCSRIILNLARYNSTTVNTFQEGGLVTIAQMLLRWCD-----KDSEIFNTLCTLI 1852          

HSP 2 Score: 112.079 bits (279), Expect = 5.732e-24
Identity = 88/302 (29.14%), Postives = 152/302 (50.33%), Query Frame = 1
Query:  655 HLSKTKVEDINKNMPIYIEATKLLLSE-CKVAIEKINSEVTKDSLKFKDDI-FFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNE-ACFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAK-ILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLW 1548
            +L+K ++E + K       A +L  SE  ++   K+   V K +L+ + D          R + EL++ +N  WL L   V       + + SN +      FI  ++  NK   ++ R     +  + E+  ++ ++ L++ L ++  LD AK+  I   +  LF K S  K + ++L  F+S  L   G+I +        + H QT +DE+D+  +NL+ D+ DGVRL R+ + IL+  D+  +LR PA+   ++ FN++LA+ A  +A   +    G +I    I  GHREKTL+LLW
Sbjct:  675 YLTKYRLETLRK------AAVELFFSEQMRLPCSKVAVYVNKQALRIRSDRNLHLDVVMQRTILELLLCFNPLWLRLGLEVVFGE--KIQMQSNRDIVGLSTFILNRLFRNK--CEEQRYSKAYTLTE-EYAETIKKHSLQKILFLLLFLDQAKQKRIVKHNPCLFVKKSPHKETKDILLRFSSELLANIGDITRELRRLGYVLQHRQTFLDEFDYAFNNLAVDLRDGVRLTRVMEVILLRDDLTRQLRVPAISRLQRIFNVKLALGALGEANFQL----GGDIAAQDIVDGHREKTLSLLW 961          

HSP 3 Score: 104.375 bits (259), Expect = 1.371e-21
Identity = 216/904 (23.89%), Postives = 401/904 (44.36%), Query Frame = 1
Query: 2581 AAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKS----AVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSL----RNSFLXXXXXXX-XXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSV----RKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA-ISARK---QFLNFRKFTIVVQKY----IKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMY----RKMFLSIKFSAIVIQKYLRG-----FIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRK--HYIRQ--QYNETRKKVIFIQSLIRQFIAIQK----YKQMKKAATYIQKIAKGYI-IRKK---YVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRF-LMRSVYKRKLLAATLIQKIARGYLVRKR----IVVEQKAVRIIQNFYRAHTI----RSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF----NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDL--EQKAARIIQNFYRGYTIR 5109
            AA ++Q ++R     R +L+    V+I +++ HK L +R      R+  +IQ   RG   R+    FK+    A  IL+ +   YL +KQ  +  +S+I +Q+  R   L    R  F+  +++AI + +   +R FAKK   A ++A +    K +A            AA  IQ  +R Y +    R++FL Q    + +Q+ +RS          K S+L                                  +K++ +++++ I IQ+ +RA +S RK    +L  R   + VQ Y    I+M   R  +  L+  VI +Q+ +RA++    QR  Y++ + A I +Q+++R    ++Q+I +  A      Y ++  C             I   QRR     Q ++E K  + LQ+      T KR Q K  A   + K       R ++L  +   +V+Q   R  +     R+ +L ++   I +Q+         F++ K   +Q  A+  +Q + R  L+RK                   + R +F+  R AAI +Q+++R   + I+Q   Y + ++  I IQ+  R   A+QK    Y++ ++A   +Q+  +G + +RK+   Y  QR++ + +QK  R                     +R   L ++ Y+R  L++  IQ+  R  +  +R     +   + VR++Q F RA  +    R  F  ++ AA+ +Q+  R                   +++K   AR+ YQ ++SS I+VQ+ FR       A ++F++L+  ++ +Q+  R     +L  + RN   +++  + GF  R +         + ++ F+  +    +DL  +++AA++IQ ++RGY IR
Sbjct:  975 AATVLQKWWR-----RHWLH----VVIQRRIRHKELMRRH-----RAATVIQAVFRGHQMRKYVKLFKTERTQAAIILQKFTRRYLAQKQLYQSYHSIITIQRWWRAQQLGRQHRQRFVELREAAIFLQRIWRRRLFAKKLLAAAETARLQRSQKQQA------------AASYIQMQWRSYQLGRIQRQQFLRQRDLIMFVQRRMRS----------KWSMLE--------------------------------QRKEFQQLKRAAINIQQRWRAKLSMRKCNADYLALRSSVLKVQAYRKATIQMRIDRNHYYSLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRM---RQQMIQDRNA------YLRTRKC-------------IINVQRRWRATLQMRRERKNYLHLQT------TTKRIQIKFRAKREMKK------QRAEFLQLKKVTLVVQKRRRALLQMRKERQEYLHLREVTIKLQRRFHAQKSMRFMRAKYRGTQA-AVSCLQMHWRNHLLRK-------------------RERNSFLQLRQAAITLQRRYRARLNMIKQLKSYAQLKQAAITIQTRYRAKKAMQKQVVLYQKQREAIIKVQRRYRGNLEMRKQIEVYQKQRQAVIRLQKWWRS--------------------IRDMRLCKAGYRRIRLSSLSIQRKWRATVQARRQREIFLSTIRKVRLMQAFIRATLLMRQQRREFEMKRRAAVVIQRRFRARC----------------AMLK---ARQDYQLIQSSVILVQRKFRANRSMKQARQEFVQLRTIAVHLQQKFR---GKRLMIEQRNCFQLLRCSMPGFQARAR-------GFMARKRFQALMTPEMMDLIRQKRAAKVIQRYWRGYLIR 1707          

HSP 4 Score: 94.7449 bits (234), Expect = 1.054e-18
Identity = 187/816 (22.92%), Postives = 360/816 (44.12%), Query Frame = 1
Query: 2008 FYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIR----GYLCRSNYKRIRKSTKIIQK------YVKGYLARKKFVKLTK------AIVVIQSAFRGYA----KRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLFKRKLEKR---LRSCII-IQKY----IRGFINRRNFLKFKSAVNILEHYFMGYLR----RKQFLKMRNSVILLQKNLR----MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQ----RRKFQYLRNAAIIIQKTFRCYSVRKK----FLIQYYSAIVIQKNVRSIIC----QKNYLKIKQSVLVIQKH---TKGFLVXXXXXXXXXXXXXC-QSLVRKYLLQKQ----YLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA--LLQRR--RYIKNKKAVIFIQRKFRSCKE-KKQIIL---NNQAATVVQKYFKSY----ICKKQFRKMK-ESVTVIQKYQRRLICRKQ---FQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYF----ARKKYLSYRHSVIVIQNSFRCF----MYRKMFLSIKFSAIVIQKYLRG----FIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNS-----------HHQSATLIQHFYRSYKIRK 4146
            F+ AA+ +Q+ WR++   +L+           +++Q  +R                      K  + RHR + + + A+      R+Y+   + E+ ++A ++LQ   RRYL QK   + Y SI+ IQ   R    G   R  +  +R++   +Q+      + K  LA  +  +L +      A   IQ  +R Y     +R+ +  Q    + +Q   RS       R+ +  L+++ I IQ+     L  RK       LRS ++ +Q Y    I+  I+R ++   +  V  L+      ++    R+ +L++RN+ IL+QK  R    M+  RN++L                         +   I +Q + RA +Q    R+ + +L+     IQ  FR     KK    FL      +V+QK  R+++     ++ YL +++  + +Q+     K     ++  +     + C Q   R +LL+K+    +L++R++ I +Q+ +RA                    + M +  + + +LK   ITIQ   RA   +Q++   Y K ++A+I +QR++R   E +KQI +     QA   +QK+++S     +CK  +R+++  S+++ +K++  +  R+Q   F   ++ V L+Q+ IR  +     ++ ++ K  A + I +  +       AR+ Y   + SVI++Q  FR        R+ F+ ++  A+ +Q+  RG      +R  +     ++   Q   RGF+ RK   +             ++A +IQ ++R Y IR+
Sbjct:  972 FHAAATVLQKWWRRH---WLH-----------VVIQRRIRH---------------------KELMRRHRAATVIQ-AVFRGHQMRKYVKLFKTERTQAA-IILQKFTRRYLAQKQLYQSYHSIITIQRWWRAQQLGRQHRQRFVELREAAIFLQRIWRRRLFAKKLLAAAETARLQRSQKQQAAASYIQMQWRSYQLGRIQRQQFLRQRDLIMFVQRRMRSKWSMLEQRKEFQQLKRAAINIQQRWRAKLSMRKCNADYLALRSSVLKVQAYRKATIQMRIDRNHYYSLRKNVICLQQRLRAIMKMREQRENYLRLRNASILVQKRYRMRQQMIQDRNAYLRT-----------------------RKCIINVQRRWRATLQMRRERKNYLHLQTTTKRIQIKFRAKREMKKQRAEFLQLKKVTLVVQKRRRALLQMRKERQEYLHLREVTIKLQRRFHAQKSMRFMRAKYRGTQAAVSCLQMHWRNHLLRKRERNSFLQLRQAAITLQRRYRA-------------------RLNMIKQLKSYAQLKQAAITIQTRYRAKKAMQKQVVLYQKQREAIIKVQRRYRGNLEMRKQIEVYQKQRQAVIRLQKWWRSIRDMRLCKAGYRRIRLSSLSIQRKWRATVQARRQREIFLSTIRKVRLMQAFIRATLLMRQQRREFEMKRRAAVVIQRRFRARCAMLKARQDYQLIQSSVILVQRKFRANRSMKQARQEFVQLRTIAVHLQQKFRGKRLMIEQRNCFQLLRCSMPGFQARARGFMARKRFQALMTPEMMDLIRQKRAAKVIQRYWRGYLIRR 1708          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089744)

HSP 1 Score: 67.781 bits (164), Expect = 1.486e-10
Identity = 66/254 (25.98%), Postives = 122/254 (48.03%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK--IIQKYVKGYLARKKFVKLTKAIVVIQSAFRG-------YAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFL 2913
            C+++V +++      +   + I  +     +L ++R    K    ++QS  RR++ ++ +L+I + I  IQ + RGYL R   +++R++    I+ KY +G+L R+++++L  +I  IQ+  RG       +A R +Y      AV IQ F R ++ RR Y                       +KR R+ II Q  IR F+ RR F + K+    + H         +++ + N +I +Q+ +  L+  NS L
Sbjct:  735 CRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYR-----AVQIQRFVRGALARRAY-----------------------QKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRIDELNRDNSNL 954          

HSP 2 Score: 61.6178 bits (148), Expect = 1.134e-8
Identity = 54/177 (30.51%), Postives = 98/177 (55.37%), Query Frame = 1
Query: 2170 IIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS--ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKI--IQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYT-IQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKV 2685
            I I QSVV+R++ R +  +++K    IQK+ R YL R R +K++   A ++L  + R +L ++ YL++  SI  IQ   RG L R+ +  +R   +   IQ++V+G LAR+ + K  + I++ Q+A R +  RR +  ++ +A  I       S     Y+ L   +I +Q+ + ++
Sbjct:  778 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTI-------SHMENKYMGLENKIISMQQRIDEL 947          

HSP 3 Score: 60.4622 bits (145), Expect = 2.265e-8
Identity = 49/160 (30.63%), Postives = 84/160 (52.50%), Query Frame = 1
Query: 3688 VTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK--KIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIK--FSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFI 4155
            +T++Q   RR + R+QF +  K++  +Q   R  + ++R QK  +  A L +SK+ +G+  R++YL  RHS+  IQ   R  + R  F +++  + A+ IQ+++RG + R+ Y  +   I + Q  IR FL R+        A  I H    Y   +N I
Sbjct:  778 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKI 937          

HSP 4 Score: 58.151 bits (139), Expect = 1.265e-7
Identity = 51/164 (31.10%), Postives = 85/164 (51.83%), Query Frame = 1
Query: 3865 RKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIY--CSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNA--AIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYI 4344
            RKKY++      ++Q+  R F+YR+ FL I+     IQK+ RG++ R+      +  A  ++ K  RG+L R+       S + IQ + R    R  F   R+   A+ IQ+  R    R+ Y + R+ +I  Q+ IR+F+A +K+K+MK  A  I  +   Y+
Sbjct:  774 RKKYIT------IVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYM 931          

HSP 5 Score: 55.0694 bits (131), Expect = 1.152e-6
Identity = 55/234 (23.50%), Postives = 111/234 (47.44%), Query Frame = 1
Query: 4231 RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQR--RSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRN 4926
            +K +  +QS++R+F+  +++ +++K    IQK A+GY+ R++    R  R+ +I+ K                       Y R +L R  Y R   + + IQ  ARG L R +                 H +R H+      A+++Q+ +RG L R+ + + R  II+ Q+ ++ F+AR+ ++++++ +  +  +        K++ L+N  I +Q+ +      +L RD  N
Sbjct:  775 KKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSK-----------------------YARGWLCRRRYLRLRHSISGIQTYARGMLARNKF----------------HAMRDHY-----RAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRID-----ELNRDNSN 953          

HSP 6 Score: 53.9138 bits (128), Expect = 2.358e-6
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 4939 IQKYVRGFLCRIKYQ--RQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNS--CVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSEL-KTFQNLKN 5409
            IQK+ RG+L R + Q  R+  A +IL ++ R +L  RR    + +   IQ + RG   R  F   ++    V IQ + +  L R+ Y + R+  I  Q  +RR+++R +F R+K     I  +        KY+  +  +I++Q+   R  EL +   NLK+
Sbjct:  804 IQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQ---RIDELNRDNSNLKH 956          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089745)

HSP 1 Score: 67.781 bits (164), Expect = 1.545e-10
Identity = 66/254 (25.98%), Postives = 122/254 (48.03%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK--IIQKYVKGYLARKKFVKLTKAIVVIQSAFRG-------YAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFL 2913
            C+++V +++      +   + I  +     +L ++R    K    ++QS  RR++ ++ +L+I + I  IQ + RGYL R   +++R++    I+ KY +G+L R+++++L  +I  IQ+  RG       +A R +Y      AV IQ F R ++ RR Y                       +KR R+ II Q  IR F+ RR F + K+    + H         +++ + N +I +Q+ +  L+  NS L
Sbjct:  735 CRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYR-----AVQIQRFVRGALARRAY-----------------------QKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRIDELNRDNSNL 954          

HSP 2 Score: 61.6178 bits (148), Expect = 1.154e-8
Identity = 54/177 (30.51%), Postives = 98/177 (55.37%), Query Frame = 1
Query: 2170 IIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS--ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKI--IQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYT-IQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKV 2685
            I I QSVV+R++ R +  +++K    IQK+ R YL R R +K++   A ++L  + R +L ++ YL++  SI  IQ   RG L R+ +  +R   +   IQ++V+G LAR+ + K  + I++ Q+A R +  RR +  ++ +A  I       S     Y+ L   +I +Q+ + ++
Sbjct:  778 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTI-------SHMENKYMGLENKIISMQQRIDEL 947          

HSP 3 Score: 60.077 bits (144), Expect = 3.592e-8
Identity = 49/160 (30.63%), Postives = 84/160 (52.50%), Query Frame = 1
Query: 3688 VTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK--KIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIK--FSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFI 4155
            +T++Q   RR + R+QF +  K++  +Q   R  + ++R QK  +  A L +SK+ +G+  R++YL  RHS+  IQ   R  + R  F +++  + A+ IQ+++RG + R+ Y  +   I + Q  IR FL R+        A  I H    Y   +N I
Sbjct:  778 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKI 937          

HSP 4 Score: 57.7658 bits (138), Expect = 1.565e-7
Identity = 51/164 (31.10%), Postives = 85/164 (51.83%), Query Frame = 1
Query: 3865 RKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIY--CSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNA--AIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYI 4344
            RKKY++      ++Q+  R F+YR+ FL I+     IQK+ RG++ R+      +  A  ++ K  RG+L R+       S + IQ + R    R  F   R+   A+ IQ+  R    R+ Y + R+ +I  Q+ IR+F+A +K+K+MK  A  I  +   Y+
Sbjct:  774 RKKYIT------IVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYM 931          

HSP 5 Score: 54.6842 bits (130), Expect = 1.346e-6
Identity = 55/234 (23.50%), Postives = 111/234 (47.44%), Query Frame = 1
Query: 4231 RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQR--RSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRN 4926
            +K +  +QS++R+F+  +++ +++K    IQK A+GY+ R++    R  R+ +I+ K                       Y R +L R  Y R   + + IQ  ARG L R +                 H +R H+      A+++Q+ +RG L R+ + + R  II+ Q+ ++ F+AR+ ++++++ +  +  +        K++ L+N  I +Q+ +      +L RD  N
Sbjct:  775 KKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSK-----------------------YARGWLCRRRYLRLRHSISGIQTYARGMLARNKF----------------HAMRDHY-----RAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRID-----ELNRDNSN 953          

HSP 6 Score: 53.5286 bits (127), Expect = 3.631e-6
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 4939 IQKYVRGFLCRIKYQ--RQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNS--CVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSEL-KTFQNLKN 5409
            IQK+ RG+L R + Q  R+  A +IL ++ R +L  RR    + +   IQ + RG   R  F   ++    V IQ + +  L R+ Y + R+  I  Q  +RR+++R +F R+K     I  +        KY+  +  +I++Q+   R  EL +   NLK+
Sbjct:  804 IQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQ---RIDELNRDNSNLKH 956          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Match: didum (gene:FBgn0261397 transcript:FBtr0089743)

HSP 1 Score: 67.781 bits (164), Expect = 1.559e-10
Identity = 66/254 (25.98%), Postives = 122/254 (48.03%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK--IIQKYVKGYLARKKFVKLTKAIVVIQSAFRG-------YAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFL 2913
            C+++V +++      +   + I  +     +L ++R    K    ++QS  RR++ ++ +L+I + I  IQ + RGYL R   +++R++    I+ KY +G+L R+++++L  +I  IQ+  RG       +A R +Y      AV IQ F R ++ RR Y                       +KR R+ II Q  IR F+ RR F + K+    + H         +++ + N +I +Q+ +  L+  NS L
Sbjct:  743 CRNIVMKWIQDEDKYRFGNTQIFFRAGQVAFLEQVRANLRKKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYR-----AVQIQRFVRGALARRAY-----------------------QKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRIDELNRDNSNL 962          

HSP 2 Score: 61.6178 bits (148), Expect = 1.136e-8
Identity = 54/177 (30.51%), Postives = 98/177 (55.37%), Query Frame = 1
Query: 2170 IIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS--ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKI--IQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYT-IQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKV 2685
            I I QSVV+R++ R +  +++K    IQK+ R YL R R +K++   A ++L  + R +L ++ YL++  SI  IQ   RG L R+ +  +R   +   IQ++V+G LAR+ + K  + I++ Q+A R +  RR +  ++ +A  I       S     Y+ L   +I +Q+ + ++
Sbjct:  786 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTI-------SHMENKYMGLENKIISMQQRIDEL 955          

HSP 3 Score: 60.077 bits (144), Expect = 3.389e-8
Identity = 49/160 (30.63%), Postives = 84/160 (52.50%), Query Frame = 1
Query: 3688 VTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK--KIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIK--FSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFI 4155
            +T++Q   RR + R+QF +  K++  +Q   R  + ++R QK  +  A L +SK+ +G+  R++YL  RHS+  IQ   R  + R  F +++  + A+ IQ+++RG + R+ Y  +   I + Q  IR FL R+        A  I H    Y   +N I
Sbjct:  786 ITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYMGLENKI 945          

HSP 4 Score: 58.151 bits (139), Expect = 1.439e-7
Identity = 51/164 (31.10%), Postives = 85/164 (51.83%), Query Frame = 1
Query: 3865 RKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIY--CSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNA--AIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYI 4344
            RKKY++      ++Q+  R F+YR+ FL I+     IQK+ RG++ R+      +  A  ++ K  RG+L R+       S + IQ + R    R  F   R+   A+ IQ+  R    R+ Y + R+ +I  Q+ IR+F+A +K+K+MK  A  I  +   Y+
Sbjct:  782 RKKYIT------IVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHMENKYM 939          

HSP 5 Score: 55.0694 bits (131), Expect = 1.260e-6
Identity = 55/234 (23.50%), Postives = 111/234 (47.44%), Query Frame = 1
Query: 4231 RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQR--RSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRN 4926
            +K +  +QS++R+F+  +++ +++K    IQK A+GY+ R++    R  R+ +I+ K                       Y R +L R  Y R   + + IQ  ARG L R +                 H +R H+      A+++Q+ +RG L R+ + + R  II+ Q+ ++ F+AR+ ++++++ +  +  +        K++ L+N  I +Q+ +      +L RD  N
Sbjct:  783 KKYITIVQSVVRRFVYRRQFLRIQKVINGIQKHARGYLARERTQKMREARAGLILSK-----------------------YARGWLCRRRYLRLRHSISGIQTYARGMLARNKF----------------HAMRDHY-----RAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQRID-----ELNRDNSN 961          

HSP 6 Score: 53.5286 bits (127), Expect = 3.543e-6
Identity = 48/162 (29.63%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 4939 IQKYVRGFLCRIKYQ--RQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNS--CVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSEL-KTFQNLKN 5409
            IQK+ RG+L R + Q  R+  A +IL ++ R +L  RR    + +   IQ + RG   R  F   ++    V IQ + +  L R+ Y + R+  I  Q  +RR+++R +F R+K     I  +        KY+  +  +I++Q+   R  EL +   NLK+
Sbjct:  812 IQKHARGYLARERTQKMREARAGLILSKYARGWLCRRRYLRLRHSISGIQTYARGMLARNKFHAMRDHYRAVQIQRFVRGALARRAYQKRRRNIIICQAAIRRFLARRKFKRMKAEAKTISHM------ENKYMGLENKIISMQQ---RIDELNRDNSNLKH 964          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Match: CG14692 (gene:FBgn0037836 transcript:FBtr0347183)

HSP 1 Score: 60.077 bits (144), Expect = 3.325e-8
Identity = 43/144 (29.86%), Postives = 69/144 (47.92%), Query Frame = 1
Query: 2245 LIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQK---------NYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIK--------AAVIIQSFYRSSVCR 2625
            L + + R +  RI Y +   + V++Q HFRRYL ++         N +    +IL+IQ  +R YL +     ++ S     +  +   A+ K     KA+VVIQ  +R Y K++    ++K        AA+IIQ  YR  V R
Sbjct:  175 LAEADQREFSSRISYIQ---SVVIIQRHFRRYLNERKIGRDKDKCNSVDYVAAILLIQRQVRRYLAKKRVAELKNS-----RDAQKADAKPKAADYMKAVVVIQRHYRIYLKKKQEQNRLKHGPVSLATAAIIIQRAYRRMVAR 310          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Match: aspm (abnormal spindle microtubule assembly [Source:ZFIN;Acc:ZDB-GENE-050208-620])

HSP 1 Score: 609.372 bits (1570), Expect = 8.551e-177
Identity = 559/2117 (26.41%), Postives = 1003/2117 (47.38%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCI-----FNTHLSKTKVEDINKNM----------PIYIE------------------ATKLLLSECKV-AIEKINSEV-TKDSLKFKDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEA-CFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKIL-VNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEI------------------------------KLFENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVII--VQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKK---------SAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTK---AIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRT----YLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYF----MGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRAL----LQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICR----KQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNET----RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFIC----QKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKL----KNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRR--IDLEQK--AARIIQNFYRGYTIRAHFLCQKNSCVTI------------------------QNYFKAYLIRKKYL----EIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFS----ELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFV----RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARK----RFLEIKSNIIIIQKFFR----RFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKR 6330
            D+ W+++QE  F  W+N I     F      TKV  ++  M          P   E                  A KL  SE  V AI+++  EV  K  L  KD   +K     + +   +++YN  WL +    +I  +  +SL SNN+      FI  ++LWN D+A + R   +    +     +L+R  L++ + +V  LD AK++ +   D  LF  D+  KSS ++L  F+  FL GEG + +  S+  L+VSH+QT +DE++F V  L+ D+  G+RL R+ ++  ++  +  KLR PA+   +K  N++LA++  K+ G  +    G  ID   I  GHREKTL LLW ++    ++ ++D ++L  EI                              + FE+P          LL+ WV +VC  Y++   N + +  DGR  C LIH+Y P +L   EI   TT T                               +   D   LLENEK NFQ+  + +  +GG P ++  E   N IP+ + +   L+F  +RL+DL    RAA  IQ  WR+Y+   L K   + H K +    +Q++ R+F+  ++        +  Q++ + Y AR ++  +KK         +A LIQK Y+ +  +   +K +SA  V+Q+ FR++  +K  L+   + L IQ   R  LC+  Y  +++    +Q + +G+L R KF  L K   A VVIQSAFR Y  R+  +   + AV+IQ ++R+ V R+     Y  ++ +V+++Q        ++ + +  RS ++IQ   R F  +R+FL  K +  +L+  +     G   RK+++ ++++ + +Q   R  + R       + A IIQ +++R+  +  F+  K A ++IQ + RA    +K    +  ++ AAII+Q  +R   +R++   +  +A +IQ  +R+ +C + +L  K + +VIQ+  + F   +                   + +  Y+++RK+TI +Q  +R    R+      +   V+Q   +MH+ R  F+  K   I IQ++ RA       +  Y++ K A + IQ  FR  K +  +  ++QAA V+Q +F+ +   K++R+ + + +V+Q+  R  + +    KQ+       I +QS  R ++ +K+  +K      I K  + Y  R  YL+ R++ I IQ  +R  +  +            Q++ R       YCS   A   +Q + RG   RK +N   ++AT+IQ  Y+ Y+ R  F   + A++VIQ+Q+R H +R++  E     ++  + IQ++ R  +A +   +   AAT IQ+    Y  RK ++T + + +  Q++ R  L  +  +    +       +    R   +R   +R+  AAT+IQ   R  ++  R    + AV  +Q  +RA+ I    +     +K+AA+ LQ   RG   R+   +      ++QS ++  I    +Q+LR +   VQ+ FR     ++ +      K+A++ +Q   R     +  +    A+ +IQ +VR  +  +++QR   A   LQRHFR   I+R+    L++K  AA I+Q  YRG   R H L Q +   TI                        Q  F+A  I ++ +    E +   + +Q   R   +R    ++  +  I+Q   R Y   ++Y++ K A I+IQ+ +R  +    + K++  ++  ++++Q  +R   +R+  + + +  V IQSY RR+  + K++ +K + +IIQ H R        R  Y+ + K  + IQ   R + +R      +++ + IQ+ +RM+ +   ++  + +  V+Q+  R    R     ++ ++++  + +Q++FR    R LA+RS          +QS +R  + + ++ K + A I IQ   +G+F R  Y  +Q   + +Q++ R   +    RK F+ ++ A++ +   +RG+LV                  L KR  A+IKIQ+  R +IQ++RY  L++  L  Q  +R +V +R
Sbjct:  675 DERWIEKQERGFTWWMNYILTPDDFKVATEVTKVNALSLTMGNDKFNIPKAPTKEEMSFRTYTARQRLNRLRRAACKLFTSEAMVKAIQRLELEVEAKRLLVRKDRHLWKDIGERQKVLNWLISYNPLWLRIGLE-TIYGEL-ISLESNNDVMGLAMFILGRLLWNPDLAAEFRHSKVPHLYRDGHEEALSRFTLKKLILLVCFLDKAKESRLIEHDPCLFCMDAEFKSSKDLLLAFSRDFLSGEGILSRHLSHLGLAVSHVQTPLDEFNFAVKKLAVDLKCGIRLVRVMELFTLDWTLSRKLRIPAISRLQKVHNVDLALQVLKNKGVDLRDEHGANIDSRDIVDGHREKTLNLLWKIIFAFQVEVLLDENQLKEEISFLRKTWRTKQKLASIMANNSVTVSRMKARRAFEHP-----SQKVTLLMDWVNAVCEFYSLKAENFTVSFSDGRILCYLIHHYHPGHLHAEEIQQRTTQTIECGHRGRVELNNSSSDSDCSFENLATMQSESVTVDFRELLENEKSNFQLVNTAVSYLGGVPAMINPEDMSNTIPNEKVVTCYLSFLCARLLDLRNETRAARVIQGAWRRYK---LQKDIALMHEKNLAATKIQALARKFILKRRLIRQNKAAVKIQTLWRGYSAREKLRVLKKERHYALQNAAATLIQKTYKAWRVKNLLKKNRSA-FVIQAAFRKWHAKK-MLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFRKEYMALKSASVRIQAMWRGRAERKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAVVIQRQYRAFRDGQKVHAEYTKIKRAAIILQSAYRGRRIRQELQRKNKAATLIQSVMRAHMCHQQFLAQKHAAIVIQQQFRAFTFGR-------------------MERSHYMRLRKATITMQAIYRGSKVRQNLKREHQAATVIQAQFRMHKVRIPFVAAKCAAILIQQHYRAYKVGKTVQATYLQMKNAAVVIQSAFRGMKVRNYLRKSHQAAKVIQAHFRGHSQLKKYRRQQWAASVLQQRFRATVTKNAVMKQYAAIKTATICIQSAFRGMVARKQIAEKQKCAKIIQKMYRAYKQRHDYLALRNATIRIQQQYRAVVSAR------------QQHQR-------YCSLRAAAITLQSSYRGLRARKEINRRQKAATVIQAAYKMYRTRVPFQAMKLASLVIQRQYRCHLLRKKARENFLKLKQSAVAIQAIYRGKLARRDLARRHFAATIIQRKYLAYKQRKCFLTLQAAVIFCQQHYRSILLTRHDRKDYLTKRRAVVAIQASFRGMNVRRQIRREHKAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANKIMRQEMAALQEKKSAALILQAAYRGKKTRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQERFRANRIMRQEMAALQEKKSAALILQAAYRGKKTRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTLQRHFRANKIMRQEMAALQEKKSAALILQAAYRGMKTR-HTLKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANRIMRQEMAALQEKKSAALILQAAYRGMKTRQTLKQMHQAATIVQATYRAYSGRKRYLEMKCAAIDIQQRYRAVNAAKQQRKSYLKVRQGALVLQACYRGRKVRRNLQLQCQAAVLIQSYFRRHKEMVKYQAMKLSAVIIQSHFRSYIQARADRKNYQHLRKSAIVIQAAFRGHSLRRHLARKQEASVIIQASFRMYQQRSAFKKQRWAARVLQQRFRALKLRDEHVCQYQQVRNAAVCLQRYFRGMKGRELARRS-----KAARTIQSFLRMSVQRQRFMKEKAAAIAIQSAYRGHFARAQYTRMQAGTVLIQKWYRSRKLVQEDRKRFVAVRQATLTLQSALRGMLV----------------RRLAKRRRAAIKIQSVMRMHIQRKRYVTLRASALKFQAHYRMLVAQR 2719          

HSP 2 Score: 424.861 bits (1091), Expect = 7.686e-119
Identity = 467/1854 (25.19%), Postives = 844/1854 (45.52%), Query Frame = 1
Query: 2011 YRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFK----SIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYL----VQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFR----GYAKRRNYTIQIKAAVIIQSFYRSSVCRR--------------------------------------------------TYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRR----KQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALI----QRRKFQYLRNAAIIIQKTFRCYSVRKK-----------------------FLIQYYSAIVIQKNVRSIICQK----NYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQ---YLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQ----AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIR----MIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRG--FIKRKIYCSQT--TAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ----YNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYL----IRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR-------RYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKT----------------------IFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR--------RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFV----RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR----SYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKI----FLKLKNASIIISKHVRGVLVRNHFQKNK-------------QHMKI----------FAQENLRKRLEASIKIQAYFRCYIQKRRYC-----------LLKSY-------TLLIQQRWRFIV-------LKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSIS 6879
            +R+A  IQ  +R++      + HF+   +  I++Q   R  +   KF+    ++K   +  Q++ +    R +IS++ + A +IQ NYRR+L + R+ ++K A VV+Q  +R +     V   Y KI R+ +I+Q+  RG   R   +R  K+  +IQ  ++ ++  ++F+    A +VIQ  FR    G  +R +Y    KA + +Q+ YR S  R+                                                  TYL ++ + ++IQ     +  +  L K  ++  +IQ + RG    + + + + A ++L+  F   + +    KQ+  ++ + I +Q   R +  R     KQK A IIQK ++ Y  + +++A ++ATI IQ + RA++    Q +++  LR AAI +Q ++R    RK+                       F     +++VIQ+  R  + +K    N+LK+KQS + IQ   +G L ++   +      I Q   RKYL  KQ   +L ++ + I  Q+H+R+I      RK +L  R+  + +Q   +    R++  +       IQ ++R  +   R+ + + AV  +Q++FR+ K  +Q +   Q    AA ++Q  ++    ++  ++M ++ T+IQ + R  I   +FQ+    V  +Q + R    M       Q+K +A L +    +G   R+       +  +IQ+  R  +    F  ++++   +Q++ R    +++++   Q   +A  ++Q   RG   R TL   HQ+AT+IQ   R   +   F   R A   +Q++FR + I +Q      E +   + +Q+  R     Q  KQM +AAT +Q   + Y  RK+Y+  + +A+ IQ+  R   + K                     R  Y +    A ++Q   RG  VR+ + ++ +A  +IQ+++R H     +   K +A+ +Q + R Y+     RKN+   R   I++Q+  +G   R+   + + +S+I+Q  FR +     F K + A+  +Q+  R         CQ   Y+  RNA++ +Q+Y RG   R +  R+  AA  +Q   R  +  +R   E+ AA  IQ+ YRG+  RA +   +   V IQ ++++  +    RK+++ +RQ T                      I IQ ++R +I R R++ L+ S +  Q   R     RKY + + A + +QK++R        R S LKT QN+K     +Q   R +I  K F++ R   + IQ+  R  I   +F  +K   L+IQKH R   +    R K+ ++ +  V IQ+  RA   R   +  + + + IQ+++R     +NY L + +   I++  +    R +FL ++ ++ +IQ+ +R  L+ R     + + +  +I++Q+L RG+  +   QK  TA + IQ   +G   R+ Y   + + I LQR  R   + ++      +  NA+I I    RG L R   ++                H+            +A ++ +K++ + + IQ  FR  +Q+++Y             ++S+         +IQ   R ++       L+R  +  Q +WRG    C          IS +R R  E N+R  + + +      ALT L   +   A +L  L  LE  T LS E C+ L+ES A   +  L+  CNR V  +E+++  I V  NL K       V + D      + L++  +YR     K   KG +IF  TC LLVLL++ E++++ 
Sbjct: 1490 HRSALVIQTAFRRFTA----QRHFLCLKRSAIVLQQRYRAKVHGGKFRKEYMALKSASVRIQAMWRGRAERKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAVVIQRQYRAFRDGQKVHAEYTKIKRAAIILQSAYRGRRIRQELQRKNKAATLIQSVMRAHMCHQQFLAQKHAAIVIQQQFRAFTFGRMERSHYMRLRKATITMQAIYRGSKVRQNLKREHQAATVIQAQFRMHKVRIPFVAAKCAAILIQQHYRAYKVGKTVQATYLQMKNAAVVIQSAFRGMKVRNYLRKSHQAAKVIQAHFRGHSQLKKYRRQQWAASVLQQRFRATVTKNAVMKQYAAIKTATICIQSAFRGMVARKQIAEKQKCAKIIQKMYRAYKQRHDYLALRNATIRIQQQYRAVVSARQQHQRYCSLRAAAITLQSSYRGLRARKEINRRQKAATVIQAAYKMYRTRVPFQAMKLASLVIQRQYRCHLLRKKARENFLKLKQSAVAIQAIYRGKLARRDLARRHFAATIIQ---RKYLAYKQRKCFLTLQAAVIFCQQHYRSILLTRHDRKDYLTKRRAVVAIQASFRGMNVRRQIRREHKAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANKIMRQEMAALQEKKSAALILQAAYRGKKTRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQERFRANRIMRQEMAALQEKKSAALILQAAYRGKKTRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTLQRHFRANKIMRQEMAALQEKKSAALILQAAYRGMKTRHTLKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANRIMRQEMAALQEKKSAALILQAAYRGMKTRQTLKQMHQAATIVQATYRAYSGRKRYLEMKCAAIDIQQRYRAVNAAKQ-------------------QRKSYLKVRQGALVLQACYRGRKVRRNLQLQCQAAVLIQSYFRRHKEMVKYQAMKLSAVIIQSHFRSYIQARADRKNYQHLRKSAIVIQAAFRGHSLRRHLARKQEASVIIQASFRMYQQRSAFKKQRWAARVLQQRFRALKLRDEHVCQ---YQQVRNAAVCLQRYFRGMKGR-ELARRSKAARTIQSFLRMSVQRQRFMKEKAAAIAIQSAYRGHFARAQYTRMQAGTVLIQKWYRSRKLVQEDRKRFVAVRQATLTLQSALRGMLVRRLAKRRRAAIKIQSVMRMHIQRKRYVTLRASALKFQAHYRMLVAQRKYRRLQAATVTLQKHYRSHRATLEQRCSYLKTLQNIKK----LQARVRGHIAYKRFQRLRTCAITIQANYRGMIERRRFHQLKECALVIQKHYRAFILCQKERSKFLQLRQSAVVIQRAYRAYQKRQNAMKAQ-AALKIQAWFRGRLARRNYILKQAASATIRRCIQARRQRSKFLAVQHSVRVIQQRWRETLSSRKQHAEFLKLIKSVIYIQALWRGRRLRDSIQKQATAAVKIQSAFRGSIQRRRYHQQRNAAITLQRHFRVLRLARVKEENLRRRHNAAIYIQALWRGWLARQQVKEMAFAARRLRFTAAVYHHLSAIKIQRAVRAHWALKSAKKKISSVLYIQQCFRAKLQRKKYLKDREDIIKTQRAVRSWLHRRNQAASIIQHAVRKLLFRRRKERLQRGIIRAQALWRGH---CSRKLHDTNKVIS-MRQRLREVNQRVKEEDKLCNKTTTALTYLLGLQ-NYAFILAALKHLETATRLSPECCERLVESGATHTIFTLIRSCNRSVPSMEIITLSIQVLLNLSKYHRTIDAVYDVDNSVETLLDLLQ--IYREKAGDKVADKGGSIFTKTCFLLVLLVQDERRAME 3301          

HSP 3 Score: 387.111 bits (993), Expect = 2.765e-107
Identity = 407/1615 (25.20%), Postives = 738/1615 (45.70%), Query Frame = 1
Query: 1984 SRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQ----SIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYL----VQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRR----NYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGF----INRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA-----LIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRH-SVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ----YNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKN------VRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFIC----QKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR---------------------------SSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLC----RIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV----RTRFLNIKKSI----------------------INIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLA----KRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTL-----------------------LIQQRWR-----------FIVLKRSAVVIQRIWRGRQLR 6375
            S+  +L   + A+  IQ  +R Y    L +       +  +++Q    + V+R    K++  IK  +++ Q+  + +  R  +++  +SA++IQ  +RR+  +  +  +K + +VLQ  +R  +     +K Y+ +  + + IQ   RG   R    ++ +  KIIQ   + +L + +F+++ +A VVIQ  +R +   +     YT   +AA+I+QS YR    R+      K+  +IQ V+   +  ++   +  + I+IQ+  R F    + R ++++ + A   ++  + G   R+   +   +  ++Q   RM  +R                         FVA K A ILIQ   RA      +Q    Q ++NAA++IQ  FR   VR      + +A VIQ + R     K Y + + +  V+Q+  +                   + V K  + KQY  ++ +TI IQ  FR + ARKQ    +K   ++QK  + ++ R  +L L++  I IQ+  RA++    Q +RY   + A I +Q  +R  + +K+I    +AATV+Q  +K Y  +  F+ MK +  VIQ+  R  + RK+                    ++ + K   + + I    +G  AR+  L+ RH +  +IQ  +  +  RK FL+++ + I  Q++ R  +     RK Y ++  A+  IQ + RG  VR+ +   H++AT+IQ   R   +   F   R A   +Q++FR + I +Q      E +   + +Q+  R     Q  KQM +AAT IQ   +  I+  ++   R +   +Q+       +RQ ++    +   + I+      ++   R   K+   AAT+IQ   R  ++  R    + AV  +Q  +RA+ I    +     +K+AA+ LQ   RG   R    +      ++QS ++  I    +Q+LR                           S+++I+Q  +RG    +   ++  A+  +Q   R Y   K Y + + A+I IQ+  R        R  Y +    A++LQ  +R   + R + L+ +AA +IQ+++R +     +   K S V IQ++F++Y+     RK Y  +R+  I IQ   R +  R    R + + +IIQ   R Y     + KQ+ A   +Q+ FR    R   +  +Q ++NA++ +Q+ FR    R E  ++ K    IQS++R  +   +F   K+A + IQ   RG F R +Y ++    V IQK  R+  +    R RF+ ++++                       I IQS  RMH + K Y  ++ S    Q + R  +A++++  +++  + +QK +R   A    + SY + L  I  +Q+ VRG +A  ++Q++RT  I IQ   +G   R+ +  L++  + +Q+  R F++    R  FL+L+ ++++I +  R       +QK +  MK           +A++KIQA+FR  + +R Y L ++ +                        +IQQRWR           F+ L +S + IQ +WRGR+LR
Sbjct: 1408 SKFQNLKKRHHASVVIQSAFRAY----LIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFRKEYMALKSASVRIQAMWRGRAERKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAVVIQRQYRAFRDGQKVHAEYTKIKRAAIILQSAYRGRRIRQELQRKNKAATLIQSVMRAHMCHQQFLAQKHAAIVIQQQFRAFTFGRMERSHYMRLRKATITMQAIYRGSKVRQNLKREHQAATVIQAQFRMHKVRIP-----------------------FVAAKCAAILIQQHYRAYKVGKTVQATYLQ-MKNAAVVIQSAFRGMKVRNYLRKSHQAAKVIQAHFRGHSQLKKYRRQQWAASVLQQRFR-------------------ATVTKNAVMKQYAAIKTATICIQSAFRGMVARKQIAEKQKCAKIIQKMYRAYKQRHDYLALRNATIRIQQQYRAVVSARQQHQRYCSLRAAAITLQSSYRGLRARKEINRRQKAATVIQAAYKMYRTRVPFQAMKLASLVIQRQYRCHLLRKK-------------------ARENFLKLKQSAVAIQAIYRGKLARRD-LARRHFAATIIQRKYLAYKQRKCFLTLQAAVIFCQQHYRSILLTRHDRKDYLTKRRAVVAIQASFRGMNVRRQIRREHKAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANKIMRQEMAALQEKKSAALILQAAYRGKKTRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQERFRANRIMRQEMAALQEKKSAALILQAAYRGKK--TRQALKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTLQRHFRANKIMRQEMAALQEKKSAALILQAAYRGMKTRHTLKQMHQAATIIQSHVRMRILNLRFQRLRWAVCTVQQRFRANRIMRQEMAALQEKKSAALILQAAYRGMKTRQTLKQMHQAATIVQATYRAYSGRKRYLEMKCAAIDIQQRYRAVNAAKQQRKSYLKVRQGALVLQACYRGRKVRRNLQLQCQAAVLIQSYFRRHKEMVKYQAMKLSAVIIQSHFRSYIQARADRKNYQHLRKSAIVIQAAFRGHSLRRHLARKQEASVIIQASFRMYQQRSAFKKQRWAARVLQQRFRALKLRDEHVCQYQQVRNAAVCLQRYFRGMKGR-ELARRSKAARTIQSFLRMSVQRQRFMKEKAAAIAIQSAYRGHFARAQYTRMQAGTVLIQKWYRSRKLVQEDRKRFVAVRQATLTLQSALRGMLVRRLAKRRRAAIKIQSVMRMHIQRKRYVTLRASALKFQAHYRMLVAQRKYRRLQAATVTLQKHYRSHRATLEQRCSYLKTLQNIKKLQARVRGHIAYKRFQRLRTCAITIQANYRGMIERRRFHQLKECALVIQKHYRAFILCQKERSKFLQLRQSAVVIQRAYRA------YQKRQNAMKA----------QAALKIQAWFRGRLARRNYILKQAASATIRRCIQARRQRSKFLAVQHSVRVIQQRWRETLSSRKQHAEFLKLIKSVIYIQALWRGRRLR 2936          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Match: CR628370.1 (pep chromosome:GRCz11:CHR_ALT_CTG22_1_10:23552945:23582232:1 gene:ENSDARG00000115607.1 transcript:ENSDART00000191456.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR628370.1)

HSP 1 Score: 299.286 bits (765), Expect = 4.968e-83
Identity = 235/825 (28.48%), Postives = 411/825 (49.82%), Query Frame = 1
Query:  712 ATKLLLSECKV-AIEKINSEV-TKDSLKFKDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEA-CFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKIL-VNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVL---------------------SRHYIDAVIDRDKL-ISEIKL---FENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVII--VQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKK--------------------SAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQ---KNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK----KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK----VVH-----KVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLR 2901
            A KL  SE  V AI+++  EV  K  L  KD   +K     + +   +++YN  WL +    +I  +  +SL SNN+      FI  ++LWN D+A + R   +    +     +L+R  L++ + +V  LD AK++ +   D  LF  D+  KSS ++L  F+  FL GEG + +  S+  L+VSH+QT +DE++F V  L+ D+  G+RL R+ ++  ++  +  KLR PA+   +K  N++LA++  K+ G  +    G  ID   I  GHREKTL LLW ++                     ++  + +++  + + +S +K    FE+P          LL+ WV +VC  Y++   N + +  DGR  C LIH+Y P +L   EI   TT T                         A +   + LLENEK NFQ+  + +  +GG P ++  E   N IP+ + +   L+F  +RL+DL    RAA  IQ  WR+Y+   L K   + H K +    +Q++ R+F+  ++        ++ Q++ + Y AR ++  + K                    +A+ IQ  YR  LC+ +Y ++K   V +Q+ FR +L +   +N  K + + ++IQ+  R YL R    +++++  +IQ++ +  + RK    ++ ++  A++V+Q+AFRG+  R++     ++A++IQ+ +R    +R +L L++S I++Q+     VH     K   ++K+ +  R   IIQ   R  + +  FL+ K A       + G+  RK  L   N VI +++ LR ++ R
Sbjct:   19 ACKLFTSEAMVKAIQRLELEVEAKRLLVRKDRHLWKDIGERQKVLNWLISYNPLWLRIGLE-TIYGEL-ISLESNNDVMGLAMFILGRLLWNPDLAAEFRHSKVPHLYRDGHEEALSRFTLKKLILLVCFLDKAKESRLIEHDPCLFCMDAEFKSSKDLLLAFSRDFLSGEGILSRHLSHLGLAVSHVQTPLDEFNFAVKKLAVDLKCGIRLVRVMELFTLDWTLSRKLRIPAISRLQKVHNVDLALQVLKNKGVDLRDEHGANIDSRDIVDGHREKTLNLLWKIIFAFQVSNQLKEEISFLRKTWRTKQKLASIMANNSVTVSRMKARQAFEHP-----SQKVTLLMDWVNAVCEFYSLKAENFTVSFSDGRILCYLIHHYHPGHLHAEEIQQRTTQTIECGHRGRVELNNSSSDSDCSFENLATMQSGKELLENEKSNFQLVNTAVSYLGGVPAMINPEDMSNTIPNEKVVTCYLSFLCARLLDLRNETRAARVIQGAWRRYK---LQKDIALMHEKNLAATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKEYMRKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAA-----LWRGHCSRK--LHDTNKVISMRQRLREVNQR 826          

HSP 2 Score: 135.961 bits (341), Expect = 3.027e-31
Identity = 138/538 (25.65%), Postives = 247/538 (45.91%), Query Frame = 1
Query: 5377 SELKTFQNLKNASIIIQKNFRCYILRKE---FKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIK--------------------LVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMK---QSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLE-----ASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSIS 6879
            + L   +N   A+ +IQ  +R Y L+K+     +K     KIQ+  R++I   +      A ++IQ   RG   R K K ++K                      + IQ   R  + + ++L +K+  + +Q+++R H +   +Q +K    +  VIQ   R ++ RK   ++K N ++IQ++FR  + +++ Q+                   +Y ++++A +++Q   +G+ +RK      +S + +Q   R F  ++ FL LK ++I++ +  R           K H   F +E +RK++      A I IQ+ +R ++++ R                F+ +KR+A     +WRG   R   +  K+   IS +R R  E N+R  + + +      ALT L   +   A +L  L  LE  T LS E C+ L+ES A   +  L+  CNR V  +E+++  I V  NL K       V + D      + L++  +YR     K   KG +IF  TC LLVLL++ E++++ 
Sbjct:  493 ARLLDLRNETRAARVIQGAWRRYKLQKDIALMHEKNLAATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQK-------------------RYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRA----------KVHGGKFWKEYMRKKISQLHRFAKI-IQSNYRRHLEQTR----------------FLQMKRAA-----LWRGHCSRKLHDTNKV---IS-MRQRLREVNQRVKEEDKLCNKTTTALTYLLGLQ-NYAFILAALKHLETATRLSPECCERLVESGATHTIFTLIRSCNRSVPSMEIITLSIQVLLNLSKYHRTIDAVYDVDNSVETLLDLLQ--IYREKAGDKVADKGGSIFTKTCFLLVLLVQDERRAME 972          

HSP 3 Score: 112.464 bits (280), Expect = 4.242e-24
Identity = 78/281 (27.76%), Postives = 153/281 (54.45%), Query Frame = 1
Query: 3589 KKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEM----KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYR---HSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKI----YCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR---------KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQR 4371
            K+++I  N+AA V+Q  ++ Y         +E V  + K  R    RK   K+M       + +Q+  RM + K++Y +     + +  + +G+  R K+ + +   H+ +VIQ++FR ++ RK    +K +A++IQ++ R  ++RK     Y    +A+ V+Q   RG+ VRK++  HH+SA +IQ  +R +  +++F+C + +AIV+Q+++R         K Y+R++ ++  +    IQS  R+ +   ++ QMK+AA +     +G+  RK + T +
Sbjct:  544 KRRLIRQNKAAVVIQTLWRGY-------SAREKVKNLLKKNRSAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKEYMRKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAALW-----RGHCSRKLHDTNK 812          

HSP 4 Score: 101.293 bits (251), Expect = 1.210e-20
Identity = 92/346 (26.59%), Postives = 172/346 (49.71%), Query Frame = 1
Query: 4573 EQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKL--KNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQK---NSCVTIQNYFKAYLIRKKYLEIRQKTIFIQ----CLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYI---------LRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATL 5556
            E +A R+IQ  +R +              KLQK+I   +  KN   T+     +Q+L + FI ++   +   +++++Q ++RG++A +K   L  KN S   +K    + +  L R+T  A++ IQ + R  LC+                 R+YL ++R       A  +Q ++RG+  R+ F   K   ++ V IQ+ F+AYLIRK+  +++Q  + IQ      V+R   + R+  +K +V+++Q   RG+   +   +  ++ + IQ  FRRF+  + F  LK ++I++Q+ +R  +         +RK+  +  +    IQS  RR++  ++F  +K A L
Sbjct:  501 ETRAARVIQGAWRRY--------------KLQKDI-ALMHEKNLAATK-----IQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAAFRK---WHAKKMLERNT--AALRIQAWYRMQLCK-----------------RQYLEMKR------KAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKEYMRKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAL 798          

HSP 5 Score: 97.4413 bits (241), Expect = 1.535e-19
Identity = 73/282 (25.89%), Postives = 145/282 (51.42%), Query Frame = 1
Query: 4489 SVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLK---NASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL----AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL---------IRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVI 5280
            ++   K LAAT IQ +AR +++++R++ + KA  +IQ  +R ++ R     + +KN +   +K     ++ +N    R     +Q+  +  + ++ Y +++  ++ VQ  FRG     KF  LK   +AS+ IQ   R Y   K     +  +++IQ++ R  + R   Q++      A ++LQ  FR + + + +    ++A +IQ  +R +T + HFLC K S + +Q  ++A +         +RKK  ++ +    IQ   RR++ + RFL++K + +
Sbjct:  522 ALMHEKNLAATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAAFRKWHAKKMLERNTAALR-----IQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKEYMRKKISQLHRFAKIIQSNYRRHLEQTRFLQMKRAAL 798          

HSP 6 Score: 84.3445 bits (207), Expect = 1.566e-15
Identity = 104/374 (27.81%), Postives = 178/374 (47.59%), Query Frame = 1
Query: 3901 VIQNSFRCFMYRK---MFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVR---KTLNSHHQSATLIQHFYRSYKIRKNFICKRN-AAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKK---AATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQL 4992
            VIQ ++R +  +K   +      +A  IQ   R FI ++    Q  A  VIQ   RG+  R   K L   ++SA      +R +  +K  + +RN AA+ IQ  +R    ++QY E ++K + +Q+  R  +   K++ +KK   A+  IQ   + Y+IRK+    +++AV+IQ+  R  + RK+ Q             R F ++S       A  ++Q   RG+ VRK +    ++  +IQ  +R  T + HF+C K +AI LQ+  R  +    F              K ++ +K  Q  R + II Q  +R      +FL++K A++      R +C  KL+ DT N  I +++ +R    R+K + +L
Sbjct:  507 VIQGAWRRYKLQKDIALMHEKNLAATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAA-----FRKWHAKK--MLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQK------------RYFEIKS-------AVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKF-------------WKEYMRKKISQLHRFAKII-QSNYRRHLEQTRFLQMKRAALW-----RGHCSRKLH-DT-NKVISMRQRLREVNQRVKEEDKL 833          

HSP 7 Score: 82.8037 bits (203), Expect = 4.621e-15
Identity = 85/322 (26.40%), Postives = 156/322 (48.45%), Query Frame = 1
Query: 4222 NETRKKVIFIQSLIRQF-----IAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXX---XYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQK---NAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQK----LRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCV 5142
            NETR   + IQ   R++     IA+   K +  AAT IQ +A+ +I++++ + Q ++AV+IQ   R Y +R+  +              + ++ L R+    ++ A   +Q   R YL  KR     KAV  +Q ++R H  RS F   K   +A++ +Q   R YLIRK  ++ +   +L+Q   +  + RK  QK    ++S+ +++Q  FRG+   K   +   +++ IQ   RR+   + +   + ++IV+Q+  R  +   K+ ++ +   I Q H              + A+IIQ+ YR +  +  FL  K + +
Sbjct:  500 NETRAARV-IQGAWRRYKLQKDIALMHEKNL--AATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKNRSAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKR-----KAV-CVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKEYMRKKISQLH--------------RFAKIIQSNYRRHLEQTRFLQMKRAAL 798          

HSP 8 Score: 76.2554 bits (186), Expect = 5.299e-13
Identity = 70/271 (25.83%), Postives = 128/271 (47.23%), Query Frame = 1
Query: 2440 KSTKIIQKYVKGYLARKKFVKLTK---AIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQF--LKMRN-SVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ----YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQK 3222
            ++ ++IQ   + Y  +K    + +   A   IQ+  R +  +R    Q KAAV+IQ+ +R    R    NL K     +    +    +K+ +R  + + IQ + R  + +R +L+ K     ++ +F G+L+R +F  LK R+ + +++Q   R                        Y  +KE    K   +LIQ   RA +QR+  Q     +++A +++Q  FR + VRK     + SA+VIQ   R    Q+++L +K+S +V+Q+
Sbjct:  503 RAARVIQGAWRRYKLQKDIALMHEKNLAATKIQALARKFILKRRLIRQNKAAVVIQTLWRGYSAREKVKNLLKKN---RSAAFRKWHAKKMLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRA-----------------------YLIRKELSKMKQNAVLIQRWFRACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQ 747          

HSP 9 Score: 61.6178 bits (148), Expect = 1.261e-8
Identity = 63/273 (23.08%), Postives = 127/273 (46.52%), Query Frame = 1
Query: 2731 IQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFL---IQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKN 3540
            IQ   R FI +R  ++   A  +++  + GY  R+   K++N   LL+KN R  + R                  ++ AKK  + + +A + IQ   R  + +R++  ++  A+ +Q  FR +  R KF     ++++++VIQ   R+ + +K   K+KQ+ ++IQ+  +                   + V++   QK+Y +++ + +++Q  FR    RK      +  +V+Q   +    ++ FL LK   I +Q+  RA +   ++ K 
Sbjct:  534 IQALARKFILKRRLIRQNKAAVVIQTLWRGYSARE---KVKN---LLKKN-RSAAFR------------------KWHAKK-MLERNTAALRIQAWYRMQLCKRQYLEMKRKAVCVQAWFRGHLQRSKFQNLKKRHHASVVIQSAFRAYLIRKELSKMKQNAVLIQRWFR-------------------ACVQRKAEQKRYFEIKSAVLVLQAAFRGWKVRKSVAQHHRSALVIQTAFRRFTAQRHFLCLKRSAIVLQQRYRAKVHGGKFWKE 761          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 74.3294 bits (181), Expect = 1.474e-13
Identity = 51/145 (35.17%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 2386 IQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLN--LRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEH 2808
            IQ  +RG+L R  Y++IRKS   +Q+Y +GYLAR+  + ++LT+A V+ Q  +R    RR Y    +A + IQ+F R    RR Y    L    +IIQK V   L ++K ++   + I+IQ + R    +R   + K      EH
Sbjct:  119 IQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEH 263          

HSP 2 Score: 71.2478 bits (173), Expect = 1.532e-12
Identity = 46/130 (35.38%), Postives = 79/130 (60.77%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR--SSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRD--TRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK 5028
            A IK+QK +RG+L R  + + R   I +Q   +G++AR+  + LR   +++I QK +R     +++L+++ A I IQ   R     +LY++    + +++IQK VRG+L R KYQR   AAI++Q  +R+
Sbjct:  115 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRR 244          

HSP 3 Score: 69.707 bits (169), Expect = 4.384e-12
Identity = 48/141 (34.04%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 2200 YLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQK--NYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVK--LTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYR 2610
            YL + R  K + + I IQK  R +L RIRY KI+ + + LQ + R YL ++    L++ R+ +I Q   R    R  Y R+R++   IQ + +G   R+ + +  L    ++IQ   RG+  R+ Y     AA++IQ FYR
Sbjct:  103 YLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 243          

HSP 4 Score: 65.0846 bits (157), Expect = 1.840e-10
Identity = 42/135 (31.11%), Postives = 78/135 (57.78%), Query Frame = 1
Query: 5482 CVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL---VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR 5871
            C+KIQ  +R ++   +++ I+ + + +Q++ RG   R +Y ++++L    V  QK  R   VR  +L +++++I IQ+F R  +  + YQ  L+     +IQK  R ++ RK++   +   I+IQ F+RR  AKR
Sbjct:  116 CIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKR 249          

HSP 5 Score: 64.6994 bits (156), Expect = 2.639e-10
Identity = 48/148 (32.43%), Postives = 76/148 (51.35%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQ 3150
            +CI IQK +RG++ R  + K + +   L+ Y  GYL R+  + L++  + ++ QK  RM+ +R                       +E++  + A I IQ   R +  RR +Q   L + A+IIQKT R + VRKK+    Y+AIVIQ
Sbjct:  115 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVR-----------------------REYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 239          

HSP 6 Score: 64.3142 bits (155), Expect = 3.613e-10
Identity = 56/164 (34.15%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQ--KAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK 5406
            R A I IQK VRG+L RI+Y++   +AI LQR+ R YL  R  ++ +  +AA I Q  YR   +R  +L  + + +TIQ + +   IR+ Y E                    FL L    +IIQK  RG+   +KY + + A I IQ  +RR    +  + LK
Sbjct:  113 RFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQE--------------------FL-LHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLK 255          

HSP 7 Score: 62.7734 bits (151), Expect = 1.166e-9
Identity = 53/150 (35.33%), Postives = 77/150 (51.33%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQL---LAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR---AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
            K + A I IQK VR + Q   YR  R ++I +Q+Y RG+L R +Y   L    AA+I Q+ +R   + R     ++A   IQ F RG  IR     FL    + + IQ   + +L+RKKY   R   I IQC  RR  ++ +  +LK+  
Sbjct:  111 KFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMI-IQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEA 258          

HSP 8 Score: 59.6918 bits (143), Expect = 9.585e-9
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARK--KYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIK--VIQKNIRGFLVRKTLNSHHQSATLIQHFYR 4128
            I +Q  +R  + + RY+K   + +T+ ++ +GY AR+  + L    + ++ Q  +R    R+ +L ++ + I IQ + RG   R++Y       K  +IQK +RG+LVRK       +A +IQ FYR
Sbjct:  117 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 243          

HSP 9 Score: 59.6918 bits (143), Expect = 9.853e-9
Identity = 43/160 (26.88%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 3130 YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK---MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            ++ I IQK VR  + +  Y KI++S + +Q++ +G+                  L R+Y    + L++ ++ +I QK +R +  R+++L  R+  I +Q + +   + +  Q+FL L  + + IQK +R  L R++Y +++ A I IQ  +R  + K+Q+
Sbjct:  114 FACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGY------------------LARRY---AEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFL-LHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 251          

HSP 10 Score: 58.5362 bits (140), Expect = 2.803e-8
Identity = 47/142 (33.10%), Postives = 76/142 (53.52%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHK--KFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL--AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR 5094
             YL +    + R   I +Q  ++G++ R  Y+K+R S+I +Q+  RG+ A +  + L+L  A++  QK  R     + Y   R A I IQ + RG   R  YQ  LL   A+I+Q+  R +L+ ++    + AA +IQ FYR
Sbjct:  102 AYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 243          

HSP 11 Score: 58.5362 bits (140), Expect = 2.907e-8
Identity = 42/137 (30.66%), Postives = 84/137 (61.31%), Query Frame = 1
Query: 2995 ATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK--KFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXX--XXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQF 3393
            A I IQ  VR  +QR +++ +R +AI +Q+  R Y  R+  + L    +A++ QK  R +  ++ YL+++++V+ IQ  T+G  +++ Y++  +  + +I Q  VR +L++K+Y + R + I+IQ  +R + A++Q 
Sbjct:  115 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 251          

HSP 12 Score: 55.4546 bits (132), Expect = 2.560e-7
Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKI--FLKLKNASIIISKHVRGVLVRNHF 6153
            L KL+  K R A I IQKTV+G+  R  Y+ ++KS I LQR+ RG+L R+    L+L  A++I  K  R V VR  +
Sbjct:  104 LEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREY 180          

HSP 13 Score: 53.9138 bits (128), Expect = 8.594e-7
Identity = 36/116 (31.03%), Postives = 63/116 (54.31%), Query Frame = 1
Query: 5899 IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIR----------------KHYKILQ---------KSVIQLQRFIRGFLIRKIFLK--LKNASIIISKHVRGVLVRNHFQKNK 6165
            I +Q  VRG L +++Y+K+R + I +Q+  +GY  R                K Y+++Q         ++VI +Q F RG  IR+++ +  L + ++II K VRG LVR  +Q+++
Sbjct:  117 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSR 232          

HSP 14 Score: 53.1434 bits (126), Expect = 1.714e-6
Identity = 46/167 (27.54%), Postives = 81/167 (48.50%), Query Frame = 1
Query: 5236 YISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKN-----FRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKII--KLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYR 5715
            Y+ + R  + + + I IQK  RG+    +Y K +K+ I +Q+       RR++E+     L  A++I QK +R   +R+E             Y+R          ++ A + IQ   RG+F+R  Y++ +     + IQK +R  +VR ++   + + I IQ FYR
Sbjct:  103 YLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEM---LRLTRAAVICQKQYRMVQVRRE-------------YLR----------VRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 243          

HSP 15 Score: 52.7582 bits (125), Expect = 2.191e-6
Identity = 44/154 (28.57%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS--CKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFR 3921
            K +   I IQK +R  LQR RY K +K+ I +QR  R    +   +++   +AA + QK ++    ++++ +++ +V  IQ + R +  R+ +Q+      LL  K                 + I K V+G+  RKKY   R++ IVIQ  +R
Sbjct:  111 KFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQE-----FLLHHK----------------AMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 243          

HSP 16 Score: 51.2174 bits (121), Expect = 7.050e-6
Identity = 46/146 (31.51%), Postives = 75/146 (51.37%), Query Frame = 1
Query: 3883 YRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQ---TTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRK---NFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMK 4302
            +R + I IQ + R ++ R  +  I+ SAI +Q+Y RG++ R+ Y      T A  + QK  R   VR+      ++   IQ F R   IR+    F+   + A++IQK  R   +R++Y  +R   I IQ   R+  A ++ KQ+K
Sbjct:  112 FRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARR-YAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLH-HKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLK 255          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 78.1814 bits (191), Expect = 1.676e-13
Identity = 57/170 (33.53%), Postives = 90/170 (52.94%), Query Frame = 1
Query: 2386 IQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLN--LRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNL 2883
            IQ  +RG+L R  Y++IRKS   +Q+Y +GYLAR+  + ++LT+A V+ Q  +R    RR Y    +A + IQ+F R    RR Y    L    +IIQK V   L ++K ++   + I+IQ + R    +R   + K      EH+      +K  + M N ++ LQK +
Sbjct:  768 IQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEHF------KKLNVGMENKIVQLQKKM 931          

HSP 2 Score: 69.707 bits (169), Expect = 5.597e-11
Identity = 48/141 (34.04%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 2200 YLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQK--NYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVK--LTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYR 2610
            YL + R  K + + I IQK  R +L RIRY KI+ + + LQ + R YL ++    L++ R+ +I Q   R    R  Y R+R++   IQ + +G   R+ + +  L    ++IQ   RG+  R+ Y     AA++IQ FYR
Sbjct:  752 YLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 3 Score: 68.9366 bits (167), Expect = 1.017e-10
Identity = 46/130 (35.38%), Postives = 79/130 (60.77%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR--SSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRD--TRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK 5028
            A IK+QK +RG+L R  + + R   I +Q   +G++AR+  + LR   +++I QK +R     +++L+++ A I IQ   R     +LY++    + +++IQK VRG+L R KYQR   AAI++Q  +R+
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRR 893          

HSP 4 Score: 64.6994 bits (156), Expect = 1.897e-9
Identity = 55/152 (36.18%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 4858 ASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQL---LAAIILQRHF------RKYLIIRRIDLEQKAARIIQNFYRGYTIR---AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
            A I IQK VR + Q   YR  R ++I +Q+Y RG+L R +Y   L    AA+I Q+ +      R+YL +RR      A   IQ F RG  IR     FL    + + IQ   + +L+RKKY   R   I IQC  RR  ++ +  +LK+  
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRR------AVITIQAFTRGMFIRRLYQEFLLHHKAMI-IQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEA 907          

HSP 5 Score: 63.929 bits (154), Expect = 3.361e-9
Identity = 48/148 (32.43%), Postives = 76/148 (51.35%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQ 3150
            +CI IQK +RG++ R  + K + +   L+ Y  GYL R+  + L++  + ++ QK  RM+ +R                       +E++  + A I IQ   R +  RR +Q   L + A+IIQKT R + VRKK+    Y+AIVIQ
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVR-----------------------REYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          

HSP 6 Score: 63.929 bits (154), Expect = 3.475e-9
Identity = 42/135 (31.11%), Postives = 78/135 (57.78%), Query Frame = 1
Query: 5482 CVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLV---VFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR 5871
            C+KIQ  +R ++   +++ I+ + + +Q++ RG   R +Y ++++L    V  QK  R   VR  +L +++++I IQ+F R  +  + YQ  L+     +IQK  R ++ RK++   +   I+IQ F+RR  AKR
Sbjct:  765 CIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKR 898          

HSP 7 Score: 63.929 bits (154), Expect = 3.534e-9
Identity = 47/127 (37.01%), Postives = 74/127 (58.27%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQ--KAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLE--IRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQ 5289
            R A I IQK VRG+L RI+Y++   +AI LQR+ R YL  R  ++ +  +AA I Q  YR   +R  +L  + + +TIQ + +   IR+ Y E  +  K + IQ  VR ++ R ++ R + + I+IQ
Sbjct:  762 RFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          

HSP 8 Score: 58.151 bits (139), Expect = 1.966e-7
Identity = 44/160 (27.50%), Postives = 85/160 (53.12%), Query Frame = 1
Query: 3130 YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCR---QKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            ++ I IQK VR  + +  Y KI++S + +Q++ +G+                  L R+Y    + L++ ++ +I QK +R +  R+++L  R+  I +Q + +    R   Q+FL L  + + IQK +R  L R++Y +++ A I IQ  +R  + K+Q+
Sbjct:  763 FACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGY------------------LARRY---AEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFL-LHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 900          

HSP 9 Score: 57.3806 bits (137), Expect = 2.823e-7
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARK--KYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIK--VIQKNIRGFLVRKTLNSHHQSATLIQHFYR 4128
            I +Q  +R  + + RY+K   + +T+ ++ +GY AR+  + L    + ++ Q  +R    R+ +L ++ + I IQ + RG   R++Y       K  +IQK +RG+LVRK       +A +IQ FYR
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 10 Score: 57.3806 bits (137), Expect = 3.070e-7
Identity = 55/155 (35.48%), Postives = 80/155 (51.61%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKI--FLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY--CLLKSYTLLIQQRWRFIVLKR-------SAVVIQRIWR 6360
            L KL+  K R A I IQKTV+G+  R  Y+ ++KS I LQR+ RG+L R+    L+L  A++I  K  R V VR  +              LR R  A I IQA+ R    +R Y   LL    ++IQ+  R  ++++       +A+VIQ  +R
Sbjct:  753 LEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREY--------------LRVR-RAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 11 Score: 57.3806 bits (137), Expect = 3.483e-7
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 1
Query: 4726 ILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNA--HKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL--AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR 5094
            I +Q  ++G++ R  Y+K+R S+I +Q+  RG+ A  + + L+L  A++  QK  R     + Y   R A I IQ + RG   R  YQ  LL   A+I+Q+  R +L+ ++    + AA +IQ FYR
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 12 Score: 56.225 bits (134), Expect = 6.380e-7
Identity = 42/137 (30.66%), Postives = 84/137 (61.31%), Query Frame = 1
Query: 2995 ATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK--KFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXX--XXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQF 3393
            A I IQ  VR  +QR +++ +R +AI +Q+  R Y  R+  + L    +A++ QK  R +  ++ YL+++++V+ IQ  T+G  +++ Y++  +  + +I Q  VR +L++K+Y + R + I+IQ  +R + A++Q 
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 900          

HSP 13 Score: 53.1434 bits (126), Expect = 5.628e-6
Identity = 36/116 (31.03%), Postives = 63/116 (54.31%), Query Frame = 1
Query: 5899 IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIR----------------KHYKILQ---------KSVIQLQRFIRGFLIRKIFLK--LKNASIIISKHVRGVLVRNHFQKNK 6165
            I +Q  VRG L +++Y+K+R + I +Q+  +GY  R                K Y+++Q         ++VI +Q F RG  IR+++ +  L + ++II K VRG LVR  +Q+++
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSR 881          

HSP 14 Score: 52.373 bits (124), Expect = 9.885e-6
Identity = 47/182 (25.82%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ--MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
             Y  + +   +R + I IQ + R ++ R  +  I+ SAI +Q+Y RG++ R+ Y                 ++R T                             AA++ QKQ+R   +R++Y   R+ VI IQ+  R     + Y++  +   A  IQK  +G+++RKKY   R +A++IQ
Sbjct:  751 AYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARR-YAE---------------MLRLT----------------------------RAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 78.1814 bits (191), Expect = 1.685e-13
Identity = 57/170 (33.53%), Postives = 90/170 (52.94%), Query Frame = 1
Query: 2386 IQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLN--LRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNL 2883
            IQ  +RG+L R  Y++IRKS   +Q+Y +GYLAR+  + ++LT+A V+ Q  +R    RR Y    +A + IQ+F R    RR Y    L    +IIQK V   L ++K ++   + I+IQ + R    +R   + K      EH+      +K  + M N ++ LQK +
Sbjct:  768 IQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEARSAEHF------KKLNVGMENKIVQLQKKM 931          

HSP 2 Score: 69.707 bits (169), Expect = 5.443e-11
Identity = 48/141 (34.04%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 2200 YLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQK--NYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVK--LTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYR 2610
            YL + R  K + + I IQK  R +L RIRY KI+ + + LQ + R YL ++    L++ R+ +I Q   R    R  Y R+R++   IQ + +G   R+ + +  L    ++IQ   RG+  R+ Y     AA++IQ FYR
Sbjct:  752 YLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 3 Score: 68.9366 bits (167), Expect = 1.076e-10
Identity = 46/130 (35.38%), Postives = 79/130 (60.77%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR--SSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRD--TRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK 5028
            A IK+QK +RG+L R  + + R   I +Q   +G++AR+  + LR   +++I QK +R     +++L+++ A I IQ   R     +LY++    + +++IQK VRG+L R KYQR   AAI++Q  +R+
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRR 893          

HSP 4 Score: 64.6994 bits (156), Expect = 1.830e-9
Identity = 55/152 (36.18%), Postives = 77/152 (50.66%), Query Frame = 1
Query: 4858 ASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQL---LAAIILQRHF------RKYLIIRRIDLEQKAARIIQNFYRGYTIR---AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
            A I IQK VR + Q   YR  R ++I +Q+Y RG+L R +Y   L    AA+I Q+ +      R+YL +RR      A   IQ F RG  IR     FL    + + IQ   + +L+RKKY   R   I IQC  RR  ++ +  +LK+  
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRR------AVITIQAFTRGMFIRRLYQEFLLHHKAMI-IQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQLKQLKIEA 907          

HSP 5 Score: 63.929 bits (154), Expect = 3.496e-9
Identity = 48/148 (32.43%), Postives = 76/148 (51.35%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQ 3150
            +CI IQK +RG++ R  + K + +   L+ Y  GYL R+  + L++  + ++ QK  RM+ +R                       +E++  + A I IQ   R +  RR +Q   L + A+IIQKT R + VRKK+    Y+AIVIQ
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVR-----------------------REYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          

HSP 6 Score: 63.929 bits (154), Expect = 3.586e-9
Identity = 47/127 (37.01%), Postives = 74/127 (58.27%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQ--KAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLE--IRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQ 5289
            R A I IQK VRG+L RI+Y++   +AI LQR+ R YL  R  ++ +  +AA I Q  YR   +R  +L  + + +TIQ + +   IR+ Y E  +  K + IQ  VR ++ R ++ R + + I+IQ
Sbjct:  762 RFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          

HSP 7 Score: 63.5438 bits (153), Expect = 3.771e-9
Identity = 42/135 (31.11%), Postives = 78/135 (57.78%), Query Frame = 1
Query: 5482 CVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL---VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR 5871
            C+KIQ  +R ++   +++ I+ + + +Q++ RG   R +Y ++++L    V  QK  R   VR  +L +++++I IQ+F R  +  + YQ  L+     +IQK  R ++ RK++   +   I+IQ F+RR  AKR
Sbjct:  765 CIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLAR-RYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKR 898          

HSP 8 Score: 57.7658 bits (138), Expect = 2.245e-7
Identity = 44/160 (27.50%), Postives = 85/160 (53.12%), Query Frame = 1
Query: 3130 YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCR---QKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            ++ I IQK VR  + +  Y KI++S + +Q++ +G+                  L R+Y    + L++ ++ +I QK +R +  R+++L  R+  I +Q + +    R   Q+FL L  + + IQK +R  L R++Y +++ A I IQ  +R  + K+Q+
Sbjct:  763 FACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGY------------------LARRY---AEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFL-LHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 900          

HSP 9 Score: 57.3806 bits (137), Expect = 2.913e-7
Identity = 55/155 (35.48%), Postives = 80/155 (51.61%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKI--FLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY--CLLKSYTLLIQQRWRFIVLKR-------SAVVIQRIWR 6360
            L KL+  K R A I IQKTV+G+  R  Y+ ++KS I LQR+ RG+L R+    L+L  A++I  K  R V VR  +              LR R  A I IQA+ R    +R Y   LL    ++IQ+  R  ++++       +A+VIQ  +R
Sbjct:  753 LEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREY--------------LRVR-RAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 10 Score: 57.3806 bits (137), Expect = 2.987e-7
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARK--KYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIK--VIQKNIRGFLVRKTLNSHHQSATLIQHFYR 4128
            I +Q  +R  + + RY+K   + +T+ ++ +GY AR+  + L    + ++ Q  +R    R+ +L ++ + I IQ + RG   R++Y       K  +IQK +RG+LVRK       +A +IQ FYR
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 11 Score: 57.3806 bits (137), Expect = 3.305e-7
Identity = 44/127 (34.65%), Postives = 71/127 (55.91%), Query Frame = 1
Query: 4726 ILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNA--HKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL--AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR 5094
            I +Q  ++G++ R  Y+K+R S+I +Q+  RG+ A  + + L+L  A++  QK  R     + Y   R A I IQ + RG   R  YQ  LL   A+I+Q+  R +L+ ++    + AA +IQ FYR
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYR 892          

HSP 12 Score: 56.225 bits (134), Expect = 6.753e-7
Identity = 42/137 (30.66%), Postives = 84/137 (61.31%), Query Frame = 1
Query: 2995 ATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK--KFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXX--XXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQF 3393
            A I IQ  VR  +QR +++ +R +AI +Q+  R Y  R+  + L    +A++ QK  R +  ++ YL+++++V+ IQ  T+G  +++ Y++  +  + +I Q  VR +L++K+Y + R + I+IQ  +R + A++Q 
Sbjct:  764 ACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQCFYRRVRAKRQL 900          

HSP 13 Score: 53.1434 bits (126), Expect = 5.713e-6
Identity = 36/116 (31.03%), Postives = 63/116 (54.31%), Query Frame = 1
Query: 5899 IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIR----------------KHYKILQ---------KSVIQLQRFIRGFLIRKIFLK--LKNASIIISKHVRGVLVRNHFQKNK 6165
            I +Q  VRG L +++Y+K+R + I +Q+  +GY  R                K Y+++Q         ++VI +Q F RG  IR+++ +  L + ++II K VRG LVR  +Q+++
Sbjct:  766 IKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARRYAEMLRLTRAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSR 881          

HSP 14 Score: 52.373 bits (124), Expect = 9.702e-6
Identity = 47/182 (25.82%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ--MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
             Y  + +   +R + I IQ + R ++ R  +  I+ SAI +Q+Y RG++ R+ Y                 ++R T                             AA++ QKQ+R   +R++Y   R+ VI IQ+  R     + Y++  +   A  IQK  +G+++RKKY   R +A++IQ
Sbjct:  751 AYLEKLRADKFRFACIKIQKTVRGWLQRIRYRKIRKSAITLQRYGRGYLARR-YAE---------------MLRLT----------------------------RAAVICQKQYRMVQVRREYLRVRRAVITIQAFTRGMFIRRLYQEFLLHHKAMIIQKTVRGWLVRKKYQRSRYAAIVIQ 888          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 567.385 bits (1461), Expect = 2.884e-163
Identity = 556/2165 (25.68%), Postives = 992/2165 (45.82%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF------------------------NTHL-----SKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE----------------NPIXXXXXXXX-----------XXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTS----------------------ANLFDKEI--------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS---------ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS-SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGY----LRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQY----YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKS---------------------------YICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIA----ATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF-----NAHKKFLKLKNASICIQKNVRRYCQMKLYRD---TRNASIVIQKYVRGFL---------------------------CRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIF----VRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLRCHL 6384
            D+ W+ +QE  F  WLN I                         N H      + TK E   K      +  +L  S C++        AI ++  E+    L  + D   +K     + +   +++YN  WL     + ++  F   +SL SN++      FI  ++LWN DIA ++R   + +  +     +L++  L++ L +++ LD AK+  +   D  LF KD+  K+S ++L  F+  FL GEG++ +      L VSH+QT +DE+DF V+NL+ D+  GVRL  +  +  +  +  KLR PA+   +K  N+E+A++A  D G  +    G  I    I   HRE+TLALLW ++    +D ++   +L  EI++ +                NP       S+            LL+ WV +VC  Y+  V N + +  DGR FC L+++Y P YL LN +   TT T                         +FD+ +        LL+NE+ NF +  + +  +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ VWR YR                      V + L  +K K+ +    + Q  V ++L+R R+ K   SA +IQK +RRYL + + +++K+         AT+++Q  ++ Y  ++ ++ +  S + +Q  +R  + +S+YK+I+++T  +Q +++ +L     R++++ +  ++++IQ AF  + KR+      +A +IIQ  YR    C+    N+  + I IQ V      ++K        I IQ + R   +R  FL  K ++  L+ Y+  Y    L RK+FL+MR++ I +Q + R + +R  +   + + ++      R   KK++   K   +L+Q+ VR   Q+++F+ ++ AA +IQ  +R +   K+ + ++    ++A+VIQ   R +  +K  L+++ +V +                        Q+L R Y  +K++L++++++I IQ  FR    R ++   RK T  VQ+  +    M + R+ ++ ++   I +Q  +R    RR      KA   +Q ++R  ++KKQ  L  +AA ++Q+++++                           Y  +K  +  + +   IQ   R    RK + +  + V+ +Q   R   + ++ QKK      AT+T+    +G+  RK+   +  + I IQ++FR +  +K   ++K +A+ IQ+  R  +    +R+ Y     + K +Q   RG  VRK L   H+SA LIQ FYR +  +  +   R A+ +IQ  +R H + Q     Y   +K    +QS  R +   ++     KAAT IQ   + +I+ K+Y T R + + IQ++   +L  +                   L R+ Y R   +  ++Q   R ++VRKRI+  Q++  ++Q  YRA      +R  ++    A   LQ   RG  +R+N         ++QS  +    R  Y++LR ++ +VQ  +R       N H +++ ++NA++CIQ   R    +K+ RD      A+ +IQ++ + FL                            R +Y R   A ++LQ  FR +    RI+    +A +IQ  +R +  +  +   +++ + IQ  +KA +     RK YL+ RQ  + IQ   R    R     +  +   IQ   R +    +Y+K + AV  IQ+ FR    R SE   +  +K A + IQ  +R + +RK+ + + +   +IQS  + +     ++ ++SA  +IQ   R I      R ++ ++ K  + IQ   R  +VR     +  +   IQSFYRM+ + K Y +  Q++  IQ+  R   AR  +                      YQ +      +Q+  RG   ++  Q+M  A   IQ+  K +  RK Y  L+ S I +QR  R  ++    R+ FLK ++A+I I    RG+  R               E L+ R  A+ +IQ+ FR + Q   Y   K   ++IQ+ +R           ++ L  +A+++Q ++RG++ R +L
Sbjct:  664 DERWMAKQERGFTWWLNFILTPDDFAVKRDSSKVQAATLILGSENAHKVSVPKAPTKEEVSLKAYTTRCKLNRLRRSACRLFTSEPVVKAILRLEVEIEAQRLLVRRDRHLWKDIGERQKILNWLLSYNPLWL----RIGLETIFGELISLESNSDVTGLAVFILNRLLWNPDIAAEYRHPSVPNLYRDGHEEALSKFTLKKLLLLIFFLDHAKQFRLIDHDPCLFWKDAEYKTSKDLLLAFSRDFLSGEGDLSRHLGYLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVTVELLAQSWSLSKKLRVPAISRLQKMHNVEVALQALTDRGVLLKDERGVSITSKDIVDRHRERTLALLWKIVFSFQVDVLLSTKQLKEEIQILKESYNTQKQLAALRSLANPAPTQTRESDQFEPEKYNERVSLLMEWVNAVCRFYSTKVQNFTVSFSDGRVFCYLVNHYHPSYLPLNAVCQRTTQTVECSQSGTAMLNSSDSDNSLEVWPGVFDQGVTSSALYKELLKNEQTNFSLVHAAVADLGGIPAMVHHSDMSNTIPDEKVVITFLSFLCARLLDLRKETRAARVIQTVWRNYRL--------------------KVEKKLLERKHKAAR----VIQRAVVQFLSRCRLQKRSHSAAVIQKYFRRYLAQRQLKELKALKHKELQDNATLIIQRFWKGYSARRRFIILRHSAICMQARVRAKIAQSSYKQIQQATVTLQSHMRAWLLGKKKRQEYLHIKSSVIIIQHAFTRW-KRQKQKRHTEAVLIIQKCYRRWKACKSMAQNM--AAIKIQSVYRMHRERQKFLDTKCKIIKIQSWFRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAACVLQSYWRMRQ-EKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI------------------------QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCAR-------------------LQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVH-QYMAIRNAALCIQSAFR---GLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNF-------------------YQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLRER---------------EELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNL 2715          

HSP 2 Score: 376.711 bits (966), Expect = 4.507e-104
Identity = 446/1792 (24.89%), Postives = 788/1792 (43.97%), Query Frame = 1
Query: 2017 AASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMR---IIICQSVVKRY----LARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK----KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK--------------------VVHKVLFKRKLEKRLRS-------CIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIIC----QKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISA---------------------------RKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA----LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLIC----RKQFQKEMKLVILLQSKIRMIITKKR----YQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQ----------KNI-----------------RGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL----AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEI----RQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRF----SELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGI-FVRLKYKKIIKL---VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIAR----KRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGF----LIRKIFLKLKNASIIISKHVRGVLVRN--------------------------------HFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-FIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK---AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            AA  IQ V+R +R     +  F+    ++I +QS    F C K  ++  M+   I+  Q   + Y    L R +  +M+ +AI IQ +YR    R  Y +IK+A  VLQS++R    +K Y  + + ++++Q+N+R    +  +K ++++  +IQ Y + + A K    +F ++  A VVIQSAFR    R+   +Q+++AV IQ+  RS   R+ +L ++++ I IQ                     V  K   K++++K   +       CI +Q  +RG   RR    +  A  IL+  +  + ++KQ+  +  + I++Q++ R   ++                      +  F+A K + + +Q   R    R+  +  R AA+ IQ  FR Y +RK +L    S + IQ+  R        QK YL+I+++ + +Q   +G++ +K  K      I  QS  R+Y  QKQ   ++K+ + IQ+ +RA+ A                           RK      K   ++Q + +MH C+ ++  ++     IQ   RA     LQ+  Y++ KK+   +Q  +R  K ++Q+   ++AAT +Q  F+S+I  K++  ++ +   IQ++    +C    R ++ +  K VI+LQS  R  + +KR     Q  I         + G   RK+YL    +  ++Q ++R    R+   ++  +A VIQ   R   +R  Y     A +V+Q          +N+                 RG  VR+ LN+ H +A LIQ  Y+ +  R+ F+  RNA I+ Q++FR       IRQQY   +K V+ +Q+  R +   ++   M  +AT IQ   + +  +  Y T R +A++IQ+  +  ++ KS                    R  Y ++  +A  IQ   RG   RK + +  KA   IQ  +R H  RS +I  + A   +Q+  R            NK+   + L         Y  ++ + + +Q  +RGF   K        +  IQ   + + +  +Y++ ++A  +IQ + R      + + + L    A I++Q   R  L+ R I     AA  IQ+FYR Y+ R +++    +  TIQ  ++A   R  Y       R+    +Q   R   +R    ++  +   IQ+  + +   + Y++ K + I IQ+ +R      +E + F   ++A+I IQ  +R    R+E K + +   +IQS  R +     +   K A ++IQ+H R     +L++K+ +KL    + +Q   R    R    ++  +   +Q++YRMH + + Y  ++ ++   Q   R   AR    K++  I+  +  IQ  FR   A R  +++ S  I +Q+  +    + +Y KM  A ++IQ   +G+  RK  K ++ S   +Q + R      L R  +L +++A+I I    RG+L                                   HF++    ++   +  L+ R  A+ KIQ   R Y+Q+RR     S  +  Q  WR +I  K       R+ R R  R   + K    E  ++ NR + A                   D   S   ++ +L  L  LE  T LS   C+ + +S A K +  L+  CNR +  +EV+   + V  NL K        ++V  S  I L    ++R     K   KG +IF  TC L+ +     Q++
Sbjct: 1436 AAIKIQSVYRMHRE----RQKFLDTKCKIIKIQSW---FRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAA-CVLQSYWRMRQEKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKA-KLQVRSAVKIQALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQ-------------------VHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSE-------------------RKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRA-----------NKLRDSEKLQ--------YHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRARVDAVKKYATIRMAVKRIQSAFRARKAARDAEKD-SAAIVIQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHRVAEREQAELITNAILLLLQMWYRAKLQRRYYLHFRQKIVTLQRAIRAWLQLRNNAACKIQRSMRDYLQRRRQARAVSGIVKFQALWRGYICRKARDTKAVRVLRKRLQRVSQDVK----EEDKLCNRTVVA------------------LDYLLSSKHLSFILAALQHLEVATRLSAVCCENMAQSGAVKTIFVLIRSCNRSIPCMEVIKLSVMVLLNLSKYERTVQAVYEVENSVDILLDLMQIFREKAGDKVSDKGGSIFTKTCCLMAIFALHSQRA 3138          

HSP 3 Score: 327.791 bits (839), Expect = 3.737e-89
Identity = 354/1410 (25.11%), Postives = 653/1410 (46.31%), Query Frame = 1
Query: 2014 RAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFR-RYLVQKN---YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQ---------------------------SAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRML---------------------------SLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA--LIQRRKFQYLR--NAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC----QSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKK----QIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFI----CQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFR----GFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVR----RYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRR----YICISKFKMIKSATLIIQKHIRGIFV-RLKYKKIIKLV-----VFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRS 5874
            RAA  IQ  +R +R        F       +++QS  RR    K    ++  + I Q++ + Y AR R  ++K+++I IQ  +R    R+RY  ++ AT  +Q  FR +  +QK    Y+ +  + + +Q  +RG+  R   +   K+  I+Q   + +  +K++  L +A ++IQ                           +A+RGY  R++   Q  AA+ IQ+ +RS   R+ YL +R+SV+ IQ+        RK +K+     R+ + +Q   RG++ R+    + +A   ++  F  Y  +KQ   M+ + + +Q+  R +                           ++R     + KSA +IQ  ++ +  + ++ A + A+ LIQ   RA  L Q ++F YLR   +A ++Q  +R + VR++    + +A  IQ   RS I  K Y  ++ + L IQ+H   FL  +  +   +R+       QS  R ++++K+ L++++S I++Q+++RA+      RKQ+L   + T ++Q   +  + R+    +      IQ   R + QR  Y + ++A   +Q ++R+ KE+     Q +    AA  +Q  F+    ++       +  +IQ++ +  + R++F       IL Q + RM +     +++Y +   A + +    +G+  R++     +S  VIQ +FR    +  + +++ +AIVIQ+  +  +    +RK Y  Q  +   IQ   RG   RK L+  H++A+ IQ  +R ++ R  +I  + A  VIQ++FR + +R     QY+  ++ V+ IQS  R F   +  +   + AT IQ   K +  R  Y   + +  +IQ   R   + +  + +   +      +    R  L+R   K    AAT IQ   R Y  RK  ++  +AV  IQ  YRA   R H+       + AA  LQ   RG   R    +       +Q   K F  RK Y +L++S+I++Q+ +R    G    +KFLK ++A+ICIQ   R   + +  +    A+  IQ   R     + Y     AA+++QRH+R+Y   R   LE K       AA I+Q  YRG   R +     N+   +Q Y++ +  R+ Y  ++      Q   R    R  +  ++  ++M+V  IQ   R     R   K   A++ IQ  ++  +  + +  +  A+++IQ  FR +  RK  K    +   IQ++ R      +  +++  I+SA + IQ   RG+   R+  ++  +L+     + +Q   RA + R  +L+ ++ I+ +Q   R   + +N    K     IQ++ R ++ R+R     S I+  Q  +R ++ +++
Sbjct: 1576 RAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI-QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRY---RSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRARVDAVKKYATIRMAVKRIQSAFRARKAARDAEKDSAAIV-IQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHRVAEREQAELITNAILLLLQMWYRAKLQRRYYLHFRQKIVTLQRAIRAWLQLRNNAACK-----IQRSMRDYLQRRRQARAVSGIVKFQALWRGYICRKA 2975          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 567.77 bits (1462), Expect = 2.954e-163
Identity = 556/2165 (25.68%), Postives = 992/2165 (45.82%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF------------------------NTHL-----SKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE----------------NPIXXXXXXXX-----------XXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTS----------------------ANLFDKEI--------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS---------ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS-SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGY----LRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQY----YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKS---------------------------YICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIA----ATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF-----NAHKKFLKLKNASICIQKNVRRYCQMKLYRD---TRNASIVIQKYVRGFL---------------------------CRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIF----VRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLRCHL 6384
            D+ W+ +QE  F  WLN I                         N H      + TK E   K      +  +L  S C++        AI ++  E+    L  + D   +K     + +   +++YN  WL     + ++  F   +SL SN++      FI  ++LWN DIA ++R   + +  +     +L++  L++ L +++ LD AK+  +   D  LF KD+  K+S ++L  F+  FL GEG++ +      L VSH+QT +DE+DF V+NL+ D+  GVRL  +  +  +  +  KLR PA+   +K  N+E+A++A  D G  +    G  I    I   HRE+TLALLW ++    +D ++   +L  EI++ +                NP       S+            LL+ WV +VC  Y+  V N + +  DGR FC L+++Y P YL LN +   TT T                         +FD+ +        LL+NE+ NF +  + +  +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ VWR YR                      V + L  +K K+ +    + Q  V ++L+R R+ K   SA +IQK +RRYL + + +++K+         AT+++Q  ++ Y  ++ ++ +  S + +Q  +R  + +S+YK+I+++T  +Q +++ +L     R++++ +  ++++IQ AF  + KR+      +A +IIQ  YR    C+    N+  + I IQ V      ++K        I IQ + R   +R  FL  K ++  L+ Y+  Y    L RK+FL+MR++ I +Q + R + +R  +   + + ++      R   KK++   K   +L+Q+ VR   Q+++F+ ++ AA +IQ  +R +   K+ + ++    ++A+VIQ   R +  +K  L+++ +V +                        Q+L R Y  +K++L++++++I IQ  FR    R ++   RK T  VQ+  +    M + R+ ++ ++   I +Q  +R    RR      KA   +Q ++R  ++KKQ  L  +AA ++Q+++++                           Y  +K  +  + +   IQ   R    RK + +  + V+ +Q   R   + ++ QKK      AT+T+    +G+  RK+   +  + I IQ++FR +  +K   ++K +A+ IQ+  R  +    +R+ Y     + K +Q   RG  VRK L   H+SA LIQ FYR +  +  +   R A+ +IQ  +R H + Q     Y   +K    +QS  R +   ++     KAAT IQ   + +I+ K+Y T R + + IQ++   +L  +                   L R+ Y R   +  ++Q   R ++VRKRI+  Q++  ++Q  YRA      +R  ++    A   LQ   RG  +R+N         ++QS  +    R  Y++LR ++ +VQ  +R       N H +++ ++NA++CIQ   R    +K+ RD      A+ +IQ++ + FL                            R +Y R   A ++LQ  FR +    RI+    +A +IQ  +R +  +  +   +++ + IQ  +KA +     RK YL+ RQ  + IQ   R    R     +  +   IQ   R +    +Y+K + AV  IQ+ FR    R SE   +  +K A + IQ  +R + +RK+ + + +   +IQS  + +     ++ ++SA  +IQ   R I      R ++ ++ K  + IQ   R  +VR     +  +   IQSFYRM+ + K Y +  Q++  IQ+  R   AR  +                      YQ +      +Q+  RG   ++  Q+M  A   IQ+  K +  RK Y  L+ S I +QR  R  ++    R+ FLK ++A+I I    RG+  R               E L+ R  A+ +IQ+ FR + Q   Y   K   ++IQ+ +R           ++ L  +A+++Q ++RG++ R +L
Sbjct:  624 DERWMAKQERGFTWWLNFILTPDDFAVKRDSSKVQAATLILGSENAHKVSVPKAPTKEEVSLKAYTTRCKLNRLRRSACRLFTSEPVVKAILRLEVEIEAQRLLVRRDRHLWKDIGERQKILNWLLSYNPLWL----RIGLETIFGELISLESNSDVTGLAVFILNRLLWNPDIAAEYRHPSVPNLYRDGHEEALSKFTLKKLLLLIFFLDHAKQFRLIDHDPCLFWKDAEYKTSKDLLLAFSRDFLSGEGDLSRHLGYLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVTVELLAQSWSLSKKLRVPAISRLQKMHNVEVALQALTDRGVLLKDERGVSITSKDIVDRHRERTLALLWKIVFSFQVDVLLSTKQLKEEIQILKESYNTQKQLAALRSLANPAPTQTRESDQFEPEKYNERVSLLMEWVNAVCRFYSTKVQNFTVSFSDGRVFCYLVNHYHPSYLPLNAVCQRTTQTVECSQSGTAMLNSSDSDNSLEVWPGVFDQGVTSSALYKELLKNEQTNFSLVHAAVADLGGIPAMVHHSDMSNTIPDEKVVITFLSFLCARLLDLRKETRAARVIQTVWRNYRL--------------------KVEKKLLERKHKAAR----VIQRAVVQFLSRCRLQKRSHSAAVIQKYFRRYLAQRQLKELKALKHKELQDNATLIIQRFWKGYSARRRFIILRHSAICMQARVRAKIAQSSYKQIQQATVTLQSHMRAWLLGKKKRQEYLHIKSSVIIIQHAFTRW-KRQKQKRHTEAVLIIQKCYRRWKACKSMAQNM--AAIKIQSVYRMHRERQKFLDTKCKIIKIQSWFRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAACVLQSYWRMRQ-EKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI------------------------QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCAR-------------------LQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVH-QYMAIRNAALCIQSAFR---GLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNF-------------------YQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLRER---------------EELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNL 2675          

HSP 2 Score: 375.555 bits (963), Expect = 1.162e-103
Identity = 476/1899 (25.07%), Postives = 826/1899 (43.50%), Query Frame = 1
Query: 2017 AASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMR---IIICQSVVKRY----LARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK----KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK--------------------VVHKVLFKRKLEKRLRS-------CIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIIC----QKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISA---------------------------RKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA----LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLIC----RKQFQKEMKLVILLQSKIRMIITKKR----YQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQ----------KNI-----------------RGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL-----AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRS------HFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF----NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFR-KYLIIRRIDLEQ---KAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYI----SRNRFLRLKMSVIIIQKVTRG-----------------------YFTHRKYVKQKKAVINIQKNFRRFS----ELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIR---------------------------RYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQ---KNCR-KFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSI---------------IIFVQSLVRGKLAKLKY-------------------------QKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIR----GFLIRKIFLKLKNASIIISKHVRGVLVRN---HFQKNKQHMKIFAQENLRKRLEASIKI-----------QAYFRCYIQKRRYCLLKSYTLLIQQRWR-FIVLKRSAVV-IQRIWRGRQLRCHLNAKKIGHEISEI-------RNRFIEANRRFSKFNTVRYIGKKALTDLKESE----LTVAKVLFCLTS------------LENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK---AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            AA  IQ V+R +R     +  F+    ++I +QS    F C K  ++  M+   I+  Q   + Y    L R +  +M+ +AI IQ +YR    R  Y +IK+A  VLQS++R    +K Y  + + ++++Q+N+R    +  +K ++++  +IQ Y + + A K    +F ++  A VVIQSAFR    R+   +Q+++AV IQ+  RS   R+ +L ++++ I IQ                     V  K   K++++K   +       CI +Q  +RG   RR    +  A  IL+  +  + ++KQ+  +  + I++Q++ R   ++                      +  F+A K + + +Q   R    R+  +  R AA+ IQ  FR Y +RK +L    S + IQ+  R        QK YL+I+++ + +Q   +G++ +K  K      I  QS  R+Y  QKQ   ++K+ + IQ+ +RA+ A                           RK      K   ++Q + +MH C+ ++  ++     IQ   RA     LQ+  Y++ KK+   +Q  +R  K ++Q+   ++AAT +Q  F+S+I  K++  ++ +   IQ++    +C    R ++ +  K VI+LQS  R  + +KR     Q  I         + G   RK+YL    +  ++Q ++R    R+   ++  +A VIQ   R   +R  Y     A +V+Q          +N+                 RG  VR+ LN+ H +A LIQ  Y+ +  R+ F+  RNA I+ Q++FR       IRQQY   +K V+ +Q+  R +   ++   M  +AT IQ   + +  +  Y T R +A++IQ+  +  ++ KS +            ++    R + +RK+L     AA+ IQ   R +  R + +  Q AV +IQ  +RA+ +R       H I  K A + +Q   RG+ +RK+          +QS  K    R  YQ ++S+  ++Q  +R          +FL+L+ A+I IQ   R     +  +   +A+  IQ + R +  R  Y   L A   +Q+ +R K       +  Q   KAA ++Q  +RG   R        +  TIQ  FK++  RK YLE++  TI IQ   R  +     R +FL+ + + I IQ   RG                       +  H  Y+  K+A + IQ+++RR+     E K +  L NA+II+Q  +R    RK  +        +Q+Y R                           R   + K+  I+ A   IQ   R        +K    +V IQ   + + VR  ++ + ++ + IQ+ +R H   K  + M+ S  +IQ   ++CR   + R ++L I+S  I IQ  FR  LA R  +R  +                 + +++  RG + + K+                         QK++ A I+IQ   +G+ IRKH+  L+++V+ LQ   R    G   R  + + +NA I +    RG LVR    H ++       F    ++ +L     I           Q ++R  +Q+R Y   +   + +Q+  R ++ L+ +A   IQR      +R +L  ++    +S I       R       R       +R   ++   D+KE +     TV  + + L+S            LE  T LS   C+ + +S A K +  L+  CNR +  +EV+   + V  NL K        ++V  S  I L    ++R     K   KG +IF  TC L+ +     Q++
Sbjct: 1396 AAIKIQSVYRMHRE----RQKFLDTKCKIIKIQSW---FRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAA-CVLQSYWRMRQEKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKA-KLQVRSAVKIQALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQ-------------------VHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQ-ATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVI--KRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRARVDAVKKYATIRMAVKRIQSAFRARKAARDAEKDSAAIV-IQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHRVAEREQAASKVRSFLVMTPYRKRFLRLRAQWRGYIQRRKFVQYKSAALLIQQRYRAYRLQKSQHRQKLQKAAIVIQAAYRGFKIRKHFVRLKQAVVTLQMHFRAVKTGRYERIRYTQSRNAVIKLQACARGWLVRKEVMHIKQFFLVFFYFYYLYIKHQLLGIYPIELITNAILLLLQMWYRAKLQRRYYLHFRQKIVTLQRAIRAWLQLRNNAACKIQR-----SMRDYLQRRRQARAVSGIVKFQALWRGYICRKARDTKAVRVLRKRLQRVSQDVKEEDKLCNRTVVALDYLLSSKHLSFILAALQHLEVATRLSAVCCENMAQSGAVKTIFVLIRSCNRSIPCMEVIKLSVMVLLNLSKYERTVQAVYEVENSVDILLDLMQIFREKAGDKVSDKGGSIFTKTCCLMAIFALHSQRA 3257          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 566.229 bits (1458), Expect = 7.564e-163
Identity = 556/2165 (25.68%), Postives = 992/2165 (45.82%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF------------------------NTHL-----SKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE----------------NPIXXXXXXXX-----------XXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTS----------------------ANLFDKEI--------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS---------ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS-SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGY----LRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQY----YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKS---------------------------YICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIA----ATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF-----NAHKKFLKLKNASICIQKNVRRYCQMKLYRD---TRNASIVIQKYVRGFL---------------------------CRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIF----VRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLRCHL 6384
            D+ W+ +QE  F  WLN I                         N H      + TK E   K      +  +L  S C++        AI ++  E+    L  + D   +K     + +   +++YN  WL     + ++  F   +SL SN++      FI  ++LWN DIA ++R   + +  +     +L++  L++ L +++ LD AK+  +   D  LF KD+  K+S ++L  F+  FL GEG++ +      L VSH+QT +DE+DF V+NL+ D+  GVRL  +  +  +  +  KLR PA+   +K  N+E+A++A  D G  +    G  I    I   HRE+TLALLW ++    +D ++   +L  EI++ +                NP       S+            LL+ WV +VC  Y+  V N + +  DGR FC L+++Y P YL LN +   TT T                         +FD+ +        LL+NE+ NF +  + +  +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ VWR YR                      V + L  +K K+ +    + Q  V ++L+R R+ K   SA +IQK +RRYL + + +++K+         AT+++Q  ++ Y  ++ ++ +  S + +Q  +R  + +S+YK+I+++T  +Q +++ +L     R++++ +  ++++IQ AF  + KR+      +A +IIQ  YR    C+    N+  + I IQ V      ++K        I IQ + R   +R  FL  K ++  L+ Y+  Y    L RK+FL+MR++ I +Q + R + +R  +   + + ++      R   KK++   K   +L+Q+ VR   Q+++F+ ++ AA +IQ  +R +   K+ + ++    ++A+VIQ   R +  +K  L+++ +V +                        Q+L R Y  +K++L++++++I IQ  FR    R ++   RK T  VQ+  +    M + R+ ++ ++   I +Q  +R    RR      KA   +Q ++R  ++KKQ  L  +AA ++Q+++++                           Y  +K  +  + +   IQ   R    RK + +  + V+ +Q   R   + ++ QKK      AT+T+    +G+  RK+   +  + I IQ++FR +  +K   ++K +A+ IQ+  R  +    +R+ Y     + K +Q   RG  VRK L   H+SA LIQ FYR +  +  +   R A+ +IQ  +R H + Q     Y   +K    +QS  R +   ++     KAAT IQ   + +I+ K+Y T R + + IQ++   +L  +                   L R+ Y R   +  ++Q   R ++VRKRI+  Q++  ++Q  YRA      +R  ++    A   LQ   RG  +R+N         ++QS  +    R  Y++LR ++ +VQ  +R       N H +++ ++NA++CIQ   R    +K+ RD      A+ +IQ++ + FL                            R +Y R   A ++LQ  FR +    RI+    +A +IQ  +R +  +  +   +++ + IQ  +KA +     RK YL+ RQ  + IQ   R    R     +  +   IQ   R +    +Y+K + AV  IQ+ FR    R SE   +  +K A + IQ  +R + +RK+ + + +   +IQS  + +     ++ ++SA  +IQ   R I      R ++ ++ K  + IQ   R  +VR     +  +   IQSFYRM+ + K Y +  Q++  IQ+  R   AR  +                      YQ +      +Q+  RG   ++  Q+M  A   IQ+  K +  RK Y  L+ S I +QR  R  ++    R+ FLK ++A+I I    RG+  R               E L+ R  A+ +IQ+ FR + Q   Y   K   ++IQ+ +R           ++ L  +A+++Q ++RG++ R +L
Sbjct:  624 DERWMAKQERGFTWWLNFILTPDDFAVKRDSSKVQAATLILGSENAHKVSVPKAPTKEEVSLKAYTTRCKLNRLRRSACRLFTSEPVVKAILRLEVEIEAQRLLVRRDRHLWKDIGERQKILNWLLSYNPLWL----RIGLETIFGELISLESNSDVTGLAVFILNRLLWNPDIAAEYRHPSVPNLYRDGHEEALSKFTLKKLLLLIFFLDHAKQFRLIDHDPCLFWKDAEYKTSKDLLLAFSRDFLSGEGDLSRHLGYLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVTVELLAQSWSLSKKLRVPAISRLQKMHNVEVALQALTDRGVLLKDERGVSITSKDIVDRHRERTLALLWKIVFSFQVDVLLSTKQLKEEIQILKESYNTQKQLAALRSLANPAPTQTRESDQFEPEKYNERVSLLMEWVNAVCRFYSTKVQNFTVSFSDGRVFCYLVNHYHPSYLPLNAVCQRTTQTVECSQSGTAMLNSSDSDNSLEVWPGVFDQGVTSSALYKELLKNEQTNFSLVHAAVADLGGIPAMVHHSDMSNTIPDEKVVITFLSFLCARLLDLRKETRAARVIQTVWRNYRL--------------------KVEKKLLERKHKAAR----VIQRAVVQFLSRCRLQKRSHSAAVIQKYFRRYLAQRQLKELKALKHKELQDNATLIIQRFWKGYSARRRFIILRHSAICMQARVRAKIAQSSYKQIQQATVTLQSHMRAWLLGKKKRQEYLHIKSSVIIIQHAFTRW-KRQKQKRHTEAVLIIQKCYRRWKACKSMAQNM--AAIKIQSVYRMHRERQKFLDTKCKIIKIQSWFRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAACVLQSYWRMRQ-EKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI------------------------QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCAR-------------------LQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVH-QYMAIRNAALCIQSAFR---GLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNF-------------------YQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLRER---------------EELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNL 2675          

HSP 2 Score: 372.859 bits (956), Expect = 7.317e-103
Identity = 439/1774 (24.75%), Postives = 785/1774 (44.25%), Query Frame = 1
Query: 2014 RAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFR-RYLVQKN---YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQ---------------------------SAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRML---------------------------SLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA--LIQRRKFQYLR--NAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC----QSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKK----QIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFIC----QKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFR----GFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVR----RYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRR----YICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQS--ITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRK---HYK--------------------------ILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVL-VRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-FIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK---AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            RAA  IQ  +R +R        F       +++QS  RR    K    ++  + I Q++ + Y AR R  ++K+++I IQ  +R    R+RY  ++ AT  +Q  FR +  +QK    Y+ +  + + +Q  +RG+  R   +   K+  I+Q   + +  +K++  L +A ++IQ                           +A+RGY  R++   Q  AA+ IQ+ +RS   R+ YL +R+SV+ IQ+        RK +K+     R+ + +Q   RG++ R+    + +A   ++  F  Y  +KQ   M+ + + +Q+  R +                           ++R     + KSA +IQ  ++ +  + ++ A + A+ LIQ   RA  L Q ++F YLR   +A ++Q  +R + VR++    + +A  IQ   RS I  K Y  ++ + L IQ+H   FL  +  +   +R+       QS  R ++++K+ L++++S I++Q+++RA+      RKQ+L   + T ++Q   +  + R+    +      IQ   R + QR  Y + ++A   +Q ++R+ KE+     Q +    AA  +Q  F+    ++       +  +IQ++ +  + R++F       IL Q + RM +     +++Y +   A + +    +G+  R++     +S  VIQ +FR    +  + +++ +AIVIQ+  +  +    +RK Y  Q  +   IQ   RG   RK L+  H++A+ IQ  +R ++ R  +I  + A  VIQ++FR + +R     QY+  ++ V+ IQS  R F   +  +   + AT IQ   K +  R  Y   + +  +IQ   R   + +  + +   +      +    R  L+R   K    AAT IQ   R Y  RK  ++  +AV  IQ  YRA   R H+       + AA  LQ   RG   R    +       +Q   K F  RK Y +L++S+I++Q+ +R    G    +KFLK ++A+ICIQ   R   + +  +    A+  IQ   R     + Y     AA+++QRH+R+Y   R   LE K       AA I+Q  YRG   R +     N+   +Q Y++ +  R+ Y  ++      Q   R    R  +  ++  ++M+V  IQ   R     R   K   A++ IQ  ++  +  + +  +  A+++IQ  FR +  RK  K    +   IQ++ R      +  +++  I+SA + IQ   RG+    +  +  +    ++  +     R RFL ++ + I +QS YRM    + Y++ +++    VIQ   R F  RK F+ +K  ++ +Q  FR                   ++  G+  +++Y + R A I +Q   +G+ +RK   H K                          I    ++ LQ + R  L R+ +L  +   + + + +R  L +RN+                     A+ KIQ   R Y+Q+RR     S  +  Q  WR +I  K       R+ R R  R   + K    E  ++ NR + A                   D   S   ++ +L  L  LE  T LS   C+ + +S A K +  L+  CNR +  +EV+   + V  NL K        ++V  S  I L    ++R     K   KG +IF  TC L+ +     Q++
Sbjct: 1536 RAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI-QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRY---RSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRARVDAVKKYATIRMAVKRIQSAFRARKAARDAEKDSAAIV-IQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAH-RVAEREQAASKVRSFLVMTPYRKRFLRLRAAAIVLQSHYRMQRIKRAYEMQRETKAAIVIQAAYRGFKIRKHFVRLKQAVVTLQMHFR-------------------AVKTGRYERIRYTQSRNAVIKLQACARGWLVRKEVMHIKQFFLVFFYFYYLYIKHQLLGIYPIELITNAILLLLQMWYRAKLQRRYYLHFRQKIVTLQRAIRAWLQLRNN---------------------AACKIQRSMRDYLQRRRQARAVSGIVKFQALWRGYICRKARDTKAVRVLRKRLQRVSQDVK----EEDKLCNRTVVA------------------LDYLLSSKHLSFILAALQHLEVATRLSAVCCENMAQSGAVKTIFVLIRSCNRSIPCMEVIKLSVMVLLNLSKYERTVQAVYEVENSVDILLDLMQIFREKAGDKVSDKGGSIFTKTCCLMAIFALHSQRA 3241          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 565.074 bits (1455), Expect = 1.774e-162
Identity = 556/2165 (25.68%), Postives = 990/2165 (45.73%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF------------------------NTHL-----SKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE----------------NPIXXXXXXXX-----------XXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTS----------------------ANLFDKEI--------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS---------ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS-SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGY----LRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQY----YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKS---------------------------YICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIA----ATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF-----NAHKKFLKLKNASICIQKNVRRYCQMKLYRD---TRNASIVIQKYVRGFL---------------------------CRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIF----VRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLRCHL 6384
            D+ W+ +QE  F  WLN I                         N H      + TK E   K      +  +L  S C++        AI ++  E+    L  + D   +K     + +   +++YN  WL     + ++  F   +SL SN++      FI  ++LWN DIA ++R   + +  +     +L++  L++ L +++ LD AK+  +   D  LF KD+  K+S ++L  F+  FL GEG++ +      L VSH+QT +DE+DF V+NL+ D+  GVRL  +  +  +  +  KLR PA+   +K  N+E+A++A  D G  +    G  I    I   HRE+TLALLW ++    +D ++   +L  EI++ +                NP       S+            LL+ WV +VC  Y+  V N + +  DGR FC L+++Y P YL LN +   TT T                         +FD+ +        LL+NE+ NF +  + +  +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ VWR Y                         R    KK    K   +I ++VV+ +L+R R+ K   SA +IQK +RRYL + + +++K+         AT+++Q  ++ Y  ++ ++ +  S + +Q  +R  + +S+YK+I+++T  +Q +++ +L     R++++ +  ++++IQ AF  + KR+      +A +IIQ  YR    C+    N+  + I IQ V      ++K        I IQ + R   +R  FL  K ++  L+ Y+  Y    L RK+FL+MR++ I +Q + R + +R  +   + + ++      R   KK++   K   +L+Q+ VR   Q+++F+ ++ AA +IQ  +R +   K+ + ++    ++A+VIQ   R +  +K  L+++ +V +                        Q+L R Y  +K++L++++++I IQ  FR    R ++   RK T  VQ+  +    M + R+ ++ ++   I +Q  +R    RR      KA   +Q ++R  ++KKQ  L  +AA ++Q+++++                           Y  +K  +  + +   IQ   R    RK + +  + V+ +Q   R   + ++ QKK      AT+T+    +G+  RK+   +  + I IQ++FR +  +K   ++K +A+ IQ+  R  +    +R+ Y     + K +Q   RG  VRK L   H+SA LIQ FYR +  +  +   R A+ +IQ  +R H + Q     Y   +K    +QS  R +   ++     KAAT IQ   + +I+ K+Y T R + + IQ++   +L  +                   L R+ Y R   +  ++Q   R ++VRKRI+  Q++  ++Q  YRA      +R  ++    A   LQ   RG  +R+N         ++QS  +    R  Y++LR ++ +VQ  +R       N H +++ ++NA++CIQ   R    +K+ RD      A+ +IQ++ + FL                            R +Y R   A ++LQ  FR +    RI+    +A +IQ  +R +  +  +   +++ + IQ  +KA +     RK YL+ RQ  + IQ   R    R     +  +   IQ   R +    +Y+K + AV  IQ+ FR    R SE   +  +K A + IQ  +R + +RK+ + + +   +IQS  + +     ++ ++SA  +IQ   R I      R ++ ++ K  + IQ   R  +VR     +  +   IQSFYRM+ + K Y +  Q++  IQ+  R   AR  +                      YQ +      +Q+  RG   ++  Q+M  A   IQ+  K +  RK Y  L+ S I +QR  R  ++    R+ FLK ++A+I I    RG+  R               E L+ R  A+ +IQ+ FR + Q   Y   K   ++IQ+ +R           ++ L  +A+++Q ++RG++ R +L
Sbjct:  658 DERWMAKQERGFTWWLNFILTPDDFAVKRDSSKVQAATLILGSENAHKVSVPKAPTKEEVSLKAYTTRCKLNRLRRSACRLFTSEPVVKAILRLEVEIEAQRLLVRRDRHLWKDIGERQKILNWLLSYNPLWL----RIGLETIFGELISLESNSDVTGLAVFILNRLLWNPDIAAEYRHPSVPNLYRDGHEEALSKFTLKKLLLLIFFLDHAKQFRLIDHDPCLFWKDAEYKTSKDLLLAFSRDFLSGEGDLSRHLGYLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVTVELLAQSWSLSKKLRVPAISRLQKMHNVEVALQALTDRGVLLKDERGVSITSKDIVDRHRERTLALLWKIVFSFQVDVLLSTKQLKEEIQILKESYNTQKQLAALRSLANPAPTQTRESDQFEPEKYNERVSLLMEWVNAVCRFYSTKVQNFTVSFSDGRVFCYLVNHYHPSYLPLNAVCQRTTQTVECSQSGTAMLNSSDSDNSLEVWPGVFDQGVTSSALYKELLKNEQTNFSLVHAAVADLGGIPAMVHHSDMSNTIPDEKVVITFLSFLCARLLDLRKETRAARVIQTVWRNY-------------------------RLKVEKKLLEHKAARVIQRAVVQ-FLSRCRLQKRSHSAAVIQKYFRRYLAQRQLKELKALKHKELQDNATLIIQRFWKGYSARRRFIILRHSAICMQARVRAKIAQSSYKQIQQATVTLQSHMRAWLLGKKKRQEYLHIKSSVIIIQHAFTRW-KRQKQKRHTEAVLIIQKCYRRWKACKSMAQNM--AAIKIQSVYRMHRERQKFLDTKCKIIKIQSWFRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAACVLQSYWRMRQ-EKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI------------------------QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCAR-------------------LQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVH-QYMAIRNAALCIQSAFR---GLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNF-------------------YQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLRER---------------EELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNL 2707          

HSP 2 Score: 363.614 bits (932), Expect = 4.980e-100
Identity = 439/1748 (25.11%), Postives = 786/1748 (44.97%), Query Frame = 1
Query: 2014 RAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFR-RYLVQKN---YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQ---------------------------SAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRML---------------------------SLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA--LIQRRKFQYLR--NAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC----QSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKK----QIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFI----CQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFR----GFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGI-FVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKN--------ASIIISKHVRGV-----LVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-FIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK---AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            RAA  IQ  +R +R        F       +++QS  RR    K    ++  + I Q++ + Y AR R  ++K+++I IQ  +R    R+RY  ++ AT  +Q  FR +  +QK    Y+ +  + + +Q  +RG+  R   +   K+  I+Q   + +  +K++  L +A ++IQ                           +A+RGY  R++   Q  AA+ IQ+ +RS   R+ YL +R+SV+ IQ+        RK +K+     R+ + +Q   RG++ R+    + +A   ++  F  Y  +KQ   M+ + + +Q+  R +                           ++R     + KSA +IQ  ++ +  + ++ A + A+ LIQ   RA  L Q ++F YLR   +A ++Q  +R + VR++    + +A  IQ   RS I  K Y  ++ + L IQ+H   FL  +  +   +R+       QS  R ++++K+ L++++S I++Q+++RA+      RKQ+L   + T ++Q   +  + R+    +      IQ   R + QR  Y + ++A   +Q ++R+ KE+     Q +    AA  +Q  F+    ++       +  +IQ++ +  + R++F       IL Q + RM +     +++Y +   A + +    +G+  R++     +S  VIQ +FR    +  + +++ +AIVIQ+  +  +    +RK Y  Q  +   IQ   RG   RK L+  H++A+ IQ  +R ++ R  +I  + A  VIQ++FR + +R     QY+  ++ V+ IQS  R F   +  +   + AT IQ   K +  R  Y   + +  +IQ   R   + +  + +   +      +    R  L+R   K    AAT IQ   R Y  RK  ++  +AV  IQ  YRA   R H+       + AA  LQ   RG   R    +       +Q   K F  RK Y +L++S+I++Q+ +R    G    +KFLK ++A+ICIQ   R   + +  +    A+  IQ   R     + Y     AA+++QRH+R+Y   R   LE K       AA I+Q  YRG   R +     N+   +Q Y++ +  R+ Y         +Q  VR    R R  R ++  +            +KY   + AV  IQ  FR     +  +   +A+I+IQ  ++ + +R+E+ K  +  V IQ+  R +      K ++ +  +IQ   R     RL+                    R ++L+I+ + I IQS +R    ++   + ++     +   R +I R++F++ KS  ++IQ+ +R +  ++S  ++L  +IF    +R    +LK Q + T  +  +    G + R  Y   + +VI+LQ   RG+L+RK  + +K           + I   + G+     +   HF++    ++   +  L+ R  A+ KIQ   R Y+Q+RR     S  +  Q  WR +I  K       R+ R R  R   + K    E  ++ NR + A                   D   S   ++ +L  L  LE  T LS   C+ + +S A K +  L+  CNR +  +EV+   + V  NL K        ++V  S  I L    ++R     K   KG +IF  TC L+ +     Q++
Sbjct: 1568 RAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI-QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRY---RSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFA-------LQHAVRTTQVRFRANRARVDAV------------KKYATIRMAVKRIQSAFRARKAARDAEK-DSAAIVIQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQ--------------------RAQYLSIRSAAITIQSAFRGMLAHR---VAEREQAASKAQWRGYIQRRKFVQYKSAALLIQQRYRAYRLQKS--QHLLHLIF----IRKHFVRLK-QAVVTLQMHFRAVKTGRYERIRYTQSRNAVIKLQACARGWLVRKEVMHIKQFFLVFFYFYYLYIKHQLLGIYPIAFIYYLHFRQKIVTLQRAIRAWLQLRNNAACKIQRSMRDYLQRRRQARAVSGIVKFQALWRGYICRKARDTKAVRVLRKRLQRVSQDVK----EEDKLCNRTVVA------------------LDYLLSSKHLSFILAALQHLEVATRLSAVCCENMAQSGAVKTIFVLIRSCNRSIPCMEVIKLSVMVLLNLSKYERTVQAVYEVENSVDILLDLMQIFREKAGDKVSDKGGSIFTKTCCLMAIFALHSQRA 3239          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Match: lrp8 (LDL receptor related protein 8 [Source:Xenbase;Acc:XB-GENE-980035])

HSP 1 Score: 560.451 bits (1443), Expect = 5.803e-161
Identity = 553/2164 (25.55%), Postives = 989/2164 (45.70%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF------------------------NTHL-----SKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYID---------------AVIDRDKLISEIKLFENPIXXXXXXXX-----------XXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTS----------------------ANLFDKEI--------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS---------ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS-SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGY----LRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQY----YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKS---------------------------YICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIA----ATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF-----NAHKKFLKLKNASICIQKNVRRYCQMKLYRD---TRNASIVIQKYVRGFL---------------------------CRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIF----VRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLRCHL 6384
            D+ W+ +QE  F  WLN I                         N H      + TK E   K      +  +L  S C++        AI ++  E+    L  + D   +K     + +   +++YN  WL     + ++  F   +SL SN++      FI  ++LWN DIA ++R   + +  +     +L++  L++ L +++ LD AK+  +   D  LF KD+  K+S ++L  F+  FL GEG++ +      L VSH+QT +DE+DF V+NL+ D+  GVRL  +  +  +  +  KLR PA+   +K  N+E+A++A  D G  +    G  I    I   HRE+TLALLW ++    ++                  +  K ++ ++   NP       S+            LL+ WV +VC  Y+  V N + +  DGR FC L+++Y P YL LN +   TT T                         +FD+ +        LL+NE+ NF +  + +  +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ VWR YR                      V + L  +K K+ +    + Q  V ++L+R R+ K   SA +IQK +RRYL + + +++K+         AT+++Q  ++ Y  ++ ++ +  S + +Q  +R  + +S+YK+I+++T  +Q +++ +L     R++++ +  ++++IQ AF  + KR+      +A +IIQ  YR    C+    N+  + I IQ V      ++K        I IQ + R   +R  FL  K ++  L+ Y+  Y    L RK+FL+MR++ I +Q + R + +R  +   + + ++      R   KK++   K   +L+Q+ VR   Q+++F+ ++ AA +IQ  +R +   K+ + ++    ++A+VIQ   R +  +K  L+++ +V +                        Q+L R Y  +K++L++++++I IQ  FR    R ++   RK T  VQ+  +    M + R+ ++ ++   I +Q  +R    RR      KA   +Q ++R  ++KKQ  L  +AA ++Q+++++                           Y  +K  +  + +   IQ   R    RK + +  + V+ +Q   R   + ++ QKK      AT+T+    +G+  RK+   +  + I IQ++FR +  +K   ++K +A+ IQ+  R  +    +R+ Y     + K +Q   RG  VRK L   H+SA LIQ FYR +  +  +   R A+ +IQ  +R H + Q     Y   +K    +QS  R +   ++     KAAT IQ   + +I+ K+Y T R + + IQ++   +L  +                   L R+ Y R   +  ++Q   R ++VRKRI+  Q++  ++Q  YRA      +R  ++    A   LQ   RG  +R+N         ++QS  +    R  Y++LR ++ +VQ  +R       N H +++ ++NA++CIQ   R    +K+ RD      A+ +IQ++ + FL                            R +Y R   A ++LQ  FR +    RI+    +A +IQ  +R +  +  +   +++ + IQ  +KA +     RK YL+ RQ  + IQ   R    R     +  +   IQ   R +    +Y+K + AV  IQ+ FR    R SE   +  +K A + IQ  +R + +RK+ + + +   +IQS  + +     ++ ++SA  +IQ   R I      R ++ ++ K  + IQ   R  +VR     +  +   IQSFYRM+ + K Y +  Q++  IQ+  R   AR  +                      YQ +      +Q+  RG   ++  Q+M  A   IQ+  K +  RK Y  L+ S I +QR  R  ++    R+ FLK ++A+I I    RG+  R               E L+ R  A+ +IQ+ FR + Q   Y   K   ++IQ+ +R           ++ L  +A+++Q ++RG++ R +L
Sbjct:  684 DERWMAKQERGFTWWLNFILTPDDFAVKRDSSKVQAATLILGSENAHKVSVPKAPTKEEVSLKAYTTRCKLNRLRRSACRLFTSEPVVKAILRLEVEIEAQRLLVRRDRHLWKDIGERQKILNWLLSYNPLWL----RIGLETIFGELISLESNSDVTGLAVFILNRLLWNPDIAAEYRHPSVPNLYRDGHEEALSKFTLKKLLLLIFFLDHAKQFRLIDHDPCLFWKDAEYKTSKDLLLAFSRDFLSGEGDLSRHLGYLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVTVELLAQSWSLSKKLRVPAISRLQKMHNVEVALQALTDRGVLLKDERGVSITSKDIVDRHRERTLALLWKIVFSFQVNIFSLELRKVEIQILKESYNTQKQLAALRSLANPAPTQTRESDQFEPEKYNERVSLLMEWVNAVCRFYSTKVQNFTVSFSDGRVFCYLVNHYHPSYLPLNAVCQRTTQTVECSQSGTAMLNSSDSDNSLEVWPGVFDQGVTSSALYKELLKNEQTNFSLVHAAVADLGGIPAMVHHSDMSNTIPDEKVVITFLSFLCARLLDLRKETRAARVIQTVWRNYRL--------------------KVEKKLLERKHKAAR----VIQRAVVQFLSRCRLQKRSHSAAVIQKYFRRYLAQRQLKELKALKHKELQDNATLIIQRFWKGYSARRRFIILRHSAICMQARVRAKIAQSSYKQIQQATVTLQSHMRAWLLGKKKRQEYLHIKSSVIIIQHAFTRW-KRQKQKRHTEAVLIIQKCYRRWKACKSMAQNM--AAIKIQSVYRMHRERQKFLDTKCKIIKIQSWFRCKKDREAFLMQKESILTLQKYYRAYKQGRLDRKKFLEMRSAAISIQAHYRGMRVRQLYYRIKAACVLQSYWRMRQ-EKKKYDHVKQLVVLLQSNVRKCQQQKQFKLMKRAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI------------------------QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCAR-------------------LQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVH-QYMAIRNAALCIQSAFR---GLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNF-------------------YQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLRER---------------EELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRYRSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNL 2734          

HSP 2 Score: 328.946 bits (842), Expect = 2.071e-89
Identity = 367/1483 (24.75%), Postives = 679/1483 (45.79%), Query Frame = 1
Query: 2014 RAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFR-RYLVQKN---YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQ---------------------------SAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRML---------------------------SLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA--LIQRRKFQYLR--NAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC----QSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKK----QIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFI----CQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFR----GFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVR----RYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRR----YICISKFKMIKSATLIIQKHIRGIFV------RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRM----HYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR-TATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRK 6078
            RAA  IQ  +R +R        F       +++QS  RR    K    ++  + I Q++ + Y AR R  ++K+++I IQ  +R    R+RY  ++ AT  +Q  FR +  +QK    Y+ +  + + +Q  +RG+  R   +   K+  I+Q   + +  +K++  L +A ++IQ                           +A+RGY  R++   Q  AA+ IQ+ +RS   R+ YL +R+SV+ IQ+        RK +K+     R+ + +Q   RG++ R+    + +A   ++  F  Y  +KQ   M+ + + +Q+  R +                           ++R     + KSA +IQ  ++ +  + ++ A + A+ LIQ   RA  L Q ++F YLR   +A ++Q  +R + VR++    + +A  IQ   RS I  K Y  ++ + L IQ+H   FL  +  +   +R+       QS  R ++++K+ L++++S I++Q+++RA+      RKQ+L   + T ++Q   +  + R+    +      IQ   R + QR  Y + ++A   +Q ++R+ KE+     Q +    AA  +Q  F+    ++       +  +IQ++ +  + R++F       IL Q + RM +     +++Y +   A + +    +G+  R++     +S  VIQ +FR    +  + +++ +AIVIQ+  +  +    +RK Y  Q  +   IQ   RG   RK L+  H++A+ IQ  +R ++ R  +I  + A  VIQ++FR + +R     QY+  ++ V+ IQS  R F   +  +   + AT IQ   K +  R  Y   + +  +IQ   R   + +  + +   +      +    R  L+R   K    AAT IQ   R Y  RK  ++  +AV  IQ  YRA   R H+       + AA  LQ   RG   R    +       +Q   K F  RK Y +L++S+I++Q+ +R    G    +KFLK ++A+ICIQ   R   + +  +    A+  IQ   R     + Y     AA+++QRH+R+Y   R   LE K       AA I+Q  YRG   R +     N+   +Q Y++ +  R+ Y  ++      Q   R    R  +  ++  ++M+V  IQ   R     R   K   A++ IQ  ++  +  + +  +  A+++IQ  FR +  RK  K    +   IQ++ R      +  +++  I+SA + IQ   RG+             K+   +V     +    +R  F+ +K++++ +Q  +R      YE   Y   + ++  +Q   R ++ RK  + IK   ++   F+  ++   S  + L  + F Q +V  + A   + ++R  A   IQ++++ Y  R+        +++ Q   RG++ RK
Sbjct: 1595 RAACVIQTYYRSHRATKQAVHRFKQMRHAAVVIQSAFRRMQARKAKLQVRSAVKI-QALSRSYFARKRFLEIKRASIKIQSAFRMRQRRVRYCALRKATFFVQQKFRAKKQMQKEREAYINMQVACIKVQAAVRGHFVRREIQSWHKAATILQAEYRMWRQKKQYKLLYRAAIIIQEHYRAHKMQVHQRAYFLAIKQSAVRLQAAYRGYTVRKSVKTQRLAALHIQTAFRSYRIRKNYLRMRQSVVTIQRWYRCKTSGRKEQKKYLEIQRATVTVQSAYRGWVTRKQVKVWNTAAICIQSAFRRYAAQKQIRTMKKAALTIQQRYRAVLAGRRERERYLKLCMSAKRVQAMWRGRAVRKDLERQHKSAALIQSFYRMHVCQTQYKAMRRASHLIQNFYRAHKLGQLQQFYYLRLKKSATVLQSAYRGWKVRRQMHSFHKAATTIQSAFRSFILHKRYHTLRTATLTIQRHYSAFLCARLQRTKYVRVRKSVIVLQSAFRSFMVRKRILRMQQSAIVVQRNYRALLTGRRVRKQYLELHRATCMLQAAWRGRKVRRNIKAMDKAATVIQSQYRMMRQRCYYRELREAARVVQLRYRASKERDRNVHQYMAIRNAALCIQSAFRGLKVRRDLNAKHAAAALIQRHYKCFLERRRFVLLRNATILTQQRFRMKVHAEQIRQQYLRLKKAVVVLQTAFRGWKERERINHMHYSATVIQAAFRMHKAKDSYHTLRHAAIVIQQRYKANMASKSERKTYLKQRQSAVTIQATFRGMKERKMLSIMHKAASTIQASFRMHQCRSQYIKVQWAVHVIQQRFRANKLRDSEKLQYHVIKRAVLCIQSCYRGFKVRKDLEFQHRMATRIQSAYKMHRRRVVYQNMQSAVSLIQTWYRSIATCRQTRAEFLQLRKATILIQAACRGTLVRRNIKAMHSAATCIQSFYRMYSQRKYYIMYLQAVCTIQQQYRAKKARDHYFNFYQNSRKAATLLQAGFRGMKTRIWIQQMHQAAATIQQAFKSFKERKSYLELKASTILIQRQYRASVLGRAERQKFLKCRSAAICIQAAYRGLREREELKLRHRAAAQIQSLFRMHRQHVSYLANKQAAVVIQRHYRRY---RSCKLEHKQYLKLCNAAIIVQALYRGKKSRKNLRDMHNAATVVQAYYRMHRQRQYYFALQHAVRTTQVRFRANRARVDAVKKYATIRMAVKRIQSAFRARKAARDAEKDSAAIV-IQAQWKMHTVRREYVKMTEAAVVIQAVFRGHRTRKMLKAMEVSACLIQAWYRSCRLTRLQRAQYLSIRSAAITIQSAFRGMLAHRVAEREQAASKVRSFLVMTPYLLHLIFIRKHFVRLKQAVVTLQMHFRAVKTGRYERIRYTQSRNAVIKLQACARGWLVRKEVMHIKQFFLVFFYFYYLYIKHHS-TKTLYYLHFRQKIVTLQRAIRAWLQLRNNAACKIQRSMRDYLQRRRQARAVSGIVKFQALWRGYICRK 3071          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Match: Aspm (abnormal spindle microtubule assembly [Source:MGI Symbol;Acc:MGI:1334448])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 651/2423 (26.87%), Postives = 1090/2423 (44.99%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFENPIXXXXXXXXXXXXV----------------------------WVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTSA------------------------NLFDKEI-------LLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMK---------KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCII-IQKYIR----GFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIK------QSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQK---NIRALL-QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFK---------------------------SYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKK----YLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRK---------------------------IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYI----RQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIR----GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT---RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFR------KYLIIRRIDL------------EQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYI----SRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCY---------ILRKE-------------------FKKKRKNCVKI-----QSYIRR----YICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVR------------------TRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLS---IIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRK------------IFLKLKNASIIISKHVRGVLVRNHFQKNKQHMK--IFAQENLRKRLEASIKIQAYFR----------CYIQKRRYCLLKSYTLLIQQRWRFIVLKRS------AVVIQRIWRGRQLRCHLNAKKIGH-EISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRNINSKR-GTKGITIFCHTCLLLVLLIKMEQ 6867
            D+ W ++QE  F  WLN I        KT V  +N                   P   E                  A  L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL     + ++  F   + L  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L ++  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +  S   L VSH+QT +DE+DF V+NL+ D+  GVRL R  ++L  N ++  KLR PA+   +K  N++L ++  K  G  +    G  I    +   HREKTL LLW +     +D  ++ D+L  EI   ++  S+    S                                  WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   T+ + A                           D E        LLENEK+NF +  S  + +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   ++QS+V  FL  ++ +      ++ Q   +R  A+ ++  +K         KSA+LIQ  +RRY  R R+ ++K  +V+LQS  R  +   +Y +   + + IQ + R YL R      +++++ S+ +IQ   + +  R+K    TKA V +Q AFR +  R+   I+ ++AV+IQS+YR     + Y+ +R  VI+IQ+ V +    +KL KR +  I+ +QK+ R    G +   ++L+ ++A   L+  F G   R  +     +  +LQ   RM   R  FL  +K  I +Q   ++Y   +++   K A I IQT  RA I  R+    +Q  R++ I++Q   R    RK F     S I IQ   R+ IC+K +   K      QS++ +++  K +L  ++    I R    Q L  +   +K+Y++VR+S I +Q HFR    RKQ     K  I +Q Y +M   RQ++LK+    + IQ      RA + QR+ +++ K+A I +Q  +R CK ++QI   + AA  +Q+ F+                           +Y  + QF K +E+V  +Q   R    R+Q +++ +  + +QS  RM + +++Y+   AA   I + V+   A K+    Y+  RH+ +V Q +++  M R+        A +IQ Y R  I+R+                           +Y     A+  +Q   RG  VRK +   H++A  IQ  +R+Y+ +K +   R +AIVIQ+ +R   I     Q+Y   R+  + +Q+  R     ++ + M  AAT I+ + K    R +Y+  R +A+IIQ   R Y                  Y+ + +    Y R L A   +Q   RG  VR+ +     A  +IQ+ +R H  +++F   + AA  +Q+  R    G    + ++  R  ++L+Q+  +G   R+  + +  ++ ++Q+ FR F   +KFL L+  +I IQ+  R     K  R       A I IQ   RG++ R + Q+   AA ++Q  FR      +Y  ++R  +            ++ AA I+Q   RG   R+H     +S   IQ+ F+A+++R++++ +R+  IF+Q   R  +      ++FL+L+ + I IQ   R     +K  +  +A   IQ  FR       F   K ASI IQ+ +R Y         ++R+E                   F ++R+   K+     ++  RR    Y+C       K  T ++Q H +G+    + ++     +  QK+ RA   R                   ++L+  ++   IQ++YR    +K Y  + +++ +I+      +AR+RFL++++  IIIQ+ +R  L+ R  + NL        +Q+  RG  A+  + + R+A ++IQ+ V+     K  +I    L+KS + +Q  +RG+L+RK             F       +   K  R   +    +  K+HM   IF Q   RKRL+    I+ Y +          C++Q+ R     + +++ +   RF++ +R       A  IQ +WRG   R     KK  H EI  IR      +    + N +    ++AL  L    LT   ++ +L  L  LE VT LS   C+ + ES A   +  ++  CNR V  +EVV   + V  N+ K     A V   +      ++L++  +YR     R   K  +IF  TC LL +L+K EQ
Sbjct:  660 DERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVSLRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIGQRQKVLNWLLSYNPLWL----RIGLETVFGELIPLADNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPLLFRDGHEAALSKFTLKKLLLLICFLDHAKISRLIDHDPCLFCKDAEFKASKELLLAFSRDFLSGEGDLSRHLSFLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVRTVELLTQNWNLSDKLRIPAISRVQKMHNVDLVLQVLKSRGVPLTDEHGSAISSKDVVDRHREKTLGLLWKIALAFQVDISLNLDQLKEEIDFLKHTHSIKRAMSALTCPSQAITNKQRDKRISGNFERYGDSVQLLMDWVNAVCAFYNKKVENFTVSFSDGRILCYLIHHYHPCYVPFDAICQRTSQSVACAQTGSVVLNSSSESEGGCLDLSLEALDHESTPEMYKELLENEKKNFHLVRSAARDLGGIPAMIHHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKRDLK-HHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAYWRRYSTRKRFLRLKHYSVILQSRIRMKIALTSYKRYLWATVTIQRHWRAYLSRKRDQQIFRKLKSSSLVIQFMFRRW-KRRKLQLQTKAAVTLQRAFREWHLRKQ--IRERSAVVIQSWYRMHRELQKYIYIRSCVIVIQRRV-RCFQAQKLYKRRKDAILTLQKHYRARQKGKLAHADYLQKRAATIRLQAAFRGMKARHSYRLQIGAACVLQSYWRMRQERVRFLNLKKMVIKLQAHIRKYQQLQKYKKIKKAAITIQTHFRASISARRVLASYQKTRSSVIVLQSACRGMQARKAFRHALASVIKIQSYYRAYICRKTFQNFKNATIKLQSIVKMKQSRKQYLQIRAAALFIQRWYRSQKLASQK--RKEYIQVRESCIKLQSHFRGCLVRKQLRLQCKAAISLQSYFRMRTARQRYLKMCKAALVIQSFYCAYRAQISQRKNFLQVKRAAICLQAAYRGCKVRRQIKQQSTAAVTIQRVFRGHSQRMKYQTMLQSAVKIQRWYRAQKVAYDMRIQFLKTREAVVCLQSAYRGWQVRQQLRRQHEAAVKIQSTFRMAVAQQQYKLLRAAAAVIQQHVRARAAGKRQHLAYIQLRHAALVFQAAWKGKMLRRQIARQHQCAALIQSYYRMHIQRRKWSIMKTAALQIQLCYRAYKVGKEQRHLYLKTKAAVVTLQSAYRGMKVRKRVAECHKAAVTIQSKFRAYRTQKKYTTYRTSAIVIQRWYRNIKITTQQHQEYLNLRRAAVQVQAAYRGIRVRRRIQHMHMAATLIEAMFKMRQSRVRYLKMRTAALIIQVRYRAY------------------YLGK-IQHEKYLRTLKAIKTLQAGVRGARVRRTVRKMHFAATLIQSHFRGHRQQTYFHRLRKAATMVQQRYRAVKEGSAEFQRYSRLRRSVLLIQAAFRGLRTRRHLKAMHLAATLIQRRFRTFAMRRKFLSLRKTAIWIQRQYRARLYAKYSRQQLLLEKAVIKIQSSYRGWVVRKRVQKMHRAATVIQATFRMHGAYMRYQHLKRASVVIQVHTAAELQRQKHAAVILQAAVRGMKTRSHLKTMHSSATLIQSQFRAFIVRRRFIALRKAAIFVQRKFRATLYAKHKLHQFLQLRKAAITIQSSYRRLMVQKKLQEMHRAAALIQATFRMHRTYVAFHIWKCASIRIQQCYRTYRTIKLQKEKLIREEQHSAAVLIQSTYRMYRQRCFYQQRRWAAKVIQKTYRANKRRQDLLYVC-------KEETPLLQMHFQGLNTAKQGRQQHGAAMITQKHFRAFKARRLMEAERGFQAGCRKYKAKKYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAHACWLQQDR-----AASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWR-----KKNDHTEIKAIRRSLRAVSTTVEEENKLYRRTERALHHL----LTYKHLSAILDALKHLEVVTRLSPLCCENMAESGAVSTIFVVIRSCNRSVPCMEVVGYAVQVLLNVAKYDKTIAAVYEAENCVDTLLELLQ--VYREKPGDRVAEKSASIFTRTCCLLAVLLKTEQ 3029          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Match: Aspm (abnormal spindle microtubule assembly [Source:MGI Symbol;Acc:MGI:1334448])

HSP 1 Score: 286.189 bits (731), Expect = 7.284e-77
Identity = 262/978 (26.79%), Postives = 433/978 (44.27%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFENPIXXXXXXXXXXXXV----------------------------WVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTSA------------------------NLFDKEI-------LLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMK---------KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL---ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLFKRKL-EKRLRS-------------CII-IQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKK 3114
            D+ W ++QE  F  WLN I        KT V  +N                   P   E                  A  L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL     + ++  F   + L  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L ++  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +  S   L VSH+QT +DE+DF V+NL+ D+  GVRL R  ++L  N ++  KLR PA+   +K  N++L ++  K  G  +    G  I    +   HREKTL LLW +     +D  ++ D+L  EI   ++  S+    S                                  WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   T+ + A                           D E        LLENEK+NF +  S  + +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   ++QS+V  FL  ++ +      ++ Q   +R  A+ ++  +K         KSA+LIQ   R+Y  +    K+++A  + Q+ +RR+   K YL + +++ II+  +   L R  + ++R +  IIQ+  +  L     ++ +K  +A  VIQ+ FRGY  R+++  Q  A +IIQ   R+ V     R  Y+ L+KS +++Q +V   L ++++ E++ ++             C + IQ+  R  +  RN  K   +V  ++ +F   L+RK+F++  + ++                              R  A   ++ +  A  +IQ  VR  +  R+ + + + A  IQ  +R YS RKK
Sbjct:  660 DERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVSLRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIGQRQKVLNWLLSYNPLWL----RIGLETVFGELIPLADNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPLLFRDGHEAALSKFTLKKLLLLICFLDHAKISRLIDHDPCLFCKDAEFKASKELLLAFSRDFLSGEGDLSRHLSFLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVRTVELLTQNWNLSDKLRIPAISRVQKMHNVDLVLQVLKSRGVPLTDEHGSAISSKDVVDRHREKTLGLLWKIALAFQVDISLNLDQLKEEIDFLKHTHSIKRAMSALTCPSQAITNKQRDKRISGNFERYGDSVQLLMDWVNAVCAFYNKKVENFTVSFSDGRILCYLIHHYHPCYVPFDAICQRTSQSVACAQTGSVVLNSSSESEGGCLDLSLEALDHESTPEMYKELLENEKKNFHLVRSAARDLGGIPAMIHHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKRDLK-HHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKKYLSKVEAACRI-QAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKIL----------------------------STRREAHACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRKK 1603          

HSP 2 Score: 134.035 bits (336), Expect = 1.697e-30
Identity = 149/545 (27.34%), Postives = 253/545 (46.42%), Query Frame = 1
Query: 5410 ASIIIQKNFRCYILRKEFK---KKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVR-----LKYKKIIKL----VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLS---IIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRK------------IFLKLKNASIIISKHVRGVLVRNHFQKNKQHMK--IFAQENLRKRLEASIKIQAYFR----------CYIQKRRYCLLKSYTLLIQQRWRFIVLKRS------AVVIQRIWRGRQLRCHLNAKKIGH-EISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRNINSKR-GTKGITIFCHTCLLLVLLIKMEQ 6867
            A+ +IQ  +R Y L+++ K   ++ K    IQS +  ++   + +   SA L+IQK  R +  +     LK +K+ KL     V IQ   R    + ++L+  ++   IQ++YR    +K Y  + +++ +I+      +AR+RFL++++  IIIQ+ +R  L+ R  + NL        +Q+  RG  A+  + + R+A ++IQ+ V+     K  +I    L+KS + +Q  +RG+L+RK             F       +   K  R   +    +  K+HM   IF Q   RKRL+    I+ Y +          C++Q+ R     + +++ +   RF++ +R       A  IQ +WRG   R     KK  H EI  IR      +    + N +    ++AL  L    LT   ++ +L  L  LE VT LS   C+ + ES A   +  ++  CNR V  +EVV   + V  N+ K     A V   +      ++L++  +YR     R   K  +IF  TC LL +L+K EQ
Sbjct: 1237 AARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAK-KYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAHACWLQQDR-----AASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWR-----KKNDHTEIKAIRRSLRAVSTTVEEENKLYRRTERALHHL----LTYKHLSAILDALKHLEVVTRLSPLCCENMAESGAVSTIFVVIRSCNRSVPCMEVVGYAVQVLLNVAKYDKTIAAVYEAENCVDTLLELLQ--VYREKPGDRVAEKSASIFTRTCCLLAVLLKTEQ 1764          

HSP 3 Score: 90.5077 bits (223), Expect = 2.760e-17
Identity = 101/371 (27.22%), Postives = 178/371 (47.98%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFT--ETRNKII-LVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKN---------ASICIQKNVRRY------------CQMK-LYRDTR---------NASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR--RIDLE-QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRK----KYLEIRQKTIFIQCLVRRYISRNRFLRLK---------------MSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKE-----FKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRG 5580
            AA  +Q   R Y ++++    + R+K   ++QS++  F++R+  QK  S+++++QK +R  +A +K   LKN         +++ IQ   R+Y            C+++  YR  R          A  +I+ Y+   L R ++ +   AAII+QR +R  L +R  R +L+  +AA +IQ  +RGY  R  FL Q+++ + IQ + +A +  K    KY+++++ T+ +Q LVR ++ R R    K               M  + IQ+  R + T R   K   +VI IQ+ FR+  + K F         I++  +    R+E      ++ R   V IQ  +RR++   + + I S    IQ   RG
Sbjct: 1237 AARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKKYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRF---------IEQYHKILSTRREAHACWLQQDRAASV-IQKAVRRFLLCRRQEKITSCATRIQALWRG 1597          

HSP 4 Score: 86.2705 bits (212), Expect = 5.608e-16
Identity = 108/420 (25.71%), Postives = 182/420 (43.33%), Query Frame = 1
Query: 2509 KAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLR---------KSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLR-MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSY-ICKKQFRKMKESVTVIQKYQRRLICRKQ 3735
            KA  VIQS    +  RR     + AA++IQ  +R    +R    L+         KS ++IQ    K   K+ L K   +C I Q + R +   + +L    AVNI+E Y    L R++FLKMR + I++Q+  R  LS+R +                     +E + +  A  +IQ   R    R+ F   R+A +IIQ+  R              A+V  K  R       Y+K+K+S +V+Q                       +LVR +L++K+  + +  T +   HF A +            + +Q+  ++H   +   K    VI IQ+  R  LQR+R+I+    ++  +R+  +C      +  ++AA+V+QK  + + +C++Q  K+    T IQ   R    RK+
Sbjct: 1262 KAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKKYLSKVEAACRI-QAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGA---------------------RENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVR--------------AMVAAKQERI-----KYIKLKKSTVVVQ-----------------------ALVRGWLVRKRVSEQKAKTRLF--HFTAAAY------CHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAHAC-----WLQQDRAASVIQKAVRRFLLCRRQ-EKITSCATRIQALWRGYSWRKK 1603          

HSP 5 Score: 85.5001 bits (210), Expect = 9.854e-16
Identity = 96/428 (22.43%), Postives = 203/428 (47.43%), Query Frame = 1
Query: 3511 LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQF-----QKEMKL----VILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARK 4767
            LL  R+ I+  + +    RK++  ++ K     ++AA V+Q    +++ +++ +K   +  VIQK  RR+  +++      +K  KL     +L+Q+  R    KK Y  K+ A   I  + + + A KKYL+   +V +I+      + R+ FL ++ +AI+IQ+  R           T +++  ++N++           H++A +IQ  +R Y+ R++F+ +R+A ++IQ+     ++R      ++++              KY ++KK+   +Q + +G+++RK+   Q+    +       Y           ++ I + Y     +R+  K+ + +   IQ+  R  L RKR +  ++  +I+     AH     ++ Q  AA  +QK +R +L+ +   +  +    +Q+L +G+  RK
Sbjct: 1228 LLDLRKEIRAARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKK-YLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRA----------TLSVRGARENLK----------RHRAACVIQAHFRGYQARQSFLQQRSAVLIIQR-----HVRAMVAAKQERI--------------KYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYC-------HMCALKIQRAYRLHVTLRNA-KKHMDSVIFIQRWFRKRLQRKRFI--EQYHKILSTRREAHAC---WLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRK 1602          

HSP 6 Score: 85.1149 bits (209), Expect = 1.186e-15
Identity = 104/413 (25.18%), Postives = 179/413 (43.34%), Query Frame = 1
Query: 2995 ATILIQTKVRALIQRRKFQYLRN---AAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFR---SCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQ----FQKEMKLVILLQSKIRMIITKKRYQKKIAAT---------------LTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRK----IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRK 4146
            A  LIQT  R    +R  ++ +    AA +IQ     +  R++      +A+VIQK  R +  Q+    +K   L   ++    L+              Q+  RKY   K+YL   ++   IQ  +R   A K++L   K   +++ Y+                        A L RRR++K + A I IQRK+R   S +  ++ +  ++AA V+Q +F+ Y  ++ F + + +V +IQ++ R ++  KQ    + K  K  +++Q+ +R  + +KR  ++ A T               L I +  + +   +    +  SVI IQ  FR  + RK F         I++Y +    R+     +  Q  A  VIQK +R FL+ +        AT IQ  +R Y  RK
Sbjct: 1237 AARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLI--------------QAGCRKYK-AKKYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLS-----------------------AQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRF---------IEQYHKILSTRREAHACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRK 1602          

HSP 7 Score: 81.6481 bits (200), Expect = 1.663e-14
Identity = 94/342 (27.49%), Postives = 170/342 (49.71%), Query Frame = 1
Query: 2995 ATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFL---------IQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA-ISARKQFLNFRKF--TIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQ--------RKFRSCKEKKQIILNNQAATV-------VQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQF----------QKEMKLVILLQSKIRMIITKK-------RYQKKIAATLT-ISKFVKGYFARKK 3873
            A  +IQ+ V   + RR+ Q   +AA++IQK +R  S ++K           +Q  SA++IQ   R    +K YL   ++   IQ   + +   K Y  ++  + I +  +   L ++++LK+R + IIIQ+ +RA +S R    N ++     V+Q + + +Q RQ FL+ +S V+ IQ+++RA++    +R +YIK KK+ + +Q        RK  S ++ K  + +  AA         +Q+ ++ ++  +  +K  +SV  IQ++ R+ + RK+F          ++E     L Q +   +I K        R Q+KI +  T I    +GY  RKK
Sbjct: 1263 AARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKK-YLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAHACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRKK 1603          

HSP 8 Score: 77.411 bits (189), Expect = 2.879e-13
Identity = 123/518 (23.75%), Postives = 219/518 (42.28%), Query Frame = 1
Query: 4147 NFICKR--------NAAIVIQKQFRKHYIR---QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVT---------QRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYR----DTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRK-----EFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKII 5613
            +F+C R         AA +IQ  +RK+ ++   + + E  K    IQS++  F++ ++ ++   AA  IQK  +    ++K            Q +SAV+IQ   R+Y ++K                        Y  K+ AA  IQ   R +   K+ +   KAV II+ +  A   R  F+  + AAI +Q+  R  L                  ++G  AR+  ++ R++ +I Q  FRG+ A + FL+ ++A + IQ++VR     K  R      + +++V+Q  VRG+L R +   Q     +   HF          L+      IQ  YR +             VT++N        KK+++     IFIQ   R+ + R RF+     ++  ++       H  +++Q +A   IQK  RRF   +  + + + +  IQ  +R Y  RK     E K  R++   + + +     + +        L+  KH+  I   LK+ +++
Sbjct: 1222 SFLCARLLDLRKEIRAARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKK------------------------YLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLS-----------------VRG--ARENLKRHRAACVI-QAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLF--HFTAAAYCHMCALK------IQRAYRLH-------------VTLRNA-------KKHMD---SVIFIQRWFRKRLQRKRFIEQYHKILSTRRE-----AHACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRKKNDHTEIKAIRRSLRAVSTTVEEENKLYRRTERALHHLLTYKHLSAILDALKHLEVV 1659          

HSP 9 Score: 74.7146 bits (182), Expect = 1.698e-12
Identity = 106/434 (24.42%), Postives = 190/434 (43.78%), Query Frame = 1
Query: 3733 QFQKEMKLVILLQSKIRMIITK---KRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ---MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARK----CYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAI 5004
              +KE++   L+Q+  R    K   K +Q++  A   I   V  + +R++      + +VIQ  +R           + SA   Q+ LR     K+   Q  +  +IQ   R +  +K L S  ++A  IQ +YR ++  K ++    A  +I+        R+++ + R   I IQ   R  ++++  ++     +AA  IQ   +GY  R+ ++ QR + +IIQ++VR  ++ K                     R  Y +   +  ++Q + RG+LVRKR V EQKA   + +F  A       +C    A+K+Q+  R ++  +N  +  + +I +Q   +  + RK     Y K+ S+            AH  +L+   A+  IQK VRR+   +      + +  IQ   RG+  R K     + AI
Sbjct: 1230 DLRKEIRAARLIQTTWRKYKLKRDLKHHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWR-----------RVSA---QRKLRMLKNEKLAKLQNKSAVLIQAGCRKYKAKKYL-SKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQE-------------------RIKYIKLKKSTVVVQALVRGWLVRKR-VSEQKAKTRLFHFTAAAYC---HMC----ALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTR---------REAHACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRKKNDHTEIKAI 1612          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Match: Myo5b (myosin VB [Source:MGI Symbol;Acc:MGI:106598])

HSP 1 Score: 78.9518 bits (193), Expect = 9.283e-14
Identity = 61/215 (28.37%), Postives = 104/215 (48.37%), Query Frame = 1
Query: 2176 ICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYF 2814
            IC+SV++  +      +  ++ I  +     YL ++R +K + AT+                       +IQ ++RG+L R  Y+R+R +T  +Q++ +GYLAR+  + ++ T+A +V Q  +R    RR Y    +A VIIQSF R+   RR Y               +VL + K         IIQKY RG++ R+ FL+ + A  +++  F
Sbjct:  725 ICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATI-----------------------MIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNY--------------RQVLMEHK-------ATIIQKYARGWMARKRFLRERDAAIVIQCAF 895          

HSP 2 Score: 70.8626 bits (172), Expect = 2.781e-11
Identity = 55/184 (29.89%), Postives = 94/184 (51.09%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCR--IKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHF--LCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTR-GYFTHRKYVKQKKAVINIQKNFRRFSE 5382
            K + A+I IQK+VR + Q   YR  R A++ +Q++ RG+L R   ++ R+  AAI+ Q+ +R     R      +A  IIQ+F R   +R ++  +  ++    IQ Y + ++ RK++L  R   I IQC  RR  +R     LK+     + + R       K V+ ++ + +  K F+  SE
Sbjct:  764 KFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSE 947          

HSP 3 Score: 65.4698 bits (158), Expect = 1.115e-9
Identity = 46/158 (29.11%), Postives = 81/158 (51.27%), Query Frame = 1
Query: 3751 KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARK--KYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ 4218
            +  I++Q  +R  + + +Y++  AATL++ +F +GY AR+  ++L    + IV Q  +R    R+ +  +  + ++IQ + R    R+ Y                   R+ L  H   AT+IQ + R +  RK F+ +R+AAIVIQ  FR+   RQ+
Sbjct:  767 EATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNY-------------------RQVLMEH--KATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQE 903          

HSP 4 Score: 64.6994 bits (156), Expect = 1.863e-9
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 3961 SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ--MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
            + I+IQK +RG+++R  Y     A   +Q+  RG+L R+          L +H  R+            AAIV QKQ+R    R+ Y    +  + IQS  R     + Y+Q  M+  AT IQK A+G++ RK+++ +R +A++IQ
Sbjct:  768 ATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARR----------LAEHLRRT-----------RAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQ 892          

HSP 5 Score: 62.003 bits (149), Expect = 1.390e-8
Identity = 45/149 (30.20%), Postives = 80/149 (53.69%), Query Frame = 1
Query: 5440 CYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVR--LKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRS 5874
             Y+ +    K R+  + IQ  +R ++   K++ +++ATL +Q+  RG   R   ++ +  +  +  QK  R    R  +  + ++ + IQSF R  +  +NY+  LM+   T+IQK  R ++ARKRFL  +   I+IQ  FRR  A++ 
Sbjct:  755 AYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQE 903          

HSP 6 Score: 61.6178 bits (148), Expect = 1.865e-8
Identity = 55/166 (33.13%), Postives = 88/166 (53.01%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY--CLLKSYTLLIQQ-------RWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKI 6399
            L KL+  K R ATI+IQK+V+G+  R  Y+ L+ + + LQRF RG+L R++   L        +  R  +V   FQ  KQ+  + A+   R+   A++ IQ++ R    +R Y   L++    +IQ+       R RF+  + +A+VIQ  +R  + R  L A KI
Sbjct:  757 LEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHL--------RRTRAAIV---FQ--KQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKI 909          

HSP 7 Score: 60.4622 bits (145), Expect = 4.217e-8
Identity = 40/132 (30.30%), Postives = 75/132 (56.82%), Query Frame = 1
Query: 4645 KNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSS--SIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT--RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK 5028
            + A I +QK++RG+L R  +   R   + +Q   +G++AR+  + LR +  +I+ QK +R   A + + ++  A++ IQ   R     + YR     + + +IQKY RG++ R ++ R+  AAI++Q  FR+
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRR 897          

HSP 8 Score: 57.3806 bits (137), Expect = 3.199e-7
Identity = 53/164 (32.32%), Postives = 84/164 (51.22%), Query Frame = 1
Query: 2989 KSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK--KFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLK 3474
            + ATI+IQ  VR  +QR K++ LR A + +Q+  R Y  R+  + L +  +AIV QK  R +  ++ Y ++ ++ ++IQ  T+   V+                 R Y   +Q L   K+T IIQK+ R   ARK+FL  R   IV+Q   +  + RQ+   LK
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVR-----------------RNY---RQVLMEHKAT-IIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALK 908          

HSP 9 Score: 55.8398 bits (133), Expect = 8.846e-7
Identity = 48/159 (30.19%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 2686 LFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQ 3150
            L K + +K   + I+IQK +RG++ R  + + ++A   L+ +  GYL R+  + L+   + I+ QK  RML  R ++               R   +        AT++IQ+  RA+  RR ++   + + A IIQK  R +  RK+FL +  +AIVIQ
Sbjct:  757 LEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAY---------------RRVCR--------ATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQ 892          

HSP 10 Score: 55.4546 bits (132), Expect = 1.167e-6
Identity = 51/173 (29.48%), Postives = 98/173 (56.65%), Query Frame = 1
Query: 4231 RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRK--KYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLA--ATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQ 4737
            R+  I IQ  +R ++   KY++++ A   +Q+  +GY+ R+  +++ + R+A++ QK  R   +R++++    + +IIQ + R   +R  Y++ L+   AT+IQK ARG++ RKR + E+ A  +IQ  +R    R     Q+  A+K++     +L R N     NK++ +Q
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKAR-----QELKALKIEARSAEHLKRLNVG-MENKVVQLQ 932          

HSP 11 Score: 55.0694 bits (131), Expect = 1.541e-6
Identity = 45/169 (26.63%), Postives = 86/169 (50.89%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS--CKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSA 3966
            K +   I IQK++R  LQR +Y + + A + +QR  R    +   + +   +AA V QK ++    ++ +R++  +  +IQ + R +  R+ +++     +L++ K               AT+ I K+ +G+ ARK++L  R + IVIQ +FR    R+   ++K  A
Sbjct:  764 KFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQ-----VLMEHK---------------ATI-IQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEA 911          

HSP 12 Score: 55.0694 bits (131), Expect = 1.808e-6
Identity = 36/132 (27.27%), Postives = 75/132 (56.82%), Query Frame = 1
Query: 3400 FRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRR--RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRK--MKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIR 3783
            FR+ TI++QK ++    R K+ +L++  +++Q+  R  L RR   +++  +A I  Q+++R  K ++      +A  ++Q + ++   ++ +R+  M+   T+IQKY R  + RK+F +E    I++Q   R
Sbjct:  765 FREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFR 896          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Match: Myo5b (myosin VB [Source:MGI Symbol;Acc:MGI:106598])

HSP 1 Score: 78.9518 bits (193), Expect = 9.313e-14
Identity = 61/215 (28.37%), Postives = 104/215 (48.37%), Query Frame = 1
Query: 2176 ICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYF 2814
            IC+SV++  +      +  ++ I  +     YL ++R +K + AT+                       +IQ ++RG+L R  Y+R+R +T  +Q++ +GYLAR+  + ++ T+A +V Q  +R    RR Y    +A VIIQSF R+   RR Y               +VL + K         IIQKY RG++ R+ FL+ + A  +++  F
Sbjct:  725 ICKSVLESLIKDPDKFQFGRTKIFFRAGQVAYLEKLRADKFREATI-----------------------MIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNY--------------RQVLMEHK-------ATIIQKYARGWMARKRFLRERDAAIVIQCAF 895          

HSP 2 Score: 70.8626 bits (172), Expect = 3.008e-11
Identity = 55/184 (29.89%), Postives = 94/184 (51.09%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCR--IKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHF--LCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTR-GYFTHRKYVKQKKAVINIQKNFRRFSE 5382
            K + A+I IQK+VR + Q   YR  R A++ +Q++ RG+L R   ++ R+  AAI+ Q+ +R     R      +A  IIQ+F R   +R ++  +  ++    IQ Y + ++ RK++L  R   I IQC  RR  +R     LK+     + + R       K V+ ++ + +  K F+  SE
Sbjct:  764 KFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEARSAEHLKRLNVGMENKVVQLQRKIDDQNKEFKTLSE 947          

HSP 3 Score: 65.4698 bits (158), Expect = 1.147e-9
Identity = 46/158 (29.11%), Postives = 81/158 (51.27%), Query Frame = 1
Query: 3751 KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARK--KYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQ 4218
            +  I++Q  +R  + + +Y++  AATL++ +F +GY AR+  ++L    + IV Q  +R    R+ +  +  + ++IQ + R    R+ Y                   R+ L  H   AT+IQ + R +  RK F+ +R+AAIVIQ  FR+   RQ+
Sbjct:  767 EATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNY-------------------RQVLMEH--KATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQE 903          

HSP 4 Score: 64.6994 bits (156), Expect = 1.981e-9
Identity = 47/146 (32.19%), Postives = 76/146 (52.05%), Query Frame = 1
Query: 3961 SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ--MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
            + I+IQK +RG+++R  Y     A   +Q+  RG+L R+          L +H  R+            AAIV QKQ+R    R+ Y    +  + IQS  R     + Y+Q  M+  AT IQK A+G++ RK+++ +R +A++IQ
Sbjct:  768 ATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARR----------LAEHLRRT-----------RAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQ 892          

HSP 5 Score: 62.003 bits (149), Expect = 1.347e-8
Identity = 45/149 (30.20%), Postives = 80/149 (53.69%), Query Frame = 1
Query: 5440 CYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVR--LKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRS 5874
             Y+ +    K R+  + IQ  +R ++   K++ +++ATL +Q+  RG   R   ++ +  +  +  QK  R    R  +  + ++ + IQSF R  +  +NY+  LM+   T+IQK  R ++ARKRFL  +   I+IQ  FRR  A++ 
Sbjct:  755 AYLEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQE 903          

HSP 6 Score: 61.2326 bits (147), Expect = 2.346e-8
Identity = 53/168 (31.55%), Postives = 86/168 (51.19%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKI--FLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY--CLLKSYTLLIQQ-------RWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKI 6399
            L KL+  K R ATI+IQK+V+G+  R  Y+ L+ + + LQRF RG+L R++   L+   A+I+  K  R +  R  +               R+   A++ IQ++ R    +R Y   L++    +IQ+       R RF+  + +A+VIQ  +R  + R  L A KI
Sbjct:  757 LEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAY---------------RRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKI 909          

HSP 7 Score: 60.4622 bits (145), Expect = 4.371e-8
Identity = 40/132 (30.30%), Postives = 75/132 (56.82%), Query Frame = 1
Query: 4645 KNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSS--SIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT--RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK 5028
            + A I +QK++RG+L R  +   R   + +Q   +G++AR+  + LR +  +I+ QK +R   A + + ++  A++ IQ   R     + YR     + + +IQKY RG++ R ++ R+  AAI++Q  FR+
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRR 897          

HSP 8 Score: 57.3806 bits (137), Expect = 3.428e-7
Identity = 53/164 (32.32%), Postives = 84/164 (51.22%), Query Frame = 1
Query: 2989 KSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK--KFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLK 3474
            + ATI+IQ  VR  +QR K++ LR A + +Q+  R Y  R+  + L +  +AIV QK  R +  ++ Y ++ ++ ++IQ  T+   V+                 R Y   +Q L   K+T IIQK+ R   ARK+FL  R   IV+Q   +  + RQ+   LK
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVR-----------------RNY---RQVLMEHKAT-IIQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALK 908          

HSP 9 Score: 55.8398 bits (133), Expect = 8.790e-7
Identity = 48/159 (30.19%), Postives = 81/159 (50.94%), Query Frame = 1
Query: 2686 LFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQ 3150
            L K + +K   + I+IQK +RG++ R  + + ++A   L+ +  GYL R+  + L+   + I+ QK  RML  R ++               R   +        AT++IQ+  RA+  RR ++   + + A IIQK  R +  RK+FL +  +AIVIQ
Sbjct:  757 LEKLRADKFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAY---------------RRVCR--------ATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQ 892          

HSP 10 Score: 55.4546 bits (132), Expect = 1.327e-6
Identity = 51/173 (29.48%), Postives = 98/173 (56.65%), Query Frame = 1
Query: 4231 RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRK--KYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLA--ATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQ 4737
            R+  I IQ  +R ++   KY++++ A   +Q+  +GY+ R+  +++ + R+A++ QK  R   +R++++    + +IIQ + R   +R  Y++ L+   AT+IQK ARG++ RKR + E+ A  +IQ  +R    R     Q+  A+K++     +L R N     NK++ +Q
Sbjct:  766 REATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFRRLKAR-----QELKALKIEARSAEHLKRLNVG-MENKVVQLQ 932          

HSP 11 Score: 55.0694 bits (131), Expect = 1.505e-6
Identity = 45/169 (26.63%), Postives = 86/169 (50.89%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS--CKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSA 3966
            K +   I IQK++R  LQR +Y + + A + +QR  R    +   + +   +AA V QK ++    ++ +R++  +  +IQ + R +  R+ +++     +L++ K               AT+ I K+ +G+ ARK++L  R + IVIQ +FR    R+   ++K  A
Sbjct:  764 KFREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQ-----VLMEHK---------------ATI-IQKYARGWMARKRFLRERDAAIVIQCAFRRLKARQELKALKIEA 911          

HSP 12 Score: 55.0694 bits (131), Expect = 1.751e-6
Identity = 36/132 (27.27%), Postives = 75/132 (56.82%), Query Frame = 1
Query: 3400 FRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRR--RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRK--MKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIR 3783
            FR+ TI++QK ++    R K+ +L++  +++Q+  R  L RR   +++  +A I  Q+++R  K ++      +A  ++Q + ++   ++ +R+  M+   T+IQKY R  + RK+F +E    I++Q   R
Sbjct:  765 FREATIMIQKSVRGWLQRVKYRRLRAATLSLQRFCRGYLARRLAEHLRRTRAAIVFQKQYRMLKARRAYRRVCRATVIIQSFTRAMFVRRNYRQVLMEHKATIIQKYARGWMARKRFLRERDAAIVIQCAFR 896          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Match: Myo5c (myosin VC [Source:MGI Symbol;Acc:MGI:2442485])

HSP 1 Score: 76.2554 bits (186), Expect = 7.100e-13
Identity = 50/172 (29.07%), Postives = 91/172 (52.91%), Query Frame = 1
Query: 5209 IFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL--VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRM 5718
            IF +     Y+ + R  +L+   I+IQK  RG+   RK++++++A + IQ+ FR                 ++K      L++ +       + +Q Y R Y+  + +++I+ AT+ IQ H RG   R +Y+K+++    V +QK  RA + R RF NI++ ++NIQ  YR+
Sbjct:  738 IFFRAGQVAYLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFR-------------GQQTVRKAITATALKEAWA-----AIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQNIRRFVLNIQLTYRV 891          

HSP 2 Score: 71.633 bits (174), Expect = 1.530e-11
Identity = 54/179 (30.17%), Postives = 94/179 (52.51%), Query Frame = 1
Query: 2200 YLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFR-----RYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS 2721
            YL + R+ K+++  I+IQK+ R +L R ++ + + A + +Q +FR     R  +    LK   + +I+Q   RGYL R+ Y+ IR +T  IQ + +G+LAR+++ KL                     +Q   AVI+Q + R+ + RR + N+R+ V+ IQ        ++KLE + R 
Sbjct:  747 YLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKL---------------------LQEHKAVILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQNRE 904          

HSP 3 Score: 69.3218 bits (168), Expect = 7.073e-11
Identity = 52/171 (30.41%), Postives = 87/171 (50.88%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRL--KMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFR--RFSELKTFQNLKNASII 5421
            R   I+IQK+VRG+L R K+ R+  AA+ +QR+FR    +R+                   I A  L +  + + +Q Y + YL+R  Y  IR  TI IQ   R +++R R+ +L  +   +I+QK  R +   R++   ++ V+NIQ  +R  R  +    QN +N  ++
Sbjct:  757 RQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRK------------------AITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQNRENHGLV 909          

HSP 4 Score: 65.4698 bits (158), Expect = 1.277e-9
Identity = 52/149 (34.90%), Postives = 79/149 (53.02%), Query Frame = 1
Query: 3001 ILIQTKVRALIQRRKFQYLRNAAIIIQKTFRC-YSVRKKF----LIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKY--LLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQ 3426
            I+IQ  VR  +QRRKF   R AA+ IQ+ FR   +VRK      L + ++AI++QK  R  + +  Y  I+ + + IQ HT+GFL +                 R+Y  LLQ+         +I+QK+ RA  AR++F N R+F + +Q
Sbjct:  761 IMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLAR-----------------RRYRKLLQEH------KAVILQKYARAWLARRRFQNIRRFVLNIQ 886          

HSP 5 Score: 60.8474 bits (146), Expect = 3.147e-8
Identity = 42/130 (32.31%), Postives = 69/130 (53.08%), Query Frame = 1
Query: 2404 GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTI-----QIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS--CIIIQKYIRGFINRRNF 2772
             YL +    ++R+   +IQK+V+G+L R+KF++  +A + IQ  FRG    R         +  AA+I+Q + R  + R  Y  +R + I IQ      L +R+  K L+    +I+QKY R ++ RR F
Sbjct:  746 AYLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRF 875          

HSP 6 Score: 60.8474 bits (146), Expect = 3.200e-8
Identity = 45/130 (34.62%), Postives = 73/130 (56.15%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKF-----LKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLA---AIILQRHFRKYLIIRR 5046
             YL +    + R   I++Q  ++G++ R+ + + R +++ +Q+ FRG    +K      LK   A+I +QK  R Y    LY+  R A+I IQ + RGFL R +Y R+LL    A+ILQ++ R +L  RR
Sbjct:  746 AYLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRY-RKLLQEHKAVILQKYARAWLARRR 874          

HSP 7 Score: 59.3066 bits (142), Expect = 7.869e-8
Identity = 49/150 (32.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query: 4522 LIQKIARGYLVRKRIVVEQKAVRIIQNFYRAH-TIRSHFIC----QKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL--RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR-RYCQMKLYRDTRNASIVIQK 4947
            +IQK  RG+L R++ + E++A   IQ ++R   T+R         +  AAI LQK  RGYL+R  +   R   I +Q+  +GF+AR+ Y+KL     ++I+QK  R + A ++F  ++   + IQ   R +  Q KL    R    +++K
Sbjct:  762 MIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQNRENHGLVEK 911          

HSP 8 Score: 56.225 bits (134), Expect = 7.494e-7
Identity = 38/123 (30.89%), Postives = 71/123 (57.72%), Query Frame = 1
Query: 3466 KLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQ-----AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK---EMKLVILLQSKIRMIITKKRYQ 3810
            KL+   I IQK++R  LQRR++++ ++A + IQR FR  +  ++ I         AA ++QKY + Y+ +  ++ ++ +   IQ + R  + R++++K   E K VI LQ   R  + ++R+Q
Sbjct:  755 KLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVI-LQKYARAWLARRRFQ 876          

HSP 9 Score: 56.225 bits (134), Expect = 8.083e-7
Identity = 38/130 (29.23%), Postives = 69/130 (53.08%), Query Frame = 1
Query: 5788 FIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRG-----KLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKL--KNASIIISKHVRGVLVRNHFQ 6156
            ++ + R  +++ + I+IQK  R +L +R + R     + +Q   RG     K       K   A I++QK  +GY +R  Y++++ + I +Q   RGFL R+ + KL  ++ ++I+ K+ R  L R  FQ
Sbjct:  747 YLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQ 876          

HSP 10 Score: 55.8398 bits (133), Expect = 1.058e-6
Identity = 48/154 (31.17%), Postives = 87/154 (56.49%), Query Frame = 1
Query: 2686 LFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMG--YLRR---KQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEF--VAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQ 3126
            L K +L+K  + CI+IQK++RG++ RR FL+ + A   ++ YF G   +R+      LK   + I+LQK  R   +RN + + + + I IQ   + + A++ +  + ++   +++Q   RA + RR+FQ +R   + IQ T+R   ++KK   Q
Sbjct:  748 LEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQ 901          

HSP 11 Score: 55.8398 bits (133), Expect = 1.103e-6
Identity = 54/179 (30.17%), Postives = 87/179 (48.60%), Query Frame = 1
Query: 3835 ISKFVKGYFARKKYLSYRHSVIVIQNSFRCF-MYRKMFLSIK----FSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLV----RKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSL----IRQFIAIQKYK-QMKKAATY 4317
            I K V+G+  R+K+L  R + + IQ  FR     RK   +      ++AI++QKY RG++ R +Y     A   IQ + RGFL     RK L  H   A ++Q + R++  R+ F   R   + IQ  +R    +  +  Q  E    V  + SL    +     +QK + +++KAAT+
Sbjct:  763 IQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEH--KAVILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQNRENHGLVEKLTSLAALRVGDLEKVQKLEAELEKAATH 939          

HSP 12 Score: 53.5286 bits (127), Expect = 5.316e-6
Identity = 49/160 (30.63%), Postives = 84/160 (52.50%), Query Frame = 1
Query: 5029 YLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAY-----LIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKY---VKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKK-RKN 5481
            YL   R+D  ++   +IQ   RG+  R  FL ++ + +TIQ YF+        I    L+     I +Q   R Y+ RN +  ++++ I IQ  TRG+   R+Y   +++ KAVI +QK  R +   + FQN++   + IQ  +R   L+K+ + + R+N
Sbjct:  747 YLEKLRLDKLRQDCIMIQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVRKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRKLLQEHKAVI-LQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQNREN 905          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Match: sp|Q8CJ27|ASPM_MOUSE (Abnormal spindle-like microcephaly-associated protein homolog OS=Mus musculus OX=10090 GN=Aspm PE=1 SV=2)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 651/2423 (26.87%), Postives = 1090/2423 (44.99%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFENPIXXXXXXXXXXXXV----------------------------WVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTSA------------------------NLFDKEI-------LLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMK---------KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCII-IQKYIR----GFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIK------QSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQK---NIRALL-QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFK---------------------------SYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKK----YLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRK---------------------------IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYI----RQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIR----GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDT---RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFR------KYLIIRRIDL------------EQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYI----SRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCY---------ILRKE-------------------FKKKRKNCVKI-----QSYIRR----YICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVR------------------TRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLS---IIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRK------------IFLKLKNASIIISKHVRGVLVRNHFQKNKQHMK--IFAQENLRKRLEASIKIQAYFR----------CYIQKRRYCLLKSYTLLIQQRWRFIVLKRS------AVVIQRIWRGRQLRCHLNAKKIGH-EISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRNINSKR-GTKGITIFCHTCLLLVLLIKMEQ 6867
            D+ W ++QE  F  WLN I        KT V  +N                   P   E                  A  L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL     + ++  F   + L  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L ++  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +  S   L VSH+QT +DE+DF V+NL+ D+  GVRL R  ++L  N ++  KLR PA+   +K  N++L ++  K  G  +    G  I    +   HREKTL LLW +     +D  ++ D+L  EI   ++  S+    S                                  WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   T+ + A                           D E        LLENEK+NF +  S  + +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   ++QS+V  FL  ++ +      ++ Q   +R  A+ ++  +K         KSA+LIQ  +RRY  R R+ ++K  +V+LQS  R  +   +Y +   + + IQ + R YL R      +++++ S+ +IQ   + +  R+K    TKA V +Q AFR +  R+   I+ ++AV+IQS+YR     + Y+ +R  VI+IQ+ V +    +KL KR +  I+ +QK+ R    G +   ++L+ ++A   L+  F G   R  +     +  +LQ   RM   R  FL  +K  I +Q   ++Y   +++   K A I IQT  RA I  R+    +Q  R++ I++Q   R    RK F     S I IQ   R+ IC+K +   K      QS++ +++  K +L  ++    I R    Q L  +   +K+Y++VR+S I +Q HFR    RKQ     K  I +Q Y +M   RQ++LK+    + IQ      RA + QR+ +++ K+A I +Q  +R CK ++QI   + AA  +Q+ F+                           +Y  + QF K +E+V  +Q   R    R+Q +++ +  + +QS  RM + +++Y+   AA   I + V+   A K+    Y+  RH+ +V Q +++  M R+        A +IQ Y R  I+R+                           +Y     A+  +Q   RG  VRK +   H++A  IQ  +R+Y+ +K +   R +AIVIQ+ +R   I     Q+Y   R+  + +Q+  R     ++ + M  AAT I+ + K    R +Y+  R +A+IIQ   R Y                  Y+ + +    Y R L A   +Q   RG  VR+ +     A  +IQ+ +R H  +++F   + AA  +Q+  R    G    + ++  R  ++L+Q+  +G   R+  + +  ++ ++Q+ FR F   +KFL L+  +I IQ+  R     K  R       A I IQ   RG++ R + Q+   AA ++Q  FR      +Y  ++R  +            ++ AA I+Q   RG   R+H     +S   IQ+ F+A+++R++++ +R+  IF+Q   R  +      ++FL+L+ + I IQ   R     +K  +  +A   IQ  FR       F   K ASI IQ+ +R Y         ++R+E                   F ++R+   K+     ++  RR    Y+C       K  T ++Q H +G+    + ++     +  QK+ RA   R                   ++L+  ++   IQ++YR    +K Y  + +++ +I+      +AR+RFL++++  IIIQ+ +R  L+ R  + NL        +Q+  RG  A+  + + R+A ++IQ+ V+     K  +I    L+KS + +Q  +RG+L+RK             F       +   K  R   +    +  K+HM   IF Q   RKRL+    I+ Y +          C++Q+ R     + +++ +   RF++ +R       A  IQ +WRG   R     KK  H EI  IR      +    + N +    ++AL  L    LT   ++ +L  L  LE VT LS   C+ + ES A   +  ++  CNR V  +EVV   + V  N+ K     A V   +      ++L++  +YR     R   K  +IF  TC LL +L+K EQ
Sbjct:  660 DERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVSLRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIGQRQKVLNWLLSYNPLWL----RIGLETVFGELIPLADNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPLLFRDGHEAALSKFTLKKLLLLICFLDHAKISRLIDHDPCLFCKDAEFKASKELLLAFSRDFLSGEGDLSRHLSFLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVRTVELLTQNWNLSDKLRIPAISRVQKMHNVDLVLQVLKSRGVPLTDEHGSAISSKDVVDRHREKTLGLLWKIALAFQVDISLNLDQLKEEIDFLKHTHSIKRAMSALTCPSQAITNKQRDKRISGNFERYGDSVQLLMDWVNAVCAFYNKKVENFTVSFSDGRILCYLIHHYHPCYVPFDAICQRTSQSVACAQTGSVVLNSSSESEGGCLDLSLEALDHESTPEMYKELLENEKKNFHLVRSAARDLGGIPAMIHHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKRDLK-HHQERDKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAVLIQAYWRRYSTRKRFLRLKHYSVILQSRIRMKIALTSYKRYLWATVTIQRHWRAYLSRKRDQQIFRKLKSSSLVIQFMFRRW-KRRKLQLQTKAAVTLQRAFREWHLRKQ--IRERSAVVIQSWYRMHRELQKYIYIRSCVIVIQRRV-RCFQAQKLYKRRKDAILTLQKHYRARQKGKLAHADYLQKRAATIRLQAAFRGMKARHSYRLQIGAACVLQSYWRMRQERVRFLNLKKMVIKLQAHIRKYQQLQKYKKIKKAAITIQTHFRASISARRVLASYQKTRSSVIVLQSACRGMQARKAFRHALASVIKIQSYYRAYICRKTFQNFKNATIKLQSIVKMKQSRKQYLQIRAAALFIQRWYRSQKLASQK--RKEYIQVRESCIKLQSHFRGCLVRKQLRLQCKAAISLQSYFRMRTARQRYLKMCKAALVIQSFYCAYRAQISQRKNFLQVKRAAICLQAAYRGCKVRRQIKQQSTAAVTIQRVFRGHSQRMKYQTMLQSAVKIQRWYRAQKVAYDMRIQFLKTREAVVCLQSAYRGWQVRQQLRRQHEAAVKIQSTFRMAVAQQQYKLLRAAAAVIQQHVRARAAGKRQHLAYIQLRHAALVFQAAWKGKMLRRQIARQHQCAALIQSYYRMHIQRRKWSIMKTAALQIQLCYRAYKVGKEQRHLYLKTKAAVVTLQSAYRGMKVRKRVAECHKAAVTIQSKFRAYRTQKKYTTYRTSAIVIQRWYRNIKITTQQHQEYLNLRRAAVQVQAAYRGIRVRRRIQHMHMAATLIEAMFKMRQSRVRYLKMRTAALIIQVRYRAY------------------YLGK-IQHEKYLRTLKAIKTLQAGVRGARVRRTVRKMHFAATLIQSHFRGHRQQTYFHRLRKAATMVQQRYRAVKEGSAEFQRYSRLRRSVLLIQAAFRGLRTRRHLKAMHLAATLIQRRFRTFAMRRKFLSLRKTAIWIQRQYRARLYAKYSRQQLLLEKAVIKIQSSYRGWVVRKRVQKMHRAATVIQATFRMHGAYMRYQHLKRASVVIQVHTAAELQRQKHAAVILQAAVRGMKTRSHLKTMHSSATLIQSQFRAFIVRRRFIALRKAAIFVQRKFRATLYAKHKLHQFLQLRKAAITIQSSYRRLMVQKKLQEMHRAAALIQATFRMHRTYVAFHIWKCASIRIQQCYRTYRTIKLQKEKLIREEQHSAAVLIQSTYRMYRQRCFYQQRRWAAKVIQKTYRANKRRQDLLYVC-------KEETPLLQMHFQGLNTAKQGRQQHGAAMITQKHFRAFKARRLMEAERGFQAGCRKYKAKKYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQLARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSAVLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAAYCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAHACWLQQDR-----AASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWR-----KKNDHTEIKAIRRSLRAVSTTVEEENKLYRRTERALHHL----LTYKHLSAILDALKHLEVVTRLSPLCCENMAESGAVSTIFVVIRSCNRSVPCMEVVGYAVQVLLNVAKYDKTIAAVYEAENCVDTLLELLQ--VYREKPGDRVAEKSASIFTRTCCLLAVLLKTEQ 3029          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Match: sp|P62291|ASPM_MACFA (Abnormal spindle-like microcephaly-associated protein homolog OS=Macaca fascicularis OX=9541 GN=ASPM PE=2 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 1.074e-164
Identity = 599/2180 (27.48%), Postives = 1017/2180 (46.65%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFN------VSIDPDFNVSLLSNNEACFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHY---KEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK----VVHKVLFKRKLEKRLRSCIIIQK----YIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVR--KYLLQK--QYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA----LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSY---------------------------ICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFA----RKKYLSYRHSV-----------------------IVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRK---IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQY----LXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRS----HFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF---NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHF---RKYLIIRRIDLEQ-KAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISR----NRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY----ICISKFKMIKSATLIIQKHIRGIFVRLKYK---------KIIKLVVFIQKNIRANIVRTRFL---NIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFL----IRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVL-----------KRSAVVIQRIWR 6360
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +         +S++ + +V+ L+        FI  ++LWN DIA ++R   +    +     +L++  L++ L ++  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF ++NL+ D+  GVRL R  ++L  N ++  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NFQ+  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     KT    H    K   I+QS V  FL  ++ +      +I Q   +R LA+ ++             K+A LIQ  +RRY  R R+ K+K  +++LQS  R  +   +Y +   + + IQ + R YL R      Y+ ++ S+ IIQ   + +  R+K     KA V++Q AFR +  R+    +  +A++IQS+YR     R Y+ +R  VI+IQK       + L+KRK E    S + IQK    Y++G I R N+L+ ++A   L+  F   L+     +   +  ++Q   RM   R  FL  +K+ I +Q   +++   +++   K A ++IQT  RA I  RK    +Q  R+A I++Q  +R    RK ++    S I IQ   R+ + +K +L +K + + +Q   K    +K Y  +    +  Q   R  K   QK  +Y+++R+S I +Q   R    RKQ    RK  I +Q Y +M + RQ +LK+   +I IQ    A    + QR+ +++ KKA   +Q  +R  K ++ I   + AA  +Q  F+ Y                             + +F K K +V  +Q   R    RKQ ++E +  + +QS  RM   +K+++    A L I +  + + A    R +Y+  RH+V                       I+IQ+ +R  + +K +  +K +A++IQKY + + I R+   +Y     A+  +Q   RG  VRK +   +++A  IQ  YR+YK +K +   R +AI+IQ+ +R     H   Q+Y   +K  I IQS+ R     +  + M +AAT+I+ + K +  R  Y T R++A++IQ   R Y    + R+ +     ++ I+Q   R   +R   ++  +AATLIQ   R Y  +      +K  + IQ  YRA   R+     +   +++ I +Q   RG   R++         L+Q   +  + R+ +  L+ +++ +Q+ +R       H +FL+++NA I IQ + RR+   K  R+   A+  IQ   R     ++YQ    A++++Q+ +   R   + R+  L Q ++A I+Q  +RG   R H     +S   IQ+ F++ L+R++++ +++ TIF+Q   R  I      ++FL+L+ + I IQ   R     +K  + ++A + IQ  FR      TFQ  K ASI+IQ+++R Y         R   ++ ++YIR++    +  + +K +K+   + +KH   I ++  Y+         K+      IQ+  RAN  + + L    +KK      SF  M+ + K  Q   Q+  +IQK+C+ F  RK +L +++ ++ IQ+ +R+  A R+       +I +QS  RG   +   Q M  A  LIQ   + +  +  Y+  + +++ +Q + R ++     RK FL ++ +   I    RG+ VR       Q +KI ++E +     A+I  Q+   CY  K +Y  ++S  ++IQ+ ++   L            R+AV IQ  +R
Sbjct:  692 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGVENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETIYGELISLEDNSDVTGLA-------MFILNRLLWNPDIAAEYRHPTVPHLYRDGHEGALSKFTLKKLLLLICFLDYAKISXLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAITNLAVDLQCGVRLVRTMELLTQNWNLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDALINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPXDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFQLIRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYK----LKTDLKRHQERDKAARIIQSAVINFLAKQRLRKRVNAALIIQKYWRRVLAQRKLLILKKEKLEKVQNKAASLIQGYWRRYSTRKRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSSLIIQSMFRKW-KRRKMQSQVKATVILQRAFREWHLRKR-AKEENSAIVIQSWYRMHKELRKYIYIRSCVIVIQKRFRCFQAQKLYKRKKE----SILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRR-LKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKLQAHIRKHQQVQKYKKMKKAAVIIQTHFRAYIFTRKVLASYQKTRSAVIVLQSAYRGMQARKVYIHILTSVIKIQSYYRAYVSKKEFLSLKNTTIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKITTQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMCKAIIVIQNYYHAYKAQVNQRKNFLRVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTRFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQRMEYIELRHAVLILQSMWKGKTLRRQLQRQXKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGREQHHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHXXHQEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKMHREKYLTILKAVKILQASFRGVXVRWTLRKMQIAATLIQSNYRRYKQQTYFNKLKKITKTIQQRYRAVKERNIQFKRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKKMREMHRAATFIQATFRMHRVHMRYQALKQASVVIQQQYXANRAAKLQRQHYLRQRRSAVILQAAFRGVKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLQLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTCVTFQTWKQASILIQQHYRTY---------RAAKLQKENYIRQWHSAVVIQTAYKGMKARQHLREKHKAAIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKALQHNELKKETCVQASFQDMNIQ-KQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYRLYVRVKTERKSFLPVQKSVRTIQAAFRGMKVR-------QKLKIVSEEKM-----AAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASDLACSQEAECHSQSRAAVTIQNAFR 2826          

HSP 2 Score: 370.933 bits (951), Expect = 1.664e-101
Identity = 461/1893 (24.35%), Postives = 848/1893 (44.80%), Query Frame = 1
Query: 2101 VIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRR---------------------------YLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLC----RSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS----SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYF----MGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS------CKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI----ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS----QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQF---------RKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGY----LIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR----------------RYCQMKLYRDT---------RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR----------------RIDLE--QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRRYISRNRF---LRLKMSVIIIQKVTRGYFTHRKYV---------------------------KQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL-----VVFIQKNIRANIVRTRFLNIKKSIINIQS----------------------FYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSII------IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY---------------CLLKS--YTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSV-SKYRQQLSSRCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNSLQENNLS 7125
            VI +QS  R ++  K+F S+K   I  QS+VK    R +   ++ +A+ IQ+ YR                            YL R +    + A + LQS+FR    ++ YLK+ ++I++IQN    Y      R N+ R++K+   +Q   +GY  R+   + + A + IQSAFRGY KR  Y   +++ + IQ +YR+       R  +L  + +V+ +Q        ++++ +  ++ + IQ   R    ++ F  FK+A  +++  F     G  +R +++++R++V++LQ   +  +LR                       ++   +    I+IQ+  R  +Q++K++ ++ AA++IQK ++ YS+ ++   Q++                 YLK K +V+ +Q   +G  V+K  K      +  QS  R Y  +K+Y   R S IIIQ+ +R I       +++LN +K  I +Q   +  + R+    +      I+   +    R  Y   +KA I IQ +FR+       +EK   IL  +A  ++Q  F+    +   RKM+ + T+IQ   RR   +  F K  K+   +Q + R +    I  KRY K   + + I    +G  AR+       +  +IQ  FR  M R+ FLS+K +A+ IQ+  R  +  K +      Q   IK IQ + R +++RK +   H++AT IQ  +R +++   +   + A++VIQ+Q+         R+HY+RQ     R+  + +Q+  R     +  K M  +AT IQ   +  ++R+++++ +++ + +Q+  R  +  K               + +FL      RK  AA  IQ   R  +V+K++   Q+A  +IQ  +R H     F   K A+I +Q++ R Y    L ++N+    +  +++Q+  KG  AR+  ++   ++II+Q  +R +  +  + KL+ A+  IQ+  R                  C    ++D            A+I+IQK+ + F  R  Y       + +QR +RK   +R                R D++   +AA +IQ+FYR +  +  +  +K + V IQNY++ Y+     RK +L +++    IQ   R    R +       KM+ I+ Q     Y +  +Y                             Q +A + IQ  FRR    K  +  K A++ IQ   +  + R+ F ++++  + +Q Y R +    +F + + A +++Q H R  F+  K+++ + L     V+ IQ   +  I + +F  IK S I IQ+                      +YR    +K Y  + +++ +IQ      + R  FL ++++ IIIQ+ +R  L+ +    +  +I        +Q+  RG   +  + + ++A ++IQK ++     K  +I     +KS + LQ  +RG+L+RK  L+ K    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++++               CL +      +IQ+  R  VL++      S ++ IQ +WRG   R   +  KI      IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR V  +EV+   + V  N+ K     + V + +      ++L++  +YR    +K   KG +IF  TC LL +L+K      +N    +   S + D + S Y+  L++    +     N+++IL + + N S  +   F P +  +  + ++L     L+ +N+ 
Sbjct: 1659 VIKIQSYYRAYVSKKEFLSLKNTTIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKITTQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMCKAIIVIQNYYHAYKAQVNQRKNFLRVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTRFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQRMEYIELRHAVLILQSMWKGKTLR-----------------------RQLQRQXKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGRE---QHHL----------------YLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHXXHQEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKMHREKYLTIL--KAVKILQASFRGVXVRWTLRKMQIAATLIQSNYRRYKQQTYFNKLKKITKTIQQRYRAVKERNIQFKRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIK-IQSSYRRWMIRKKMREMHRAATFIQATFRMHRVHMRYQALKQASVVIQQQYXANRAAKLQRQHYLRQ-----RRSAVILQAAFRGVKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHK-------------LHQFLQL----RK--AAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTCVTFQTWKQASILIQQHYRTYRAAKLQKENYIRQWHSAVVIQTAYKGMKARQHLREKHKAAIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKALQHNELKKETCVQASFQDMNIQKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYRLYVRVKTERKSFLPVQKSVRTIQAAFRGMKVRQKLKIVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASDLACSQEAECHSQSRAAVTIQNAFRRMVTRK-LETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRA-FLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTWFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHYRGYKERQVFLRQKSAALIIQKYIRAREAGKRERIKYIEFKKSTVILQALVRGWLVRKRILEQKTKIRLLHFTAAAYYHLNALRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQQKKFIQKYSIKKIEHEGQECLSQQNRAASVIQKAVRHFVLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKI----KAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSVPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDTLLELLQ--IYREKPGNKVADKGGSIFTKTCCLLAVLLK-----TTNRASDVRSRSKVVDRIYSLYK--LTAHKHKM-----NTERILHKQKKNSSISIP--FIPXTPVRTRIVSRLKPDWVLRRDNME 3456          

HSP 3 Score: 357.451 bits (916), Expect = 2.215e-97
Identity = 398/1566 (25.42%), Postives = 753/1566 (48.08%), Query Frame = 1
Query: 2029 IQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYL----VQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS----SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYL----RRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRAL----IQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEM----KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIR----QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXX---XXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTI----RSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF--NAHK--KFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAY--------------LIRKKYLEIRQKTIFIQ--------CLVRRYISRN---RFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKK-----------SIINIQSF--YRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSN---IIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRK--------RLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQ-------QRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHE 6408
            IQ+ ++ Y    + +T+++      I +Q+  RR       + I+   +I QS  +    R R   +KK+ I +Q + R++    +Y+K+K A V++Q+HFR Y+    V  +Y K   +++++Q+  RG   R  Y  I  S   IQ Y + Y+++K+F+ L    + +QS  +    R+ Y     AA+ IQ  YRS    +  R  Y+ +R+S I +Q  V   L ++++  + ++ I +Q Y R    R+ +LK   A+ ++++Y+  Y     +RK FL+++ +   LQ   R   +R     +  +A+ IQ +F+ Y  + ++ +   + I IQ   RA       R +F   + A + +Q  +R + VRK+   ++ +A+ IQ   R    QK +   K + LVIQ++ + +                 +  RK  +  +Y+++R + +I+Q  ++  + R+Q     K  I++Q Y +MH  ++K+  +K   + IQK  +A      Q   Y+K K AV+ +Q  +R  K +K+I   N+AA  +Q  +++Y  KK++   + S  +IQ++ R +       +E     K  I +QS  R I  ++  Q    A   I    K + +R  Y + R + IVIQ  FR                    Y +G + R+ Y +   A+K++Q + RG  VR TL     +ATLIQ  YR YK +  F   +     IQ+++R    R    ++YN+ R  VI+IQ++ R   A +  K M  AAT IQ+  +  ++R+++++ +++AV IQ+  R +L  K           +   Q   RR+++R   +    AAT IQ   R + V  R    ++A  +IQ  Y A+      R H++ Q+ +A+ LQ   RG   R++     +   L+QS  +  + R+ +  L+ ++I VQ+ +R      HK  +FL+L+ A+I IQ + RR    K  ++ + A+++IQ   R     + +Q    A+I++Q+H+R Y   R   L+++       +A +IQ  Y+G   R H   +  + + IQ+ ++ Y              +I++KY   ++K   +Q        C+   +   N   +      + IIIQK  + +   + Y+  +  V++IQ+ +R+ + ++T      A I IQ  +R + +R++ +   +    IQS+ R +     ++  K+A ++IQ + R ++VR+K ++  K  + +QK++R      R + +++           +I+N  +   YR   +Y+  Q   + + + +      +A  +  E  S     + IQ  FRR +  R  +      + +Q  ++  + + ++ + + A I +Q   + +  RK + + +K+ + LQ   R FL     R+++L+++++ III    +G + +  FQ+ K +  I  Q   R+        +++A+ KIQA++RC+   + Y  +     +IQ       +R  F+ ++ SA++IQR WR       + + KI HE
Sbjct: 1517 IQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQIRAACVI-QSYWRMRQDRVRFLNLKKTIIKLQAHIRKHQQVQKYKKMKKAAVIIQTHFRAYIFTRKVLASYQKTRSAVIVLQSAYRGMQARKVYIHILTSVIKIQSYYRAYVSKKEFLSLKNTTIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKITTQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMCKAIIVIQNYYHAYKAQVNQRKNFLRVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTRFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAW-----------------TAGRKQRM--EYIELRHAVLILQSMWKGKTLRRQLQRQXKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGREQHHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHXXHQEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRFRA-------------------YYQGKMHREKYLTILKAVKILQASFRGVXVRWTLRKMQIAATLIQSNYRRYKQQTYFNKLKKITKTIQQRYRAVKERNIQFKRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKKMREMHRAATFIQATFRMHRVHMRYQALKQASVVIQQQYXANRAAKLQRQHYLRQRRSAVILQAAFRGVKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLQLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTCVTFQTWKQASILIQQHYRTY---RAAKLQKENYIRQWHSAVVIQTAYKGMKARQHLREKHKAAIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKALQHNELKKETCVQASFQDMNIQKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYR-LYVRVKTER--KSFLPVQKSVRTIQAAFRGMKVRQKLKIVSEEKMAAIVNQSALCCYRSKTQYEAVQ--SEGVMIQEWYKASDLACSQEAECHSQSRAAVTIQNAFRRMVT-RKLETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIK-NSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTWFLNVRASAIIIQRKWRA------ILSAKIAHE 3022          

HSP 4 Score: 305.449 bits (781), Expect = 1.677e-81
Identity = 364/1403 (25.94%), Postives = 648/1403 (46.19%), Query Frame = 1
Query: 2029 IQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLC----RIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGY-LARKK---FVKLTKAIVVIQSAFRG-----------------------YAKRRNYTIQIKAAVIIQSFYR----SSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSC-----------------------IIIQ----KYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKE-------FVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKN---YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISA----RKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS--CKEKK--QIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI----ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFR-----CFMYRKMFLSIKF--------------------------------------------SAIVIQKYLRGFIKRKIY------------------CSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYI-----RQQYNETRKKVIFIQSLIRQFIAIQKYK---QMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKN----FTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK----------YLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRK----KYLEIRQKTIFIQCLVRRYISRNRFLRLK---------------MSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTF-------------------QNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYIC-----ISKFKMIKSATLIIQKHIR 5577
            IQR +R Y+T +  +T F+     V+ +QS  R +   K+ +      +  QS  +   A+ +    K +A++IQ+N+R +      R+ Y +++ A ++LQS ++   +++   +  +  +IIQ+  R ++ +  +K ++K+  +IQKY K Y + R++   ++K   A+V +QSA+RG                       Y  ++ Y     +A+IIQ +YR    +    + YLNL+K+ I IQ V   +  +R ++   R+                        I+IQ     Y +G ++R  +L    AV IL+  F G   R    KM+ +  L+Q N R    +  F    K   I +   +RY A KE       +   + + I IQ   R    RR  + +  AA +IQ+ FR   +R++FL    +A+ IQ+  R+ +C K+   +L+++ +V+ IQ   + ++++K  +++       Q+  R + +  +Y  +++++++IQ+ + A  A    R+ +L  R+  +++Q   +  + R+    + S    IQ   R+LL RRR+I  KKA IF+QRK+R+  C + K  Q +   +AA  +Q  ++  + KK+ ++M+ +  +IQ   R       FQ   +  IL+Q   R      + K+ Y ++  + + I    KG  AR+       + I+IQ+++R     CF Y+K+  + K                                             +AI+IQK+ + F  RK Y                    +T A+  IQ   RGF VR+ + + H++ATLIQ FYR ++ + ++  K+ A +VIQ  +R  Y+     R+ +   +K V  IQ+  R     QK K   + K AA   Q     Y  + +Y   +   V+IQ+  +      S + +  S       +    RR + R +  +K  AA  IQ   +  + R+R V +++A   +Q+++R    R  F+  + AA+ LQ + R +L  K+    + + R+ +I++Q+  KGFI ++ +Q++++S+I +Q ++R + A K   K+K A+  IQ   R +   K Y     A  +IQ      L R  +     +AII+QR +R           +L+I+R     +AA +IQ  YRGY  R  FL QK++ + IQ Y +A    K    KY+E ++ T+ +Q LVR ++ R R L  K               ++ + IQ+  + Y   +   KQ  +VI IQ+ FR   + K F                   QN   A+ +IQK  R ++LRK+ +K     +KIQ+  R Y        +K K I+ +  ++ + IR
Sbjct: 1854 IQRWYRAYKTLHDTRTRFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQRMEYIELRHAVLILQSMWKGKTLRRQLQRQXKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGREQHHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHXXHQEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKMHREKYLTILKAVKILQASFRGVXVRWTLRKMQIAATLIQSNYRRYKQQTYF---NKLKKITKTIQQRYRAVKERNIQFKRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKKMREMHRAATFIQATFRMHRVHMRYQALKQASVVIQQQYXANRAAKLQRQHYLRQRRSAVILQAAFRGVKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLQLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTCVTFQTWKQASILIQQHYRTYRAAKLQKENYIRQWHSAVVIQTAYKGMKARQHLREKHKAAIIIQSTYRMYRQYCF-YQKLQWATKIIQEKYRANKKKQKALQHNELKKETCVQASFQDMNIQKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYRL-YVRVKTERKSFLPVQKSVRTIQAAFRGMKVRQKLKIVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASDLACSQEAECHSQSRAAVTIQNAFRRMVTRKLETQK-CAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVK-AACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTWFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKR----HRAACLIQAHYRGYKERQVFLRQKSAALIIQKYIRAREAGKRERIKYIEFKKSTVILQALVRGWLVRKRILEQKTKIRLLHFTAAAYYHLNALRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQQKKFIQKYSIKKIEHEGQECLSQQN--RAASVIQKAVRHFVLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKIKAIRLSLQVVNREIR 3243          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Match: sp|P62289|ASPM_GORGO (Abnormal spindle-like microcephaly-associated protein homolog OS=Gorilla gorilla gorilla OX=9595 GN=ASPM PE=2 SV=1)

HSP 1 Score: 571.622 bits (1472), Expect = 8.829e-164
Identity = 598/2169 (27.57%), Postives = 1012/2169 (46.66%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK----VVHKVLFKRKLEKRLRSCIIIQK----YIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVR--KYLLQK--QYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA----LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSY---------------------------ICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFA----RKKYLSYRHSV-----------------------IVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRK---IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRK----HYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYV----RRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRS----HFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF---NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHF---RKYLIIRRIDLEQK-AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISR----NRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY----ICISKFKMIKSATLIIQKHIRGIFVRLKYK---------KIIKLVVFIQKNIRANIVRTRFL---NIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFL----IRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVL-----------KRSAVVIQR 6351
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +    +      +SL  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF V+NL+ D+  GVRL R  ++L  N D+  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   I+Q  V  FL  ++ +      ++ Q   +R LA+ ++             K+A LIQ  +RRY  R R+ K+K  +++LQS  R  +   +Y +   + + IQ + R YL R      Y+ ++ ST +IQ   + +  R K     KA V++Q AFR +  R+ +  +  +A+IIQS+YR     + Y+ +R  V+IIQK       + L+KRK E    S + IQK    Y++G I R N+L+ ++A   L+  F   L+     +   +  ++Q   RM   R  FL  +K+ I +Q   +++  ++++   K A ++IQT  RA I  RK    +Q  R+A I++Q  +R    RK ++    S I IQ   R+ + +K +L +K + + +Q   K    +K Y  +    +  Q   R  K   QK  +Y+++R+S I +Q   R    RKQ    RK  I +Q Y +M + RQ +LK+   +I IQ    A    + QR+ +++ KKA   +Q  +R  K ++ I   + AA  +Q  F+ Y                             +  F K K ++  +Q   R    RKQ ++E + V+ +QS  RM   +K+++    A L I +  K + A    R +Y+  RH+V                       ++IQ+ +R  + +K +  +K +A++IQKY R + I R+   +Y     A+  +Q   RG  VRK +   +++A  IQ  YR+YK +K +   R +AI+IQ+ +R     ++  ++Y   +K  I IQS+ R     +  + M +AAT+I+ + K +  R  Y T R++A++IQ   R Y   K+ + K  +I+   K +    R   +R   ++  +AATLIQ   R Y  +      +K  + +Q  YRA   R+     +   +++ I +Q   RG   R++         L+Q   +  + R+ +  L+ ++I++Q+ +R       H +FL+++NA I IQ + RR+   K  R+   A+  IQ   R     ++YQ    A++++Q+ +   R   + R+  L Q+ +A I+Q  +RG   R H     +S   IQ+ F++ L+R++++ +++ TIF+Q   R  I      ++FL L+ + I IQ   R     +K  + ++A I IQ  FR      TFQ  K+ASI+IQ+++R Y   +  K +R+N      YIR++    +  + +K +K+  L+ +KH   I ++  Y+         K+      IQ+  RAN  + +      +KK       F  M+ + K  Q   Q+  +IQK+C+ F  RK +L +++ ++ IQ+ +R+  A R+       +I +QS  RG   +   Q M  A  LIQ   + +  +  Y+  + +++ +Q + R ++     RK FL ++ +   I    RG+ VR       Q +K  ++E +     A+I  Q+   CY  K +Y  ++S  ++IQ+ ++   L            R+AV IQ+
Sbjct:  691 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGEL--ISLEDNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDVVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKTDLKRH-QEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRRRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLVIQSMFRKWKQR-KMQSQVKATVILQRAFREWHLRK-HAKEENSAIIIQSWYRMHKELQKYIYIRSCVVIIQKRFRCFQAQKLYKRKKE----SILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRR-LKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKLQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFARKVLASYQKTRSAVIVLQSAYRGMQARKMYVHILTSVIKIQSYYRAHVSKKEFLSLKNATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAALISLQSAYRGWKVRKQIRREHQAVLKIQSAFRMAKAQKQFRLFKTAALVIQQNFKAWTAGRKQRMEYIELRHAVLMLQSMWRGKTLRRQLQRQHKCAVIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAVFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKTQREKYLTILKAVKILQASFRGVRVRRTLRKMQIAATLIQSNYRRYRKQTYFNKLKKITKTVQQRYRAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQATFRMHRLHMRYQTLKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAILIQATFRMHRTYTTFQTWKHASILIQQHYRTY---RAAKLQREN------YIRQWHSAVVIQAAYKGMKARHLLREKHKASIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKAFQHNELKKETCVQAGFQDMNIK-KQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRKDIQNMHQAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMEVR-------QKLKNVSEEKV-----AAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQK 2822          

HSP 2 Score: 378.637 bits (971), Expect = 7.982e-104
Identity = 498/1949 (25.55%), Postives = 887/1949 (45.51%), Query Frame = 1
Query: 2014 RAASCIQRVWR----KYRTFYLYKT------HFIAHY---------KEVIIVQSIVRRFL----CLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIR----GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVV--HKV--LFKR-------------------KLEKRLRSCIIIQKYIRGF----INRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKK----EFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVR--SIICQKN--YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSC------KEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI----ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRH-SVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS----QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQF---------RKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGY----LIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR----------------RYCQMKLYRDT---------RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR----------------RIDLE--QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYL----------------EIRQK----------TIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYF----THRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL-----VVFIQKNIRANIVRTRFLNIKKSIINIQS----------------------FYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSII------IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY----------------CLLKS--YTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSV-SKYRQQLSSRCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNSLQENNLS 7125
            RAA  IQ  WR    + R   L KT      H   H          K  +I+Q+  R ++     L  ++  +  +I+ QS  +   AR     +  S I IQ  YR ++ +  +  +K+AT+ LQS  +    +K YL +  + L IQ   R        R  Y ++R+S   +Q +V+GYL RK+     KA++ +QS FR    R+ Y    KA ++IQ++Y +       R+ +L ++K+   +Q     +KV  L K+                   K +  L+S I IQ++ R +      R +FLK K+A+  L+  + G+  RKQ  +   +V+ +Q   RM   +  F + + +A++IQ++FK + A +    E++  + A +++Q+  R    RR+ Q     A+IIQ  +R +  +KK+ I   +A++IQK  R  SI  ++N  YLK K +V+ +Q   +G  V+K  K      +  QS  R Y  +K+Y   R S IIIQ+ +R I       K++LN +K  I +Q   +  + R+    +      I+   +    R  Y   +KA I IQ +FR+       +EK   IL  +A  ++Q  F+    ++  RKM+ + T+IQ   RR   +  F K  K+   +Q + R +    I  +RY K   + + I    +G  AR+ +L   H +  +IQ  FR  M R+ FLS+K +AI+IQ+  R  +  K +      Q   IK IQ + R +++RK +   H++AT IQ  +R +++   +   + A++VIQ+Q+         R+HY+RQ     R   + +Q+  R     +  K M  +AT IQ   +  ++R+++++ +++ + +Q+  R  +                   +  L + ++ RK  AA  IQ   R  +V+K++   Q+A  +IQ  +R H   + F   K+A+I +Q++ R Y    L R+N+    +  +++Q+  KG  AR   ++   +SII+Q  +R +  +  + KL+ A+  IQ+  R                  C    ++D            A+I+IQK+ + F  R  Y       + +QR +RK   +R                R D++   +AA +IQ+FYR +  +  +  +K + V IQNY++ Y+     RK +L                E+RQK           I  Q  +  Y S+ ++  ++   ++IQ+  +          +Y  Q +A + IQK F R +  K  +  K A++ IQ   +  + R+ F ++++  + +Q Y R +    +F + + A +++Q H R  F+  K+++ + L     V+ IQ   +  I + +F  IK S I IQ+                      +YR    +K Y  + +++ +IQ      + R RFL ++++ IIIQ+ +R  L+ +    +  +I        +Q+  RG   +  + + ++A ++IQK ++     K  +I     +KS + LQ  +RG+L+RK  L+ +    ++          N  +  + +    A ++  K++ + I IQ +FR  +Q++R+                CL +      +IQ+  R  +L++      S ++ IQ +WRG   R   +  KI      IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ +  S A   +  L+  CNR V  +EV+   + V  N+ K       V   E  I ++  LL  YR    +K   KG +IF  TC LL +L+K      +N    +   S + D + S Y+  L++    +     N+++IL + + N S  +   F P +  +  + ++L     L+ +N+ 
Sbjct: 1560 RAACVIQSYWRMRQDRVRFLNLKKTIIKLQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFARKVLASYQKTRSAVIVLQSAYRGMQARKMYVHILTSVIKIQSYYRAHVSKKEFLSLKNATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAALISLQSAYRGWKVRKQIRREHQAVLKIQSAFRMAKAQKQFRLFKTAALVIQQNFKAWTAGRKQRMEYIELRHAVLMLQSMWRGKTLRRQLQRQHKCAVIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAVFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKTQREKYLTIL--KAVKILQASFRGVRVRRTLRKMQIAATLIQSNYRRYRKQTYFNKLKKITKTVQQRYRAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARR-HLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIK-IQSSYRRWMIRKRMREMHRAATFIQATFRMHRLHMRYQTLKQASVVIQQQYQANRAAKLQRQHYLRQ-----RHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATIC-----------------AKHKLHQFLHLRK--AAITIQSSYRRLMVKKKLQEMQRAAILIQATFRMHRTYTTFQTWKHASILIQQHYRTYRAAKLQRENYIRQWHSAVVIQAAYKGMKARHLLREKHKASIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKAFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHQAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMEVRQKLKNVSEEKVAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFCRMATRK-LETQKYAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRA-FLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKRERIKYIEFKKSTVILQALVRGWLVRKRILEQRAKIRLLHFTAAAYYHLNALRIQRAYKLYLAMKHANKQVNSVICIQRWFRARLQEKRFIQKYHSVKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTKI----KAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAHSGAISKIFVLIRSCNRSVPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNKVADKGGSIFTKTCCLLAILLK-----TTNRASDVRSRSKVVDRIYSLYK--LTAHKHKM-----NTERILYKQKKNSSISIP--FIPETPVRTRIVSRLKPDWVLRRDNME 3456          

HSP 3 Score: 365.925 bits (938), Expect = 5.293e-100
Identity = 407/1565 (26.01%), Postives = 758/1565 (48.43%), Query Frame = 1
Query: 2029 IQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYL----VQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRS----SVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYL----RRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRAL----IQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEM----KLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIR----QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXX---XXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTI----RSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF--NAHK--KFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQK-------AARIIQNFYRGYTIRAHFLCQKN-SCVTIQNYFKAY--------------LIRKKYLEIRQKTIFIQ--------CLVRRYISRN---RFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKK-----IIKLVVFIQKNIRANIVRTRFLNIKK----SIINIQSF--YRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSN---IIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRK--------RLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQ-------QRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHE 6408
            IQ+ ++ Y    + +T+++      I +Q+  RR       + I+   +I QS  +    R R   +KK+ I +Q + R++  R +Y+K+K A V++Q+HFR Y+    V  +Y K   +++++Q+  RG   R  Y  I  S   IQ Y + ++++K+F+ L  A + +QS  +    R+ Y     AA+ IQ  YRS    +  R  Y+ +R+S I +Q  V   L ++++  + ++ I +Q Y R    R+ +LK   A+ ++++Y+  Y     +RK FL+++ +   LQ   R   +R     +  +A+ IQ +F+ Y  + ++ +   + I IQ   RA       R  F   + A I +Q  +R + VRK+   ++ + + IQ   R    QK +   K + LVIQ++ K +                 +  RK  +  +Y+++R + +++Q  +R  + R+Q     K  +++Q Y +MH  ++K+  +K   + IQK  RA      Q   Y+K K AV+ +Q  +R  K +K+I   N+AA  +Q  +++Y  KK++   + S  +IQ++ R +       KE     K  I +QS  R I  ++  Q    A   I    K + +R  Y + R + IVIQ  FR                    Y +G  +R+ Y +   A+K++Q + RG  VR+TL     +ATLIQ  YR Y+ +  F   +     +Q+++R    R    Q+YN+ R  VI+IQ++ R   A +  K M  AAT IQ+  +  ++R+++++ +++A++IQ+  R +L  K           +   Q   RR+++R   +    AAT IQ   R + +  R    ++A  +IQ  Y+A+      R H++ Q+++A+ LQ   RG   R++     +   L+QS  +  + R+ +  L+ ++I VQ+ +R      HK  +FL L+ A+I IQ + RR    K  ++ + A+I+IQ   R       +Q    A+I++Q+H+R Y   R   L+++       +A +IQ  Y+G   R H L +K+ + + IQ+ ++ Y              +I++KY   ++K    Q        C+   +   N   +      + IIIQK  + +   + Y+  +  V++IQ+ +R+ + ++T      A I IQ  +R + +RK+ +   +    IQS+ R +     ++  K+A ++IQ + R ++VR+K ++     + K V  IQ   R   VR +  N+ +    +I+N  +   YR   +Y+  Q   + + + +      +A  +  E  S     + IQK F R +A R  +      + +Q  ++  + + ++ + + A I +Q   + +  RK + + +K+ + LQ   R FL     R+++L+++++ III    +G + +  FQ+ K +  I  Q   R+        +++A+ KIQA++RC+   + Y  +     +IQ       +R RF+ ++ SA++IQR WR       + + KI HE
Sbjct: 1516 IQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQIRAACVI-QSYWRMRQDRVRFLNLKKTIIKLQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFARKVLASYQKTRSAVIVLQSAYRGMQARKMYVHILTSVIKIQSYYRAHVSKKEFLSLKNATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAALISLQSAYRGWKVRKQIRREHQAVLKIQSAFRMAKAQKQFRLFKTAALVIQQNFKAW-----------------TAGRKQRM--EYIELRHAVLMLQSMWRGKTLRRQLQRQHKCAVIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAVFKMHQSRISYHTMRKAAIVIQVRFRA-------------------YYQGKTQREKYLTILKAVKILQASFRGVRVRRTLRKMQIAATLIQSNYRRYRKQTYFNKLKKITKTVQQRYRAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQATFRMHRLHMRYQTLKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAILIQATFRMHRTYTTFQTWKHASILIQQHYRTY---RAAKLQRENYIRQWHSAVVIQAAYKGMKAR-HLLREKHKASIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKAFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRKDIQNMHQAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYR-LYVRVKTERKNFLAVQKSVRTIQAAFRGMEVRQKLKNVSEEKVAAIVNQSALCCYRSKTQYEAVQ--SEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFCR-MATRKLETQKYAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIK-NSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRA------ILSAKIAHE 3021          

HSP 4 Score: 213.001 bits (541), Expect = 1.946e-53
Identity = 243/991 (24.52%), Postives = 458/991 (46.22%), Query Frame = 1
Query: 1954 FIMATLAFFSSRL-IDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCR----IRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGY----LARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKL--EKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQK----NVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC---QSLVRKYLLQKQYLKVRKSTIIIQKHFR----AISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQ---VITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFR----KMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKK 4839
            FI AT  F   RL +   T  +A+  IQ+ ++  R   L + H++      +I+Q+  R     +  KS+     + QS  +  L R R   +KK+ I +Q+ YR  +C      ++  ++ A + +QS +RR +V+K   ++ R+ ++IQ   R +   + ++  + ++ +IQ++ + Y    L R+ +++   + VVIQ+A++G   R     + KA++IIQS YR       Y  L+ +  IIQ+       K+K      L+    +Q   +    ++   +   A  I++ +   +  RK +L +R +V+ +Q+  R L+                              +  A I IQ+  R    R+  Q +  AA +IQ  +R +  +  +  +  + +VIQ      VR    +KN+L +++SV  IQ   +G  V++  K +    +     QS +  Y  + QY  V+   ++IQ+ ++    A S   ++ +  +  + +QK      CR    KL++Q    + IQ  ++  + RRR+++ K+A I +Q  FR+ + +KQ +L  +AA V+Q ++++++  K  R    +++ SV +IQ   +  I +++FQ+     I +Q+  R    KK Y  K+ A   I  + + + A K+YL+   +V +IQ  F   + R  FL+++ SAI+IQ+  R  +  KI       IK                  H++A LIQ  YR YK R+ F+ +++AA++IQK     YIR +    R+++              KY + KK+   +Q + +G+++RK+ + QR    ++                             F   + Y    L A  IQ+  + YL  K    +  +V  IQ ++RA      FI + ++  K++   +  L ++N   +     ++Q  ++ F+ RK  +K  S  I +Q ++RG++  KK
Sbjct: 2339 FIQAT--FRMHRLHMRYQTLKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAILIQATFRMHRTYTTFQTWKHASILIQQHYRTYRAAKLQRENYIRQWHSAVVIQAAYKGMKARHLLREKHKASIIIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKAFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLT----------------------------AVRTQAVICIQSYYRGFKVRKDIQNMHQAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMEVRQKLKNVSEEKVAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAF----CRMATRKLETQKYAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRAFLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKK-YLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILSAKIAHEHFLMIK-----------------RHRAACLIQAHYRGYKGRQVFLRQKSAALIIQK-----YIRAREAGKRERI--------------KYIEFKKSTVILQALVRGWLVRKRILEQRAKIRLLH----------------------------FTAAAYYH---LNALRIQRAYKLYLAMKHANKQVNSVICIQRWFRARLQEKRFIQKYHSVKKIEHEGQECLSQRNRAAS-----VIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKK 3222          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Match: sp|P62287|ASPM_COLGU (Abnormal spindle-like microcephaly-associated protein homolog OS=Colobus guereza OX=33548 GN=ASPM PE=3 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 6.755e-163
Identity = 597/2180 (27.39%), Postives = 1012/2180 (46.42%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFN------VSIDPDFNVSLLSNNEACFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHY---KEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQK----VVHKVLFKRKLEKRLRSCIIIQK----YIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRK----FQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVR--KYLLQK--QYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRA----LLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSY---------------------------ICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFA----RKKYLSYRHSV-----------------------IVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRK---IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRK----HYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQY----LXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRS----HFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF---NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHF---RKYLIIRRIDLEQK-AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISR----NRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY----ICISKFKMIKSATLIIQKHIRGIFVRLKYK---------KIIKLVVFIQKNIRANIVRTRFL---NIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFL----IRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVL-----------KRSAVVIQRIWR 6360
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +         +S++ + +V+ L+        FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF ++NL+ D+  GVRL R  ++L  N  +  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     KT    H    K   I+QS V  FL  ++ +      +I Q   +R LA+ ++             K+A LIQ  +RRY  R R+ K+K  +++LQS  R  +   +Y +   + + IQ + R YL R      Y+ ++ S+ IIQ   + +  R K     KA V++Q AFR +  R+    +  +A++IQS+YR     R Y+ +R  VI+IQK       + L+KRK E    S + IQK    Y++G I R N+L+ ++A   L+  F   L+     +   +  ++Q   RM   R  FL  +K+ I  Q   +++   +++   K A ++IQT  RA I  RK    +Q  R+A I++Q  +R    RK ++    S I IQ   R+ + +K +L +K + + +Q   K    +K Y  +    +  Q   R  K   QK  +Y+++R+S I +Q   R    RKQ    RK  I +Q Y +M + RQ +LK+   +I IQ    A    + QR+++++ KKA   +Q  +R  K ++ I   + AA  +Q  F+ Y                             +  F K K +V  +Q   R    RKQ ++E +  + +QS  RM   +K+++    A L I +  + + A    R +Y+  RH+V                       I+IQ+ +R  + +K +  +K +A++IQKY + + I R+   +Y     A+  +Q   RG  VRK +   +++A  IQ  YR+YK +K +   R +AI+IQ+ +R     H   ++Y   +K  I IQS+ R     +  + M +AATYI+ + K +  R  Y T R++A++IQ   R Y    + R+ +     ++ I+Q   R   +R   ++  +AATLIQ   R Y  +      +K  + IQ  YRA   R+     +   +++ I +Q   RG   R++         L+Q   +  + R+ +  L+ +++ +Q+ +R       H +FL+++NA I IQ + RR+   K  R+   A+  IQ   R     ++YQ    A++++Q+ +   R   + R+  L Q+ +A I+Q  +RG   R H     +S   IQ+ F++ L+R++++ +++ TIF+Q   R  I      ++FL+L+ + I +Q   R     +K  + ++A + IQ  FR      TFQ  K ASI+IQ+++R Y         R   ++ ++YIR++    +  + +K +K+   + +KH   I ++  Y+         K+      IQ+  RAN  + + L    +KK      SF  M+ + K  Q   Q+  +IQK+C+ F  RK +L +++ ++ IQ+ +R+    R+       +I +QS  RG   +   Q M  A  LIQ   + +  +  Y+  + +++ +Q + R ++     RKIFL ++ +   I    RG+ VR       Q +K  ++E +     A+I  Q+   CY  K +Y  ++S  + IQ+ ++   L            R+AV IQ+ +R
Sbjct:  692 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGVENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETIYGELISLEDNSDVTGLA-------MFILNRLLWNPDIAAEYRHPTVPHLYRDGHEGALSKFTLKKLLLLVCFLDYAKISKLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAITNLAVDLQCGVRLVRTMELLTQNWSLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTQSIKRTISLLSCHSDALINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYK----LKTDLKRHQERDKAARIIQSAVINFLAKQRLRKRVNAALIIQKYWRRVLAQRKLLILKKEKLEKVQNKAASLIQGYWRRYSTRKRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSSLIIQSMFRKWKQR-KMQSQVKATVILQRAFREWHLRKR-AKEENSAIVIQSWYRMHKELRKYIYIRSCVIVIQKRFRCFQAQKLYKRKKE----SILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRR-LKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHIRKHQQLQKYKKMKKAAVIIQTHFRAYIFARKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIATQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKKFLRVKKAATCLQAAYRGYKIRQLIKQQSIAAVKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQRMEYIELRHAVLILQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGREQHHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHRQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATYIKAMFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKMQREKYLTILKAVKILQASFRGVRVRWTLRKMQIAATLIQSNYRRYKQQTYFNKLKKITKTIQQRYRAVKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKKMREMHRAATFIQATFRMQRVHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLHQFLQLRKAAITVQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTYVTFQTWKQASILIQQHYRTY---------RAAKLQKENYIRQWHSAVVIQAAYKGMKARQHLREKHKAAIIIQSTYRMHRQYCFYQKLQWATKIIQEKYRANKKKQKALQHNELKKETCVQASFQDMNMQ-KQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTVVRT-----QAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYRLYIRVKTERKIFLAVQKSVRTIQAAFRGMKVR-------QKLKNISEEKM-----AAIVNQSALCCYRSKTQYEAVQSEGVTIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFR 2826          

HSP 2 Score: 374.785 bits (961), Expect = 1.101e-102
Identity = 482/1952 (24.69%), Postives = 883/1952 (45.24%), Query Frame = 1
Query: 2014 RAASCIQRVWR----KYRTFYLYKT--HFIAHY-------------KEVIIVQSIVRRFL----CLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIR----GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYL----RRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALI----QRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXX----XXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIK----MHQCRQKFLKLKSQVITIQKNIRALLQRRR---------YIKN--------------KKAVIFIQRKFRSC------KEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMI----ITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS----QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQF---------RKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGY----LIRKNFTETRNKIILVQSLMKGFIARK----------------------C-YQKLRSSSIIVQKIFRGFNAHKKFL---KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR----------------RIDLE--QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRRYISRNRFLRL---KMSVIIIQKVTRGYFT---------------------------HRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL-----VVFIQKNIRANIVRTRFLNIKKSII----------------------NIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSII------IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTL-------------------LIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSV-SKYRQQLSSRCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNSLQENNLS 7125
            RAA  IQ  WR    + R   L KT   F AH              K  +I+Q+  R ++     L  ++  +  +I+ QS  +   AR     +  S I IQ  YR Y+ +  +  +K+AT+ LQS  +    +K YL +  + L IQ   R        R  Y ++R+S   +Q +V+GYL RK+     KA++ +QS FR    R+ Y    KA ++IQ++Y +       R+ +L ++K+   +Q        ++ ++++  + + IQ   RG+  R  +     ++  ++ ++  Y      R  FLK + +V+ LQ   R   +R     + ++A+ IQ +F+   A+K+F   K+A ++IQ   RA      QR ++  LR+A +I+Q  ++  ++R++   Q+  AI+IQ   R  + QK +  +K++ L+IQK+ K + + +            ++  QS  R   ++K+     K+ + IQ  +RA   +K++  +R   I++Q++ +     H+  +++L LK   I IQ   R +  RR          YIK               +KA I IQ +FR+       +EK   IL  +A  ++Q  F+    +   RKM+ + T+IQ   RR   +  F K  K+   +Q + R +    I  +RY K   + + I    +G  AR+       +  +IQ  FR  M R+ FLS+K +A+ IQ+  R  +  K +      Q   IK IQ + R +++RK +   H++AT IQ  +R  ++   +   + A++VIQ+Q+         R+HY+RQ     R   + +Q+  R     +  K M  +AT IQ   +  ++R+++++ +++ + +Q+  R  +  K               + +FL      RK  AA  +Q   R  +V+K++   Q+A  +IQ  +R H     F   K A+I +Q++ R Y    L ++N+    +  +++Q+  KG  AR+                      C YQKL+ ++ I+Q+ +R     +K L   +LK  + C+Q + +     K  ++   A+I+IQK+ + F  R  Y       + +QR +RK  ++R                R D++   +AA +IQ+FYR +  +  +  +K + V IQNY++ Y+     RK +L +++    IQ   R    R +   +   KM+ I+ Q     Y +                             +Y  Q +A + IQK FRR    K  +  K A++ IQ   +  + R+ F ++++  + +Q Y R +    +F + + A +++Q H R  F+  K+++ + L     V+ IQ   +  I + +F  IK S I                       IQ++YR    +K Y  + +++ +IQ      + R  FL ++++ IIIQ+ +R  L+ +    +  +I        +Q+  RG   +  + + ++A ++IQK ++     K  +I     +KS + LQ  +RG+L+RK  L+ +    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++++ + K Y++                   +IQ+  R  VL++      S ++ IQ +WRG   R   +  K    I  IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR V  +EV+   + V  N+ K     + V + +      ++L++  +YR    +K   KG +IF  TC LL +L+K      +N    +   S + D + S Y+  L++    +     N+++IL + + N S  +   F P +  +  + ++L     L+ +N+ 
Sbjct: 1561 RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHIRKHQQLQKYKKMKKAAVIIQTHFRAYIFARKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSIVKMKQTRKQYLHLRAAALFIQQCYRSKKIATQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKKFLRVKKAATCLQAAYRGYKIRQLIKQQSIAAVKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVVSLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQRMEYIELRHAVLILQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYKAYSIGREQHHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITHRQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATYIKAMFKMHQSRISYHTMRKAAIVIQVRFRAYYQGKMQREKYLTIL--KAVKILQASFRGVRVRWTLRKMQIAATLIQSNYRRYKQQTYFNKLKKITKTIQQRYRAVKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHVAATLIQRRFRTLMMRRRFLSLKKTAVWIQRKYRAHLCTKHHLQFLQVQNAVIK-IQSSYRRWMIRKKMREMHRAATFIQATFRMQRVHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQ-----RHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHK-------------LHQFLQL----RK--AAITVQSSYRRLMVKKKLQEMQRAAVLIQATFRMHRTYVTFQTWKQASILIQQHYRTYRAAKLQKENYIRQWHSAVVIQAAYKGMKARQHLREKHKAAIIIQSTYRMHRQYCFYQKLQWATKIIQEKYRANKKKQKALQHNELKKET-CVQASFQDMNMQKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTVVRTQAVICIQSYYRGFKVRRDIQNMHRAATLIQSFYRMHRAKVDYQTKKTAIVVIQNYYRLYIRVKTERKIFLAVQKSVRTIQAAFRGMKVRQKLKNISEEKMAAIVNQSALCCYRSKTQYEAVQSEGVTIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFRRMVTRKV-ETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRA-FLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGGFYTKLERTWFLNVRASAIIIQRKWRAILSAKIAHEHFLMIKRHRAACLIQAHYRGYKERQVFLRQKSAALIIQKYIRAREAGKRERIKYIEFKKSTVILQALVRGWLVRKRILEQRTKIRLLHFTAAAYYHLNALRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQQKKF-IQKYYSIEKIEHEGQECLSQRNRAASVIQKAVRHFVLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTK----IKAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSVPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCVDTLLELLQ--IYREKPGNKVADKGGSIFTKTCCLLAILLK-----TTNRASDVRSRSKVVDRIYSLYK--LTAHKHKM-----NTERILHKQKKNSSISIP--FIPETPVRTRIVSRLKPDWVLRRDNME 3457          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Match: sp|Q8IZT6|ASPM_HUMAN (Abnormal spindle-like microcephaly-associated protein OS=Homo sapiens OX=9606 GN=ASPM PE=1 SV=2)

HSP 1 Score: 568.54 bits (1464), Expect = 8.953e-163
Identity = 594/2185 (27.19%), Postives = 1011/2185 (46.27%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTH--LSKTKVEDIN----------------KNMPIYIE------------------ATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF----------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT------------------------SANLFDKE-------ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISK---------MKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSN----YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQK----YIRGFINRRNFLKFKSAVNILEHYF------------------MGYLRRKQ----FLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRY-FAKKEFVA---KKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQK-HTKGFLVXXXXXXXXXXXXXC---QSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQC----RQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKE--KKQIILNNQAATVVQKYFKSY----ICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKK----YLSYRHSV-----------------------IVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRK---IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF---------ICQKNAAIK------------------LQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGF---NAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHF---RKYLIIRRIDLEQK-AARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRN----RFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY----ICISKFKMIKSATLIIQKHIRGIFVRLKYK---------KIIKLVVFIQKNIRANIVRTRFL---NIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFL----IRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVL-----------KRSAVVIQR 6351
            D+ W ++QE  F  WLN I        KT + ++N                   P   E                  A +L  SE  V AI+K+  E+    L   KD   +K     + +   +++YN  WL +    +      +SL  N++      FI  ++LWN DIA ++R   +    +     +L++  L++ L +V  LD AK + +   D  LF KD+  K+S E+L  F+  FL GEG++ +      L V+H+QT  DE+DF V+NL+ D+  GVRL R  ++L  N D+  KLR PA+   +K  N+++ ++  K  G  +    G  I    I   HREKTL LLW +     +D  ++ D+L  EI                               ++        + +LL+ WV +VC  YN  V N + +  DGR  C LIH+Y P Y+  + I   TT T                        S   FD E        LLENEK+NF +  S ++ +GG P ++      N IP  + ++  L+F  +RL+DL    RAA  IQ  WRKY+     K H     K   I+Q  V  FL  ++ +      ++ Q   +R LA+ ++             K+A LIQ  +RRY  R R+ K+K  +++LQS  R  +   +Y +   + + IQ + R YL R      Y+ ++ ST IIQ   + +  R K     KA V++Q AFR +  R+    +  +A+IIQS+YR     R Y+ +R  V+IIQK       ++  ++R  S + IQK    Y++G I R N+L+ ++A   L+  F                    Y R +Q    FL ++ ++I  Q ++R    R  +   +K+A+IIQ  F+ Y FA K   +    +SA I++Q+  R +  R+ + ++  + I IQ  +R Y  +K+FL    + I +Q  V+    +K YL ++ + L IQ+ +    +  +  ++ +     C   Q+ VR YL++KQ    RK+ I +Q +FR   AR+ +L   K  IV+Q Y   ++     R+ FL++K     +Q   R    R+   +   A + IQ  FR   +  K Q +L  Q+   +Q+++++Y      +  F K K +V  +Q   R    RKQ ++E +  + +QS  RM   +K+++    A L I +  + + A +K    Y+  RH+V                       I+IQ+ +R  + +K +  +K +A++IQKY R + I R+   +Y     A+  +Q   RG  VRK +   +++A  IQ  YR+YK +K +   R +AI+IQ+ +R     ++  ++Y   +K  I IQS+ R     +  + M +AAT+I+ + K +  R  Y T R++A++IQ   R Y   K                   + R  Y   L A  ++Q   RG  VR+ +   Q A  +IQ+ YR +  +++F         + Q+  A+K                  +Q   RG   R++         L+Q   +  + R+ +  L+ ++I++Q+ +R       H +FL+++NA I IQ + RR+   K  R+   A+  IQ   R     ++YQ    A++++Q+ +   R   + R+  L Q+ +A I+Q  +RG   R H     +S   IQ+ F++ L+R++++ +++ TIF+Q   R  I       +FL L+ + I IQ   R     +K  + ++A + IQ  FR +    TFQ  K+ASI+IQ+++R Y   +  K +R+N      YIR++    +  + +K +K+  L+ +KH   I ++  Y+         K+      IQ+  RAN  + +      +KK       F  M+ + K  Q   Q+  +IQK+C+ F  RK +L +++ ++ IQ+ +R+  A R+       +I +QS  RG   +   Q M  A  LIQ   + +  +  Y+  + +++ +Q + R ++     RK FL ++ +   I    RG+ VR       Q +K  ++E +     A+I  Q+   CY  K +Y  ++S  ++IQ+ ++   L            R+AV IQ+
Sbjct:  692 DERWKEKQEQGFTWWLNFILTPDDFTVKTNISEVNAATLLLGIENQHKISVPRAPTKEEMSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGEL--ISLEDNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPHLYRDGHEEALSKFTLKKLLLLVCFLDYAKISRLIDHDPCLFCKDAEFKASKEILLAFSRDFLSGEGDLSRHLGLLGLPVNHVQTPFDEFDFAVTNLAVDLQCGVRLVRTMELLTQNWDLSKKLRIPAISRLQKMHNVDIVLQVLKSRGIELSDEHGNTILSKDIVDRHREKTLRLLWKIAFAFQVDISLNLDQLKEEIAFLKHTKSIKKTISLLSCHSDDLINKKKGKRDSGSFEQYSENIKLLMDWVNAVCAFYNKKVENFTVSFSDGRVLCYLIHHYHPCYVPFDAICQRTTQTVECTQTGSVVLNSSSESDDSSLDMSLKAFDHENTSELYKELLENEKKNFHLVRSAVRDLGGIPAMINHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKTDLKRH-QEREKAARIIQLAVINFLAKQRLRKRVNAALVIQKYWRRVLAQRKLLMLKKEKLEKVQNKAASLIQGYWRRYSTRQRFLKLKYYSIILQSRIRMIIAVTSYKRYLWATVTIQRHWRAYLRRKQDQQRYEMLKSSTLIIQSMFRKWKQR-KMQSQVKATVILQRAFREWHLRKQ-AKEENSAIIIQSWYRMHKELRKYIYIRSCVVIIQKRFRCFQAQKLYKRRKESILTIQKYYKAYLKGKIERTNYLQKRAAAIQLQAAFRRLKAHNLCRQIRAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVL--QSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGK-------------------MQREKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQRYNKLRHSVIYIQAIFRGKKARRHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIKIQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQRHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATICAKHKLYQFLHLRKAAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTY---RAAKLQREN------YIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIK-KQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRT-----QAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVR-------QKLKNVSEEKM-----AAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQK 2823          

HSP 2 Score: 380.563 bits (976), Expect = 1.925e-104
Identity = 501/1967 (25.47%), Postives = 886/1967 (45.04%), Query Frame = 1
Query: 2014 RAASCIQRVWR----KYRTFYLYKT--HFIAHY-------------KEVIIVQSIVRRFL----CLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIR----GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVV--HKV--LFKR-------------------KLEKRLRSCIIIQKYIRGF----INRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKK----EFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVR--SIICQKN--YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQK-----------------------YIKMHQCRQKFLKLKSQVITIQKNIRAL----LQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKE-SVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRH-SVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS----QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQF---------RKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGY----LIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR----------------RYCQMKLYRDT---------RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIR----------------RIDLE--QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRR--------------------------YISRNRFLRLKMSVIIIQKVTRGYF----THRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL-----VVFIQKNIRANIVRTRFLNIKKSII----------------------NIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFL-AKRSYQRNLSI-----IIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKI----LQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY----------------CLLK--SYTLLIQQRWRFIVLKR------SAVV-IQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELT---VAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSV-SKYRQQLSSRCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNSLQENNLS 7125
            RAA  IQ  WR    + R   L KT   F AH              K  +I+Q+  R ++     L  ++  +  +I+ QS  +   AR     +  S I IQ  YR Y+ +  +  +K+AT+ LQS  +    +K YL +  + L IQ   R        R  Y ++R+S   +Q +V+GYL RK+     KA++ +QS FR    R+ Y    KA ++IQ++Y +       R+ +L ++K+   +Q     +KV  L K+                   K +  L+S I IQ++ R +      R +FLK K+AV  L+  + G+  RKQ  +   + + +Q   RM   +  F + + +A++IQ++F+ + A +    E++  + A +++Q+  +    RR+ Q     AIIIQ  +R +  +KK+ I   +A++IQK  R  SI  ++N  YLK K +V+ +Q   +G  V+K  K      +  QS  R Y  +K+Y   R S IIIQ+ +R I       K++LN +K  I +Q                          KMHQ R  +  ++   I IQ   RA     +QR +Y+   KAV  +Q  FR  + ++ +     AAT++Q  ++ Y  +  F K+K+ + TV Q+Y        QFQ                    RY K   + + I    +G  AR ++L   H +  +IQ  FR  M R+ FLS+K +AI+IQ+  R  +  K +      Q   IK IQ + R +++RK +   H++AT IQ  +R +++   +   + A++VIQ+Q+         R+HY+RQ     R   + +Q+  R     +  K M  +AT IQ   +  ++R+++++ +++ + +Q+  R  +                   +  L + ++ RK  AA  IQ   R  +V+K++   Q+A  +IQ  +R +     F   K+A+I +Q++ R Y    L R+N+    +  +++Q+  KG  AR+  ++   +SI++Q  +R +  +  + KL+ A+  IQ+  R                  C    ++D            A+I+IQK+ + F  R  Y       + +QR +RK   +R                R D++   +AA +IQ+FYR +  +  +  +K + V IQNY++ Y+     RK +L +++    IQ   R                           Y S+ ++  ++   ++IQ+  +          +Y  Q +A + IQK F R    K  +  K A++ IQ   +  + R+ F ++++  + +Q Y R +    +F + + A +++Q H R  F+  K+++ + L     V+ IQ   +  I + +F  IK S I                       IQ++YR    +K Y  + +++ +IQ      + R RFL ++++ IIIQ+ +R  L AK +++  L I        +Q+  RG   +  + + ++A ++IQK ++     KH +I     +KS + LQ  +RG+L+RK FL+ +    ++          N  +  + +    A +N  K++ + I IQ +FR  +Q++R+                CL +      +IQ+  R  +L++      S ++ IQ +WRG   R   +  K    I  IR      NR   + N +      AL  L    LT   ++ +L  L  LE VT LS   C+ + +S A   +  L+  CNR +  +EV+   + V  N+ K       V   E  I ++  LL  YR    +K   KG +IF  TC LL +L+K      +N    +   S + D + S Y+  L++    +     N+++IL + + N S  +   F P +  +  + ++L     L+ +N+ 
Sbjct: 1561 RAACVIQSYWRMRQDRVRFLNLKKTIIKFQAHVRKHQQRQKYKKMKKAAVIIQTHFRAYIFAMKVLASYQKTRSAVIVLQSAYRGMQARKMYIHILTSVIKIQSYYRAYVSKKEFLSLKNATIKLQSTVKMKQTRKQYLHLRAAALFIQQCYRSKKIAAQKREEYMQMRESCIKLQAFVRGYLVRKQMRLQRKAVISLQSYFRMRKARQYYLKMYKAIIVIQNYYHAYKAQVNQRKNFLQVKKAATCLQAAYRGYKVRQLIKQQSIAALKIQSAFRGYNKRVKYQSVLQSIIKIQRWYRAYKTLHDTRTHFLKTKAAVISLQSAYRGWKVRKQIRREHQAALKIQSAFRMAKAQKQFRLFKTAALVIQQNFRAWTAGRKQCMEYIELRHAVLVLQSMWKGKTLRRQLQRQHKCAIIIQSYYRMHVQQKKWKIMKKAALLIQKYYRAYSIGREQNHLYLKTKAAVVTLQSAYRGMKVRKRIKDCNKAAVTIQSKYRAYKTKKKYATYRASAIIIQRWYRGIKITNHQHKEYLNLKKTAIKIQSVYRGIRVRRHIQHMHRAATFIKAMFKMHQSRISYHTMRKAAIVIQVRCRAYYQGKMQREKYLTILKAVKVLQASFRGVRVRRTLRKMQTAATLIQSNYRRYRQQTYFNKLKKITKTVQQRYWAMKERNIQFQ--------------------RYNKLRHSVIYIQAIFRGKKAR-RHLKMMHIAATLIQRRFRTLMMRRRFLSLKKTAILIQRKYRAHLCTKHHLQFLQVQNAVIK-IQSSYRRWMIRKRMREMHRAATFIQSTFRMHRLHMRYQALKQASVVIQQQYQANRAAKLQRQHYLRQ-----RHSAVILQAAFRGMKTRRHLKSMHSSATLIQSRFRSLLVRRRFISLKKATIFVQRKYRATIC-----------------AKHKLYQFLHLRK--AAITIQSSYRRLMVKKKLQEMQRAAVLIQATFRMYRTYITFQTWKHASILIQQHYRTYRAAKLQRENYIRQWHSAVVIQAAYKGMKARQLLREKHKASIVIQSTYRMYRQYCFYQKLQWATKIIQEKYRANKKKQKVFQHNELKKETCVQAGFQDMNIKKQIQEQHQAAIIIQKHCKAFKIRKHYLHLRATVVSIQRRYRKLTAVRTQAVICIQSYYRGFKVRKDIQNMHRAATLIQSFYRMHRAKVDYETKKTAIVVIQNYYRLYVRVKTERKNFLAVQKSVRTIQAAFRGMKVRQKLKNVSEEKMAAIVNQSALCCYRSKTQYEAVQSEGVMIQEWYKASGLACSQEAEYHSQSRAAVTIQKAFCRMVTRK-LETQKCAALRIQFFLQMAVYRRRFVQQKRAAITLQHYFRTWQTRKQFLLYRKAAVVLQNHYRA-FLSAKHQRQVYLQIRSSVIIIQARSKGFIQKRKFQEIKNSTIKIQAMWRRYRAKKYLCKVKAACKIQAWYRCWRAHKEYLAILKAVKIIQGCFYTKLERTRFLNVRASAIIIQRKWRAILPAKIAHEHFLMIKRHRAACLIQAHYRGYKGRQVFLRQKSAALIIQKYIRAREAGKHERIKYIEFKKSTVILQALVRGWLVRKRFLEQRAKIRLLHFTAAAYYHLNAVRIQRAYKLYLAVKNANKQVNSVICIQRWFRARLQEKRFIQKYHSIKKIEHEGQECLSQRNRAASVIQKAVRHFLLRKKQEKFTSGIIKIQALWRGYSWRKKNDCTK----IKAIRLSLQVVNREIREENKLYKRTALALHYL----LTYKHLSAILEALKHLEVVTRLSPLCCENMAQSGAISKIFVLIRSCNRSIPCMEVIRYAVQVLLNVSKYEKTTSAVYDVENCIDILLELLQIYREKPGNKVADKGGSIFTKTCCLLAILLK-----TTNRASDVRSRSKVVDRIYSLYK--LTAHKHKM-----NTERILYKQKKNSSISIP--FIPETPVRTRIVSRLKPDWVLRRDNME 3457          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Match: C3ZHZ0 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_88778 PE=4 SV=1)

HSP 1 Score: 694.501 bits (1791), Expect = 0.000e+0
Identity = 628/2379 (26.40%), Postives = 1104/2379 (46.41%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF--NTHLSKTKVEDINKNMPIYI---------EATKLLLSECKVA--IEKINSEVTKDSLKFKDDIFFKSGKHHRD-LTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNE--ACFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVT-YSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTT------------LTSANLFDKE-----ILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYL----VQKNYLKIYRSILIIQNNIRGYLCRSN--------------------------------------------------YKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRT----YLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLR--RKQFLKMRNSVILLQKNLRMLSLRN--SFLXXXXXXXXXXXXXXRYFA-------KKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSII----CQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARK----QFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCK---EKKQIILNNQAATV-VQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKI----YCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIR----QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYK-RKLLAATL-IQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKN----FTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQ----MKLYRDTR---NASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFR----------KYLIIRRIDL-------------EQKAARII----QNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEI----RQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKT----FQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKH---------------------------IRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKN----YQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRT---ATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALT-DLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-AGVLNFDVIGSEFIKLVKNLL--YRNINSKRGTKGITIFCHTCLLLVLLIK--------MEQKSISNSQYSISKDSNIKDSVSKYRQQLSSRCENIVGSISNSDKILEQM--RLNPSWDLKR 7041
            D+ W+++QE  F++WLN I   NT   + +       M  Y           A  LL     +A  I ++  EV    L+ + D    + +  R  + +++++Y+  WL +           V  L +N+  A   +F+  ++L N DIA++     +    K  +  +L +  L++FL++V+ +D AK   +   D  LF   +N+KSS E+L  F+  +L GEG++ +  S    SV+H QTA+ E D+TV NL+ D+ DG+RL R  ++L  N  + SKLR PAV   +K  N +++++A ++AG ++ T   G +I+   I  G +EKTLALLW               KLI                               ++  V N S +  DGR  CLL+H+YLP+ L + EI  +TT             T A   + +      LL +EK NF++   K+ ++G  P +L      N IP  + +MAT+++  +R+I+L    RA   IQ  WR+Y     +    +  + E                   ++   I  Q+ V+  + R  + +  KSA  IQ   R +  R +Y K + A ++LQ   R +L     Q+ Y  + R+ + +Q  +RG   R                                                    Y+ +R +T  +Q  V+G L R+   K  K+   IQ+A RG+  R+ Y  Q +AA+ +Q   R+ +  +T    Y ++R++ I +Q  V  ++ +R L+++ +S   IQ  +RG+  R+ ++K + A  IL+ Y   +L   R  +++ R     L         R     +  +   +      +R+ A       +  + + KSATI +Q  VR ++ R+  Q    +A  IQ   R ++ R++++ Q  +AI +Q+ VR+ +     Q+ Y  +++S + +Q   +G +V++S ++        Q+ VR++  ++QY+K R++ II+Q+  RA  ARK    ++ + R+ TI +Q  ++    R++  + +     IQ   R   Q  +Y   K A   IQ++FR+ K   E++ +  + ++AT+ +Q   +  + +K  ++  +S T IQ   R    R+Q+ K+ +  I LQ ++R  +     +++YQ    +T+ +   V+G   RK       S  +IQ + R +  R+ ++  + +AIV+Q Y+R  +KRK     Y +   A   +Q  +RG LVR++L   H+SAT IQ   R +  R+ ++ +R A I++Q+Q R H  R    Q+Y   R+  I +Q+ +R     ++ KQ + AAT IQ   +G+    KY   + +  IIQ+  R +                     + +    +  R L +AT+ +Q   RG LVRK +  + K+  IIQ   R  T R  ++ Q+ AA+ LQ  IR +L RK     +   R   I +Q+ ++G I R+  ++   S+  +Q   RG+ A ++++K + A+I +Q+ VR + +    M + R  R    ++  IQ  VRG+  R +Y +Q  AAI+LQ+  R          KY  +RR  +              QK A+++    +  +RG+     +   K +   IQ  F+A+ + ++  +I    +  TI +Q  VR  + R    R   S   IQ   RG+   ++Y+KQ++A I +Q   R + + KT    +QN++ A+I +Q   R   +R+  K+ +    KIQ+  R +  + K+K IK AT IIQ+                            +RG+ VR   ++  K    IQ  +R  I R +++  +++ I +Q   R H   K     YQ ++++   +Q   R F+AR++ ++      +IQ  FR FL +R Y    + +  +Q+ VRG  A+  YQ++R    A ++IQ T +G+  R   K+LQ SV       R +L RK +L+L+ A   +   VR      + QK              +RL A++ +Q+Y R Y+ K+         L+IQ+       K++ +V+Q IWRGR +R ++  K+I   I+  R + + A R  ++   +  +   AL   LK   L+   +L  L S+E VT LS   C+ L++  A +++  L+  CNR +   E++   IS+  NL K    +   V+    ++ + +L+  YR        K   IF  TCLLL L           +   S++    S+ +  N K  +S+ +Q++ S+ +        +   L QM   + P+W L++
Sbjct:  629 DERWMQKQERAFIQWLNFILIPNTLAPQPRRNGTAVQMCEYAVLCNLNQLRRAACLLFQSEPMARVIHRLEEEVETGRLQVRADRHLHADQGIRQAILDMLLSYSPLWLRIGLETIFG---EVLPLQHNDDVAGLSRFLLNRVLGNSDIAQQFSHPTVPHMYKTGYAAALAKFTLKKFLTLVFFMDRAKLTRLIDQDPCLFCIHANIKSSKELLLTFSREYLSGEGDVTRHLSFLGYSVTHQQTALMEMDYTVQNLATDLRDGLRLNRAVELLTKNWTLSSKLRAPAVSRLQKIHNTKVSLEALQEAGVSLDTGLRGGKIEARDIVEGRQEKTLALLW---------------KLI-------------------------------FHFQVDNFSMSFSDGRVLCLLVHHYLPDLLPVEEICMDTTQSYITNYSGQAGTTQAECPETDKDRLKELLAHEKSNFKLVNQKVLELGTIPPLLCATDMSNTIPDQKVVMATVSYLCARVINLSQKVRAVRIIQAAWRRY-----HPKPAVGEWTE------------------DVQTATIRLQAAVRGMIVRRSLQRQHKSATTIQAAVRGWTARQQYMKQRQAAIILQQQVRAHLKRKTAQQKYQHVRRATICLQAAVRGMYVRRRQKQAQLAATKIQACWRGHQQLIKYKAIKLAAAIIQQRFRAFKLMQEEQHMYRSLRSATIHLQAAVRGMLVRRSLRKQHKSATTIQAAVRGWTARQQYMKQRQAAITLQQQVRAHLACKTAQQKYHHVRRATIWLQAAVRGMIVRRSLQRQHKSATTIQAAVRGWTARQQYMKQRQAAIILQLYVRAHLAPVRGMYVRRRQKQAQLAATKIQACWRGHQQLIKYKAIKLATTIIQQRFRAFKLMQEEQHMYRSLKSATIRLQAAVRGMLVRKSLQRQHKSATTIQTAVRGWTARQQYIKQRQAAITLQQQVRAHLKCKTAQQKYQHVRRSTIRLQAAVRGMIVRRSLQRQHKSATTIQAAVRRWTARQQYMKQRQAAIILQQQVRAYLARKTAQQKYQHVRRSTICLQAAVRGMYVRRRQKQAQLAATKIQACWRGHQQLIKYKAIKLATTIIQQRFRAFKLMQEEQHMYRSLKSATIRLQAAVRGMLVRKSLQRQHKSATTIQTAVRGWTARQQYIKQRQAAITLQQQVRAHLKCKTAQQKYQHVRRSTIRLQAAVRGMLVRKSLQRKHKSATIIQAAVRGWTARQQYMKQRQAAIVLQLYIRAHLKRKTAQQKYQNIRRATIRLQAAVRGMLVRRSLQRQHKSATTIQAAVRGWTARQQYMKQRQAVIILQQQVRAHLKRKTAQQKYQHVRRATICLQAAVRGMYVRRRQKQAQLAATKIQACWRGHQQLIKYKAIKLATTIIQQRFRAF---------------------KLMQEEQHMYRSLRSATIRLQAAVRGMLVRKSLQRQHKSATIIQTAVRGWTARQQYMKQRQAAVVLQLYIRAHLKRKTAQQKYQNIRRATICLQAAVRGMIVRRSLRRQHKSATTIQAAVRGWTARQQYMKQRQAAIVLQQQVRAHLKPVRGMIVRRSLRRQHKSATTIQAAVRGWTARQQYMKQRQAAIVLQQQVRAHLKRKTAQQKYQHVRRATICLQAAVRGMYVRRRQKQAQLLLPRFKLLWRGHQQLIKYKAIKLATTIIQQRFRAFKLMQEKQQIFRSCKSATIRLQAAVRGMLVRRSLRRQHKSATTIQAAVRGWTARQQYIKQRQAAIVLQLYVRAYLKRKTAQMNYQNIRRATICLQAAVRGMYVRRRQKQAQLAATKIQACWRGHQQLVKYKAIKLATTIIQQRFRAFKLMQEEQHMYRSCKSAAIRLQAAVRGMVVRKSLQRQHKSATIIQTAVRGWIARQQYMKQRQAAIILQQQVRAHLARKTAQQKYQHVRRATICLQAGIRGFLARRQLMKWIHASTVIQASFRCFLQRRRYLCIRAAVCRLQAAVRGWTARRTYQQVRVHHRAAVVIQSTYRGFATR---KVLQASV-------RAWLQRKHYLQLRQAVCKLQAAVR------YHQK--------------QRLTAAVVLQSYVRMYLAKK---------LMIQR-------KKAVIVMQAIWRGRHVRKNIKNKRI--RIA--RAKILAAQRAATEDKKLCNMTATALNLLLKYKHLST--ILDALRSMEVVTRLSAVCCERLVQGGAVQVIYTLIQSCNRSLPCQEMIKYSISILLNLAKNPATVAAAVVQEGGVETLVSLMAIYRE-------KDDVIFGQTCLLLTLFCNNAAYQKEVLNMPSVTQKLQSLYRLVNRKAGMSRNKQRMGSQEDK-----RRTSTALVQMVHHIKPAWILRK 2850          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Match: A0A3B3T4R3 (Abnormal spindle microtubule assembly OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 651/2539 (25.64%), Postives = 1115/2539 (43.91%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF-------NTHLSKTKVEDI--NKNMPIYIE-------------------------ATKLLLSECKV-AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEA-CFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE--------------------NPIXXXXXXXXXXXXV---WVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT-------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAP-IILPKE--NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCR-----IRYEKIK----SATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGY----AKRRN-----------------YTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQ---------------KVVHK------------VLFKRKLEKRLRSCIIIQKYIRGFI----NRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFA-------KKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKN----YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA---------------------------ISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQ-------------------------------------KY-------------FKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIIT----KKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQK----YLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIR----QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLI----RKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYC----QMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAAR----IIQNFYRGYT----IRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGY----FTHRKYVKQKKAVINIQKNFRRFS----------------------ELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKM----IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNY-----------------QLMK----------QSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ-------------------------------------------------RNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQR----FIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKI-----------------------FAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLK--RSAVVIQRIWRG-----RQLRCH-----LNAKKIGHEISEIRN--RFIEANRRFSKFNTVRYIGKKALTDLKESELTVAK----------------VLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            D+ W+++QE  F  W+N          NT ++K     +    N P  I                          A  L  SE  V AI ++  EV    L  + D   +K     + +   +++YN  WL     + ++  F   + L SNN+      FI  ++LWN DIA + R   +    +     +L+   L++ L +V  LD AK++ I   D  LF  D+  K+S ++L  F+  FL GEG + +      L VSH+Q  +DE+DF V NL+ D+  G+RL R+ ++   +  +  KLR PA+   +K  N+++A++  +D G  +    G  ID   I  GHREK++ LLW ++    +D ++D +KL  EI   +                     P    +  S   L +   WV +VC  YN+   N + +  DGR  C L+H+Y P +L L  I+ +TT T                              D + LLENE+RNF++  + +  +GG P +I P +  N IP+ + +   L+F  +RL+DL    RAA  IQ  WRKYR                     + RR L  K   ++K+++      VKR+L R R  +++ SAI++Q  +R +L R      R EK++    SA +V+Q+ +RRYL  K + ++    ++IQ  +R  +  + ++R+R +    Q+  K  L     R++++ L  A + +Q +FR +    + RRN                  T Q  AA+ IQS+YR  VC R Y  + ++ +IIQ               K+ H              L +R LE R  + +IIQ++ R        R  +LK K A   L+  + GY+ RK+      + I++Q   RM   R  FL         +   +RY A       K E+VA + + + +Q   R  ++RR+ + L  AA +IQ  FR YSV+ +F ++  +A+V+Q   R+ +  +N    YLK +++++ +Q   +G  V++  K+      + Q+  + ++ ++ Y+ +R++TI++Q+H+RA                              R+  ++ ++ + V+Q Y +M++ R  F   +   + IQ+  RA +    QR  Y++ K++ + IQ  FR  K + ++   ++AATV+Q                                     KY             F+    ++Q R+M+ +  +IQ++      RK++ +     + +Q + R  +     ++RYQ  +AA++TI    +G   RK+    R S  +IQ  FR +  R  F++ K +A+VIQ+    +L G   R+ +     +  VIQ   RG   R  +   H +A +I+  +R ++    F   R AA VIQ+++R   +R    Q+Y   +     IQ   R + A Q+ K M +AAT IQ+  + +  RK++V+ R +A++IQ   + +++ K                    MR+ Y  K  AA  IQ   RG   R++++ E+KA  +IQ   R H  R+     + AA  +Q+  R   +    + N    R   I +Q   +G  AR+ + ++RS++  +Q  FR   A K++L LK+A + +Q   R       Q +LY   R+A++ +Q   RG+  R   +RQ  AA ++Q  FR     RR  ++ +A R    IIQ  YR Y      R  FL  +N+ ++IQ  F+   ++KK     +    IQ   R +  R  F+RL  +  ++Q+  R          KY++ K+A   +Q +FR                         + + F   ++A+++IQ  FR + +R +F+K + + + IQ + R      K +     I+ A +++Q   RG+  R +  K  +  V IQ  +R    R  FL+++ +++ +Q+ YRM  + + +                 Q M+          +S+ VIQ   R  + RK+FL+ K + I IQ F++  + ++ +Q                                                 R     + +Q+  +G L + K+   R A + IQ   +G+  R+  K+ + +V+ LQR      RG   R  F K+K A++ +    RG L R   ++  Q  ++                       +A E+ RK++ + I IQ + R  IQ++RY   +   + +Q+  R  + +  R++ +IQR  R      R+ R       L A   GH   ++ +  +     RRF K N++          +KE +    K                +L  L  LE  T LS E C+ L++S A  ++  L+  CNR V  +EV+S  I V  NL K       V G E  ++ +  LL  YR     K   KG +IF  TC LL +L+   Q++
Sbjct:  695 DERWMEKQERGFTMWMNYALTPDEFKVNTEVTKVNAMSLAFQSNQPFNISKAPTKEEVSFRTYTARRRLNRLRQAACLLFTSESMVKAIRRLELEVEARRLLVRRDRHLWKDIGQRQKVLNWLLSYNPLWL----RIGLETIFGEMIPLESNNDVMGLAMFILRRLLWNPDIAAEFRHPKVPHLYRDGHEDALSSFTLKKLLLLVCFLDKAKESKIIEHDPCLFCMDAEFKTSKDLLLAFSRDFLSGEGILPRHLGYMGLPVSHVQMPLDEFDFAVKNLAVDLRCGIRLVRVMELFTQSWSLSQKLRVPAISRLQKVHNVDIALQVLRDRGVDLKDEHGGAIDSRDIVDGHREKSITLLWKIIFAFQVDVLLDEEKLKEEISFLQRMWRSKQELAAWKQHRNVVPKPQQAKSEESAAKLTLLMHWVNAVCAFYNLKAENFTVSFSDGRLLCYLLHHYHPCHLPLEAISQSTTQTVECDQRGRVGLNCSFSDSDSSLNNGPGTSLDYKELLENERRNFELLHAAVTSLGGIPAMITPTDMSNTIPNEKVVTCYLSFLCARLLDLRAESRAAWVIQGTWRKYRL-------------------KMQRRLLKEKNIAAVKIQV-----AVKRFLLRRREERLQASAIVLQAAWRGHLVRQEIRQQRMEKLRILQDSAAIVIQAEWRRYLAVKRFQRLRHHAVVIQARVRMKVAVTAFRRLRWAVMTFQQRRKASLLAKEHRQRYLSLRNAAITVQKSFRKWKVLSSIRRNNAAVVIQTAFRKWLTQKRTCQAAAALRIQSWYRMLVCCRRYAKVLQNAVIIQAWYRGFKERKIYQILKLQHSRAAIIQRTFKAFALRRRFLEVR-HATLIIQRWYRACKQKQRERLQYLKMKVAAVTLQAAYRGYVARKEKRVQHKAAIVIQAAFRMSLTRKRFL---LLRRAARDIQRRYRAKLLGEKQKMEYVALRHSAVKLQALWRGRVERRRIERLHKAAALIQSHFRRYSVQLQFRLKRRAALVLQDKFRAYVFGRNVRQQYLKKREAIITLQAGFRGMKVRQEMKEKHRAASLIQATFKAFIYKRNYMLLRRATIVVQQHYRAHLLGQHQRRQYNRLRQAAVKLQASYRRCKVRRDLMHKQRASAVIQAYFRMYKARMSFNAARFAAVIIQRRYRAWMEGRCQREWYLRRKESALVIQSSFRGLKARLKVKEMHKAATVIQACYRRHKRVTQFNKLRWAASVIGQRFKATQLKNAQVRKYEAMKNAAVRIQSAFRGMKTRQQVREMQNAARIIQRHYAAYSMRKRYLQVKAAAVKIQRQYRAHLAARLQQQRYQSLVAASVTIQAAYRGMKVRKELQRMRRSATLIQAYFRMYRKRMPFIAAKLAAVVIQRQYRCHLEGKRVREDFLKLQHSAVVIQAAFRGKRARCEIRRMHSAALVIEGCFRMWQCYTQFQKMRWAARVIQERYRASRMRNLLMQEYRVKKTSANIIQLAFRNYKARQQIKTMHRAATSIQRSFRTFRTRKRFVSLRAAAIVIQLRYKAFMAAKR-------------------MRAEYLAKHNAAMTIQAAFRGVKARRQLLRERKAATVIQVAVRRHQARTFHRKLQWAADVVQRRYRANKLMVKEKHNLALKRQAAICIQGAFRGMKARQRFMRVRSAACTLQTAFRARAARKQYLSLKSAVLAMQLQYRAVAAGRRQRELYLHVRSAAVTLQAAYRGWRTRQMIRRQHAAATLIQSLFRG----RREAIKYQAMRLSTLIIQQHYRSYLQSKRERERFLQLRNAAISIQAAFRRRRVQKKLARWHRAATLIQATFRMHQQRVVFVRLHWAATVLQRRLRAQKLRDVQLEKYMRMKRAATCLQASFRAVKARRLAKKKRAARAIQSFLQMSVDRRRFLRCRSAAVVIQSAFRGHYIRNQFRKMQTSSLLIQRWYRSCRTTQKLRADYLSIRQAAVMLQSAYRGLLAR-RTAKCERSAVKIQSVMRMLPYRKSFLHLRSNVVKLQASYRMCMDRRRFLSYRMAAVTLQRRFRARQEMRAQKEVYLKTLKSVQVIQAQLRGHVERKKFLKCKKSAITIQAFYQGMVQRKYFQQQKASATKIQEFYRAYTLGRKDRERYMQMRKSAVLIQAAYRGHQGRQLARRRQAAVKIQAWFKGSLTRRKFSAQRNAAVAIQSAYRGHVQRRDLKLRRAAVLVLQRRFQALQRGKAERDAFRKMKMATLTLQAFGRGWLARRRMKQEAQARRVKCFSAAAYHHLCAIKIQRAVRAHWALESARKQMSSVICIQKWLRTRIQRKRYLEDREKLIKLQRTVRIWLSRRHRASTIIQRAVRKFLTKRREQRVQHGIIKLQALWRGHRSRQLHDTSKVAAMRRRFRKINSM----------VKEEDKLCNKTSTAIDYLLRYKHFSYILAALKHLETSTRLSPECCEHLVKSGATFVIFTLIRSCNRSVPCMEVISYAIQVLLNLSKYDKTTEAVYGVENSVETLLELLQIYREKAGDKVADKGGSIFTKTCFLLTILLHDRQRA 3167          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Match: A0A3B3T4M1 (Abnormal spindle microtubule assembly OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 651/2539 (25.64%), Postives = 1115/2539 (43.91%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIF-------NTHLSKTKVEDI--NKNMPIYIE-------------------------ATKLLLSECKV-AIEKINSEVTKDSLKFKDD-IFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEA-CFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE--------------------NPIXXXXXXXXXXXXV---WVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT-------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAP-IILPKE--NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCR-----IRYEKIK----SATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGY----AKRRN-----------------YTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQ---------------KVVHK------------VLFKRKLEKRLRSCIIIQKYIRGFI----NRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFA-------KKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKN----YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA---------------------------ISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQ-------------------------------------KY-------------FKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIIT----KKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQK----YLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIR----QQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLI----RKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYC----QMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAAR----IIQNFYRGYT----IRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGY----FTHRKYVKQKKAVINIQKNFRRFS----------------------ELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKM----IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNY-----------------QLMK----------QSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ-------------------------------------------------RNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQR----FIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKI-----------------------FAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLK--RSAVVIQRIWRG-----RQLRCH-----LNAKKIGHEISEIRN--RFIEANRRFSKFNTVRYIGKKALTDLKESELTVAK----------------VLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLL--YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            D+ W+++QE  F  W+N          NT ++K     +    N P  I                          A  L  SE  V AI ++  EV    L  + D   +K     + +   +++YN  WL     + ++  F   + L SNN+      FI  ++LWN DIA + R   +    +     +L+   L++ L +V  LD AK++ I   D  LF  D+  K+S ++L  F+  FL GEG + +      L VSH+Q  +DE+DF V NL+ D+  G+RL R+ ++   +  +  KLR PA+   +K  N+++A++  +D G  +    G  ID   I  GHREK++ LLW ++    +D ++D +KL  EI   +                     P    +  S   L +   WV +VC  YN+   N + +  DGR  C L+H+Y P +L L  I+ +TT T                              D + LLENE+RNF++  + +  +GG P +I P +  N IP+ + +   L+F  +RL+DL    RAA  IQ  WRKYR                     + RR L  K   ++K+++      VKR+L R R  +++ SAI++Q  +R +L R      R EK++    SA +V+Q+ +RRYL  K + ++    ++IQ  +R  +  + ++R+R +    Q+  K  L     R++++ L  A + +Q +FR +    + RRN                  T Q  AA+ IQS+YR  VC R Y  + ++ +IIQ               K+ H              L +R LE R  + +IIQ++ R        R  +LK K A   L+  + GY+ RK+      + I++Q   RM   R  FL         +   +RY A       K E+VA + + + +Q   R  ++RR+ + L  AA +IQ  FR YSV+ +F ++  +A+V+Q   R+ +  +N    YLK +++++ +Q   +G  V++  K+      + Q+  + ++ ++ Y+ +R++TI++Q+H+RA                              R+  ++ ++ + V+Q Y +M++ R  F   +   + IQ+  RA +    QR  Y++ K++ + IQ  FR  K + ++   ++AATV+Q                                     KY             F+    ++Q R+M+ +  +IQ++      RK++ +     + +Q + R  +     ++RYQ  +AA++TI    +G   RK+    R S  +IQ  FR +  R  F++ K +A+VIQ+    +L G   R+ +     +  VIQ   RG   R  +   H +A +I+  +R ++    F   R AA VIQ+++R   +R    Q+Y   +     IQ   R + A Q+ K M +AAT IQ+  + +  RK++V+ R +A++IQ   + +++ K                    MR+ Y  K  AA  IQ   RG   R++++ E+KA  +IQ   R H  R+     + AA  +Q+  R   +    + N    R   I +Q   +G  AR+ + ++RS++  +Q  FR   A K++L LK+A + +Q   R       Q +LY   R+A++ +Q   RG+  R   +RQ  AA ++Q  FR     RR  ++ +A R    IIQ  YR Y      R  FL  +N+ ++IQ  F+   ++KK     +    IQ   R +  R  F+RL  +  ++Q+  R          KY++ K+A   +Q +FR                         + + F   ++A+++IQ  FR + +R +F+K + + + IQ + R      K +     I+ A +++Q   RG+  R +  K  +  V IQ  +R    R  FL+++ +++ +Q+ YRM  + + +                 Q M+          +S+ VIQ   R  + RK+FL+ K + I IQ F++  + ++ +Q                                                 R     + +Q+  +G L + K+   R A + IQ   +G+  R+  K+ + +V+ LQR      RG   R  F K+K A++ +    RG L R   ++  Q  ++                       +A E+ RK++ + I IQ + R  IQ++RY   +   + +Q+  R  + +  R++ +IQR  R      R+ R       L A   GH   ++ +  +     RRF K N++          +KE +    K                +L  L  LE  T LS E C+ L++S A  ++  L+  CNR V  +EV+S  I V  NL K       V G E  ++ +  LL  YR     K   KG +IF  TC LL +L+   Q++
Sbjct:  726 DERWMEKQERGFTMWMNYALTPDEFKVNTEVTKVNAMSLAFQSNQPFNISKAPTKEEVSFRTYTARRRLNRLRQAACLLFTSESMVKAIRRLELEVEARRLLVRRDRHLWKDIGQRQKVLNWLLSYNPLWL----RIGLETIFGEMIPLESNNDVMGLAMFILRRLLWNPDIAAEFRHPKVPHLYRDGHEDALSSFTLKKLLLLVCFLDKAKESKIIEHDPCLFCMDAEFKTSKDLLLAFSRDFLSGEGILPRHLGYMGLPVSHVQMPLDEFDFAVKNLAVDLRCGIRLVRVMELFTQSWSLSQKLRVPAISRLQKVHNVDIALQVLRDRGVDLKDEHGGAIDSRDIVDGHREKSITLLWKIIFAFQVDVLLDEEKLKEEISFLQRMWRSKQELAAWKQHRNVVPKPQQAKSEESAAKLTLLMHWVNAVCAFYNLKAENFTVSFSDGRLLCYLLHHYHPCHLPLEAISQSTTQTVECDQRGRVGLNCSFSDSDSSLNNGPGTSLDYKELLENERRNFELLHAAVTSLGGIPAMITPTDMSNTIPNEKVVTCYLSFLCARLLDLRAESRAAWVIQGTWRKYRL-------------------KMQRRLLKEKNIAAVKIQV-----AVKRFLLRRREERLQASAIVLQAAWRGHLVRQEIRQQRMEKLRILQDSAAIVIQAEWRRYLAVKRFQRLRHHAVVIQARVRMKVAVTAFRRLRWAVMTFQQRRKASLLAKEHRQRYLSLRNAAITVQKSFRKWKVLSSIRRNNAAVVIQTAFRKWLTQKRTCQAAAALRIQSWYRMLVCCRRYAKVLQNAVIIQAWYRGFKERKIYQILKLQHSRAAIIQRTFKAFALRRRFLEVR-HATLIIQRWYRACKQKQRERLQYLKMKVAAVTLQAAYRGYVARKEKRVQHKAAIVIQAAFRMSLTRKRFL---LLRRAARDIQRRYRAKLLGEKQKMEYVALRHSAVKLQALWRGRVERRRIERLHKAAALIQSHFRRYSVQLQFRLKRRAALVLQDKFRAYVFGRNVRQQYLKKREAIITLQAGFRGMKVRQEMKEKHRAASLIQATFKAFIYKRNYMLLRRATIVVQQHYRAHLLGQHQRRQYNRLRQAAVKLQASYRRCKVRRDLMHKQRASAVIQAYFRMYKARMSFNAARFAAVIIQRRYRAWMEGRCQREWYLRRKESALVIQSSFRGLKARLKVKEMHKAATVIQACYRRHKRVTQFNKLRWAASVIGQRFKATQLKNAQVRKYEAMKNAAVRIQSAFRGMKTRQQVREMQNAARIIQRHYAAYSMRKRYLQVKAAAVKIQRQYRAHLAARLQQQRYQSLVAASVTIQAAYRGMKVRKELQRMRRSATLIQAYFRMYRKRMPFIAAKLAAVVIQRQYRCHLEGKRVREDFLKLQHSAVVIQAAFRGKRARCEIRRMHSAALVIEGCFRMWQCYTQFQKMRWAARVIQERYRASRMRNLLMQEYRVKKTSANIIQLAFRNYKARQQIKTMHRAATSIQRSFRTFRTRKRFVSLRAAAIVIQLRYKAFMAAKR-------------------MRAEYLAKHNAAMTIQAAFRGVKARRQLLRERKAATVIQVAVRRHQARTFHRKLQWAADVVQRRYRANKLMVKEKHNLALKRQAAICIQGAFRGMKARQRFMRVRSAACTLQTAFRARAARKQYLSLKSAVLAMQLQYRAVAAGRRQRELYLHVRSAAVTLQAAYRGWRTRQMIRRQHAAATLIQSLFRG----RREAIKYQAMRLSTLIIQQHYRSYLQSKRERERFLQLRNAAISIQAAFRRRRVQKKLARWHRAATLIQATFRMHQQRVVFVRLHWAATVLQRRLRAQKLRDVQLEKYMRMKRAATCLQASFRAVKARRLAKKKRAARAIQSFLQMSVDRRRFLRCRSAAVVIQSAFRGHYIRNQFRKMQTSSLLIQRWYRSCRTTQKLRADYLSIRQAAVMLQSAYRGLLAR-RTAKCERSAVKIQSVMRMLPYRKSFLHLRSNVVKLQASYRMCMDRRRFLSYRMAAVTLQRRFRARQEMRAQKEVYLKTLKSVQVIQAQLRGHVERKKFLKCKKSAITIQAFYQGMVQRKYFQQQKASATKIQEFYRAYTLGRKDRERYMQMRKSAVLIQAAYRGHQGRQLARRRQAAVKIQAWFKGSLTRRKFSAQRNAAVAIQSAYRGHVQRRDLKLRRAAVLVLQRRFQALQRGKAERDAFRKMKMATLTLQAFGRGWLARRRMKQEAQARRVKCFSAAAYHHLCAIKIQRAVRAHWALESARKQMSSVICIQKWLRTRIQRKRYLEDREKLIKLQRTVRIWLSRRHRASTIIQRAVRKFLTKRREQRVQHGIIKLQALWRGHRSRQLHDTSKVAAMRRRFRKINSM----------VKEEDKLCNKTSTAIDYLLRYKHFSYILAALKHLETSTRLSPECCEHLVKSGATFVIFTLIRSCNRSVPCMEVISYAIQVLLNLSKYDKTTEAVYGVENSVETLLELLQIYREKAGDKVADKGGSIFTKTCFLLTILLHDRQRA 3198          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Match: W4Y9U0 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 655.596 bits (1690), Expect = 0.000e+0
Identity = 585/2301 (25.42%), Postives = 1041/2301 (45.24%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTHLSKTKVEDINKNMPIYIEATKLLL-------------------------------SECKV--------AIEKINSEVTKDSLKFKDDIFFKSGKH-HRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEACFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF--------------------------ENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTL-------------TSANLFD----------------KEILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMK------------------------KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQ----NNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLR----SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKM---------------------------RNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA-LIQR---RKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKH---------------------------TKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQ-FLNF---RKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILN----NQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNI---------------------------RGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYI----RQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL-----AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQK-----NAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFN----AHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRK-----------YLIIRRIDLEQKA----------------ARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGY--FTHRKYVKQKK--AVINIQKNFR----RFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKM---------------------------IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRM----HYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLK----YQKMRTATILIQKTVKGYFIR----KH------------------YKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLV-----RNHFQKNKQHM-------KIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKR-----------SAVVIQRIWRG-------RQLRCHL 6384
            D+ W+++Q+  F  WLN +    +   K  D NKN  + I+A  L L                                 C V         ++K+ +EV K  +  + D    +     ++L  LI+ YN  WL +              L ++     +F+  ++L N DIA  H    + +   P +  +L +  L++FL +V+ LD AK   +   D  LF KD+ VKSS ++L EF+  +LKGEG+I +  S    SV+H+Q  +DE+DF V+ LS D+  GVRLAR+ ++L  N  +  +LR PA+   +K  N+E A K  K+ G   +   G  ++   I  GHREKTL LLW ++  + +  +++ + +  EI                             + P          LL+ W K+VC  Y++ + N + +  DGR  CLLIH+Y P  L    IN +TTL             +S N FD                +E LL NE+ NF++ + K+ ++GG P+++      N IP  + ++  +++  +RL+DL    RAA  IQ  WR +      K   +   K    +QS +R FL  ++ +     ++  Q+ ++ +LA+    +++                        K+A  IQ  +R Y  R  Y + +SAT++LQ+H+RR+   + + K+  +++ +Q    + ++G   R+ Y  +R +  ++QK  +G L R+  V+  ++ V IQ+AFRG+ +R +Y     +AV IQ+  +    RR Y  LR++ +++Q     VL  RK+ +       + I IQ  +R +  R+ F++ K  +  L+     YL +K + ++                           R + I +Q   R    R  F+  +++ II+Q + + Y A K +   + A +++QT+ RA L+ R   RK+   R AAI IQ   RCY  R++F+    + +V+Q  VR  + QKNY +I+Q+ +V+Q                              KG+L +  + +     I  QS VR  L +++Y+K++++T+I+Q+ FRA+   KQ  L++   R   I +Q   + +  ++++ + ++ VIT+Q + R  L R+ + + + A I +QR+FR+    +Q+  +      AA  +Q  F+ ++ +  + K + +V  +Q   R+ + R+Q+ +     I+LQ++ R             A + + +  + Y A+      R SVI+ Q  +R  + RK+FL  K +A++IQ   RG+++ + Y     A++ +Q                              RG+  RK LN+   +A  IQ  ++    RK +   + A  V+Q + R H +    R+ + +T+  +I IQSL R +   ++  +  +AAT +Q   K +I R +Y+  +++ +++Q   R  L       +  +I        +   R   +R++L     AA LIQ   R +  R+  V  + A  ++Q  +RA  + S  IC K      AAI LQ   RG+L RK          L+Q+  +GF+ ++ Y  +  + +++Q  +R         K++  ++ A+I +Q   R + Q K+     +++  IQ   RGF+ R +Y +   AA +LQ+HFR            Y+++  I   Q A                A  IQ  +RGY  R  +    N+ + +Q  F+A  +    R  Y+  R   I IQ   R    R  F+  K S + IQ + RGY  F H K  +Q++  A   IQK +R    R  +++ +   + A+I IQ   R +++R+  +K+ +   +IQ + R +  +  +K                            +K AT+ +Q   RG+ +R +          I+  +R  I R R+L++KK+ + +Q  +R       E   Y + + +   +Q   R F+ RK          IIQ  +R F  ++ Y +   +II +Q+ +R  L   K    Y  M++A +++Q   +G   R    KH                  Y   + S I++Q   R +L ++ + K+ +A  ++ KH RG L      R++ QK    +       +  A+    K  +A+I +Q+++R  +Q+RRY  ++   L+IQ+R+R  +L R           +A+ +Q ++RG       R +RCH+
Sbjct:  798 DERWMEKQDRAFTCWLNYVLTPDIDTPK--DPNKN--VKIDAHLLCLEGASKVGPAPSREDISLRAYTARRRLNRLRRGACMVFQSEPVIRVMQKLEAEVEKGRIVVRSDKMLHADLGIKQELLNLILCYNPLWLRIG-------------LESDVCGMSRFVVTRLLGNPDIAAAHAHPTVPNLFGPGYQAALAQFTLKKFLMLVFFLDRAKLTRLIDHDPCLFCKDAQVKSSRDVLLEFSRRYLKGEGDITRHLSFLGYSVTHVQRPLDEFDFAVNKLSVDLRCGVRLARVVELLTQNWTLSRELRVPAISRLQKIHNVESAFKMLKERG---INVEGGGLNERVIVDGHREKTLELLWRIIFHYQVGVMLNDEHIREEIAFLTKNRKLKEKISALKEGGNQGPSHPSLDGPHLYFKSPQLMLLMDWCKAVCSFYDLQIENFTVSFCDGRALCLLIHHYHPSLLPYERINQDTTLMQFQREEREDDLNSSCNSFDGTWSHTFSPSTGKETNQEKLLANERMNFKLLYEKVNELGGVPMMVRSADMSNTIPDEKVVITYVSYLCARLLDLRQETRAARTIQLAWRAHHLRKEQKMRLV-REKAASKIQSALRAFLLKRRGERFGGAVLTIQTAIRGFLAKQTAKRLRQELAIRKQAQAATVIQVRRMIEQMKAARTIQSVWRGYHARQMYLRQQSATIILQTHYRRHCAVEGFRKLRGTVIKMQALYRSKVKGEAQRAKYCALRDAAVVMQKVYRGRLGRRD-VRRIRSAVTIQAAFRGHQQRASYMRLKNSAVRIQAHVKGVQSRRRYTQLRQAAVVLQTRYRGVLLGRKVCRDYNVTRGATITIQSAVRCYQERQRFIQTKQNIITLQSAVRRYLAQKNYRQLQQATKVMQTRYRAVLLGRRVYREYNISRGAAITIQSAARCFQERRRFIQTKQNVIILQSAIRGYLALKNYRQVRQAAVVMQTRYRAVLLGRQVCRKYNIQRGAAITIQSGARCYQERQRFIQTKRNIVVLQSAVRGYLAQKNYRQIRQAAVVLQTRYREVLLGRRLRSDYCIAKGAAITLQATWKGYLARTEFLQKKSAAIKLQSAVRCRLSRQRYMKLQEATVILQRRFRAVLQTKQAILDYCYTRGAIITLQAAFRGYLQKREYQRTRAAVITLQSSTRCYLARKDFTQKRSATILLQRRFRALVTGRQLHADYRCLRAAAITMQASFRCHVQRTWYLKQRSAVVAVQAEVRKRLARRQYLQLRSAAIVLQTRFR-------------ARMLMLQLTQDYKAK------RSSVILFQALYRGQVQRKIFLRQKSAAVIIQARTRGYLQHRSYMRVQQAVRTLQTRFRASMMGRACLEEYYLARGRIITIQALYRGYAARKMLNAQQAAAVTIQANFKCLIARKRYSSLKQAVSVLQTRLRAHILARKTRESFQKTKAGIIAIQSLYRGYAQRKELSRQHQAATLVQSSFKRFIARSRYLQLQQATLVLQTRYRS-LQLGRAVCRDYNIKRRAAITLQAAYRGCSQRQVLAKQRRAAVLIQAAVRAHQKRRLYVSLRNAAMVVQKRFRAQLL-SKRICMKYNIMRGAAITLQAAYRGHLQRKALARQYLAATLIQATFRGFVTKRWYSSVCKAVVVLQTRYRAHKLAQAVQKEYQIMRVAAITLQAAYRGHYQRKVLTLQHSSATKIQALFRGFVRRKRYLQVCHAARVLQKHFRALRLGKEVQQEYYMMVGAIVTVQAAFRGLVARRALHRHHEMATKIQACFRGYVQRIQYQKIANAALVLQRRFRALRLGQRTRGDYVFQRSSAIKIQAFYRCQRERKAFVTKKQSAVRIQAMIRGYLGFVHAKRFRQERTVAATAIQKQWRANALRDQQVRCYNIQRGAAITIQAAARTFLVRQSIQKQHRAATRIQCFYRCHRAVKSYKKTLDAIHVLQDQWRAHLLAKKFQEEYANLKKATITVQAVYRGLCIRRRIALEHAAATKIEATVRQFIARKRYLSLKKAAVVLQRRFRASKSCQVETLKYHITRGACITLQAAVRGFLTRKALKNSNRAATIIQSAYRSFRQQQKYNQERMVIILLQTRIRAYLVGKKVCRDYSAMKSAAVVVQSVYRGLMARRLAAKHRAARSIQSMFRMHLSRQMYLKQRSSAIKIQAICRMYLAKRFYKKVYSAVCVLQKHTRGYLEAKKTRRDYLQKKSSAIIIQSHFRRCIAERRYSKHRQAAICVQSHYRQMVQRRRYQTIRGAALVIQRRYRATILARVTQKEYHMARGAAITLQAVFRGYMQCCRYRNMRCHV 3055          

HSP 2 Score: 467.618 bits (1202), Expect = 1.053e-128
Identity = 455/1799 (25.29%), Postives = 847/1799 (47.08%), Query Frame = 1
Query: 2101 VIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIR----YEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQ-KYVKGYLAR---KKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLR-MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQK----NYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA----ISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS------CKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRH-SVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTT----AIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQ----QYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL-----AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA----HTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL---------------------------RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRY---CQMKLYRDTRN-ASIVIQKYVRGFLCRIK----YQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTI------------------RAHFLCQK---------NSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHR----KYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISK----FKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFI----ARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQK----TVKGYFIRKHYKILQKSVIQLQRFIRGFL-------IRKIFLKL-------------------KNASIIISKHVRGVLVRNHFQKNKQH----MKIFAQEN---------------------LRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRW-RFIVLK------------------------RSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESEL-------TVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE--FIKLVKNL-LYRNINSKRGTKGITIFCHTCLLLVLLIK 6858
             I +QS VR +   ++F   K  II  QS V+RYLA+    +++++  ++Q  YR  L   R    Y   + A + +QS  R +  ++ +++  ++++I+Q+ IRGYL   NY+++R++  ++Q +Y    L R   +K+     A + IQS  R Y +R+ +    +  V++QS  R  + ++ Y  +R++ +++Q    +VL  R+L         + I +Q   +G++ R  FL+ KSA   L+      L R++++K++ + ++LQ+  R +L  + + L                    ++   + A I +Q   R  +Q+R++Q  R A I +Q + RCY  RK F  +  + I++Q+  R+++  +    +Y  ++ + + +Q   +  + +  Y K    ++  Q+ VRK L ++QYL++R + I++Q  FRA    +   + +   R   I+ Q   +    R+ FL+ KS  + IQ   R  LQ R Y++ ++AV  +Q +FR+      C E  +  L       +Q  ++ Y  +K     + +   IQ   + LI RK++    + V +LQ+++R  I    T++ +QK  A  + I    +GY A++K LS +H +  ++Q+SF+ F+ R  +L ++ + +V+Q   R     +  C        A   +Q   RG   R+ L    ++A LIQ   R+++ R+ ++  RNAA+V+QK+FR   + +    +YN  R   I +Q+  R  +  +   +   AAT IQ   +G++ ++ Y +  ++ V++Q   R +   ++ Q +   + +    ++    R  Y+RK+L     +AT IQ + RG++ RKR +    A R++Q  +RA      ++  +     A + +Q   RG + R+           +Q+  +G++ R  YQK+                           RSS+I +Q  +R     K F+  K +++ IQ  +R Y      K +R  R  A+  IQK  R    R +    Y  Q  AAI +Q   R +L+ + I  + +AA  IQ FYR +                    RAH L +K          + +T+Q  ++   IR++          I+  VR++I+R R+L LK + +++Q+  R   + +    KY   + A I +Q   R F   K  +N   A+ IIQ  +R +  ++++ ++R   + +Q+ IR Y+   K    +  +KSA +++Q   RG+  R    K  +    IQ   R ++ R  +L  + S I IQ+  RM+   + Y+ +  ++ V+QK+ R ++     R+ +L+ KS+ IIIQ  FRR +A+R Y ++    I VQS  R  + + +YQ +R A ++IQ+    T+     +K Y + + + I LQ   RG++       +R   +K+                   K A++ I +HVRG   R H +  +Q     ++ FA                         +++++A   +Q + R  + + R+  L++  L++Q+   R++V K                         +A+ +Q +WRG ++RC + +KK+    S  R R   ANR  ++        +K L +   + L       ++ ++L  L SLE V+ LS   C+ L+E+ A  +L  L+  CNR V  +E++  ++ +  N+ K       V+ +E   I L+  L +YR  N+        IFC TC++L  L++
Sbjct: 1619 TITIQSAVRCYQERQRFIQTKQNIITLQSAVRRYLAQKNYRQLQQATKVMQTRYRAVLLGRRVYREYNISRGAAITIQSAARCFQERRRFIQTKQNVIILQSAIRGYLALKNYRQVRQAAVVMQTRYRAVLLGRQVCRKYNIQRGAAITIQSGARCYQERQRFIQTKRNIVVLQSAVRGYLAQKNYRQIRQAAVVLQTRYREVLLGRRLRSDYCIAKGAAITLQATWKGYLARTEFLQKKSAAIKLQSAVRCRLSRQRYMKLQEATVILQRRFRAVLQTKQAIL--------------------DYCYTRGAIITLQAAFRGYLQKREYQRTRAAVITLQSSTRCYLARKDFTQKRSATILLQRRFRALVTGRQLHADYRCLRAAAITMQASFRCHVQRTWYLKQRSAVVAVQAEVRKRLARRQYLQLRSAAIVLQTRFRARMLMLQLTQDYKAKRSSVILFQALYRGQVQRKIFLRQKSAAVIIQARTRGYLQHRSYMRVQQAVRTLQTRFRASMMGRACLE--EYYLARGRIITIQALYRGYAARKMLNAQQAAAVTIQANFKCLIARKRYSSLKQAVSVLQTRLRAHILARKTRESFQKTKAGIIAIQSLYRGY-AQRKELSRQHQAATLVQSSFKRFIARSRYLQLQQATLVLQTRYRSLQLGRAVCRDYNIKRRAAITLQAAYRGCSQRQVLAKQRRAAVLIQAAVRAHQKRRLYVSLRNAAMVVQKRFRAQLLSKRICMKYNIMRGAAITLQAAYRGHLQRKALARQYLAATLIQATFRGFVTKRWYSSVCKAVVVLQTRYRAHKLAQAVQKEYQIMRVAAITLQ-AAYRGHYQRKVLTLQHSSATKIQALFRGFVRRKRYLQVCHAARVLQKHFRALRLGKEVQQEYYMMVGAIVTVQAAFRGLVARRALHRHHEMATKIQACFRGYVQRIQYQKIANAALVLQRRFRALRLGQRTRGDYVFQRSSAIKIQAFYRCQRERKAFVTKKQSAVRIQAMIRGYLGFVHAKRFRQERTVAATAIQKQWRANALRDQQVRCYNIQRGAAITIQAAARTFLVRQSIQKQHRAATRIQCFYRCHRAVKSYKKTLDAIHVLQDQWRAHLLAKKFQEEYANLKKATITVQAVYRGLCIRRRIALEHAAATKIEATVRQFIARKRYLSLKKAAVVLQRRFRASKSCQVETLKYHITRGACITLQAAVRGFLTRKALKNSNRAATIIQSAYRSFRQQQKYNQERMVIILLQTRIRAYLVGKKVCRDYSAMKSAAVVVQSVYRGLMARRLAAKH-RAARSIQSMFRMHLSRQMYLKQRSSAIKIQAICRMYLAKRFYKKVYSAVCVLQKHTRGYLEAKKTRRDYLQKKSSAIIIQSHFRRCIAERRYSKHRQAAICVQSHYRQMVQRRRYQTIRGAALVIQRRYRATILARVTQKEYHMARGAAITLQAVFRGYMQCCRYRNMRCHVVKMQARARGAMARRCFANMVREKEAAMCIQRHVRGYQTRKHLKAQRQARLKTLQAFADRTKAHLSVIRLQRAFRNFRLRMAFKQKMDAITTLQNWMRAKLLRLRFQKLRAAALVLQRAAKRYLVRKNVAATRLQSVARVWLAKRRVQKMHSAALRMQALWRGHRVRCSIKSKKV----SAARARCQRANRNVTE--------EKKLCNRTATALDYLLHYRSMHRILETLISLEVVSRLSAICCQRLVEAGAVPVLYALVRGCNRSVPCMEMIEIIVKILLNITKHDSTQHAVLDAEEAVITLLDLLQIYREKNA-------LIFCKTCVILGKLLQ 3373          

HSP 3 Score: 405.216 bits (1040), Expect = 1.462e-109
Identity = 397/1526 (26.02%), Postives = 728/1526 (47.71%), Query Frame = 1
Query: 1999 LMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLC----RIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKK----FVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLR----SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLR----MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAA---------------------------IIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXC----QSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQ-------------------------C--RQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILN----NQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRM----IITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIV-IQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF-IKRKI---YCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL--------AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTET----RNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVR--RYCQMKL--YRDTRNASIVIQKYVRGFLCR-----------------------IKYQRQLLAAIILQRHFRKYLIIRRI----DLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYF----THRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRY-------ICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNI---KKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVR 6144
            + T YRA    ++V RKY                 I +QS  R +   ++F   K  I++ QS V+ YLA+    +++++A+++Q  YR  L     R  Y   K A + LQ+ ++ YL +  +L+   + + +Q+ +R  L R  Y +++++T I+Q+  +  L  K+    +     AI+ +Q+AFRGY ++R Y     A + +QS  R  + R+ +   R + I++Q+    ++  R+L    R    + I +Q   R  + R  +LK +SAV  ++      L R+Q+L++R++ I+LQ   R    ML L   +  K+ S I+ Q  ++    +K F+ +KSA ++IQ + R  +Q R +  ++ A                            I IQ  +R Y+ RK    Q  +A+ IQ N + +I +K Y  +KQ+V V+Q   +  ++ +  ++   +        QSL R Y  +K+  +  ++  ++Q  F+   AR ++L  ++ T+V+Q   +  Q                         C  RQ   K +   + IQ  +RA  +RR Y+  + A + +Q++FR+    K+I +       AA  +Q  ++ ++ +K   +   + T+IQ   R  + ++ +    K V++LQ++ R        +K YQ    A +T+    +G++ RK  L+ +HS    IQ  FR F+ RK +L +  +A V+QK+ R   + +++   Y     AI  +Q   RG + R+ L+ HH+ AT IQ  +R Y  R  +    NAA+V+Q++FR   + Q+   TR   +F +S     I IQ + + ++              RK +VT+++SAV IQ  +R YL     +  +    +    +++    +  + + +        AA  IQ  AR +LVR+ I  + +A   IQ FYR H     +    +A   LQ   R +L+ K F E     +   I VQ++ +G   R+      +++  ++   R F A K++L LK A++ +Q+  R  + CQ++   Y  TR A I +Q  VRGFL R                        KY ++ +  I+LQ   R YL+ +++       + AA ++Q+ YRG   R     +  +  +IQ+ F+ +L R+ YL+ R   I IQ + R Y+++  + ++  +V ++QK TRGY     T R Y+++K + I IQ +FRR    + +   + A+I +Q ++R  + R+ ++  R   + IQ   RRY       +   ++ M + A + +Q   RG     +Y+ +   VV +Q   R  + R  F N+   K++ + IQ   R +   K+ +  +Q+     K  + F  R +      ++I +Q+ FR F  + ++++ +  I  +Q+ +R KL +L++QK+R A +++Q+  K Y +RK+      +  +LQ   R +L ++   K+ +A++ +    RG  VR
Sbjct: 1741 MQTRYRAVLLGRQVCRKYNI----------QRGAAITIQSGARCYQERQRFIQTKRNIVVLQSAVRGYLAQKNYRQIRQAAVVLQTRYREVLLGRRLRSDYCIAKGAAITLQATWKGYLARTEFLQKKSAAIKLQSAVRCRLSRQRYMKLQEATVILQRRFRAVLQTKQAILDYCYTRGAIITLQAAFRGYLQKREYQRTRAAVITLQSSTRCYLARKDFTQKRSATILLQRRFRALVTGRQLHADYRCLRAAAITMQASFRCHVQRTWYLKQRSAVVAVQAEVRKRLARRQYLQLRSAAIVLQTRFRARMLMLQLTQDYKAKRSSVILFQALYRGQVQRKIFLRQKSAAVIIQARTRGYLQHRSYMRVQQAVRTLQTRFRASMMGRACLEEYYLARGRIITIQALYRGYAARKMLNAQQAAAVTIQANFKCLIARKRYSSLKQAVSVLQTRLRAHILARKTRESFQKTKAGIIAIQSLYRGYAQRKELSRQHQAATLVQSSFKRFIARSRYLQLQQATLVLQTRYRSLQLGRAVCRDYNIKRRAAITLQAAYRGCSQRQVLAKQRRAAVLIQAAVRAHQKRRLYVSLRNAAMVVQKRFRAQLLSKRICMKYNIMRGAAITLQAAYRGHLQRKALARQYLAATLIQATFRGFVTKRWYSSVCKAVVVLQTRYRAHKLAQAVQKEYQIMRVAAITLQAAYRGHYQRK-VLTLQHSSATKIQALFRGFVRRKRYLQVCHAARVLQKHFRALRLGKEVQQEYYMMVGAIVTVQAAFRGLVARRALHRHHEMATKIQACFRGYVQRIQYQKIANAALVLQRRFRALRLGQR---TRGDYVFQRS---SAIKIQAFYRCQRE-------------RKAFVTKKQSAVRIQAMIRGYLGFVHAKRFRQERTVAATAIQKQWRANALRDQQVRCYNIQRGAAITIQAAARTFLVRQSIQKQHRAATRIQCFYRCHRAVKSYKKTLDAIHVLQDQWRAHLLAKKFQEEYANLKKATITVQAVYRGLCIRRRIALEHAAATKIEATVRQFIARKRYLSLKKAAVVLQRRFRASKSCQVETLKYHITRGACITLQAAVRGFLTRKALKNSNRAATIIQSAYRSFRQQQKYNQERMVIILLQTRIRAYLVGKKVCRDYSAMKSAAVVVQSVYRGLMAR-RLAAKHRAARSIQSMFRMHLSRQMYLKQRSSAIKIQAICRMYLAKRFYKKVYSAVCVLQKHTRGYLEAKKTRRDYLQKKSSAIIIQSHFRRCIAERRYSKHRQAAICVQSHYRQMVQRRRYQTIRGAALVIQ---RRYRATILARVTQKEYHMARGAAITLQAVFRGYMQCCRYRNMRCHVVKMQARARGAMARRCFANMVREKEAAMCIQRHVRGYQTRKHLKAQRQARL---KTLQAFADRTK---AHLSVIRLQRAFRNFRLRMAFKQKMDAITTLQNWMRAKLLRLRFQKLRAAALVLQRAAKRYLVRKNV-----AATRLQSVARVWLAKRRVQKMHSAALRMQALWRGHRVR 3221          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Match: A0A3B4C7U1 (Abnormal spindle microtubule assembly OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 636/2509 (25.35%), Postives = 1105/2509 (44.04%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCI-------------------FNTHLSKTKVEDINKNMPIYIEATKLLLSECKV--------AIEKINSEV-TKDSLKFKDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILV-NIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE------------------------NPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT-SANLFDK-----------------EILLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKY-----------------------RTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIK-------------------------------MRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYL--------KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYL----ARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS----CIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKN----YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEK----KQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMII----TKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQ------------------------------------SLIRQFIAIQK--------------YKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL----AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFI--------CQK-------------------NAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL---------------------------RSSSIIVQKIFRGFNAHKKFLKLKN-ASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL----AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYL----IRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTH----------RKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISK----FKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMK---------------------------QSITVIQKNCRKFIARKRFLEIKSNIIIIQK----------------------FFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKL--------KNASIIISKHVRGVLVRNHFQKNK-----------QHM----------KIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKR--SAVVIQR-----------------------IWRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGK-----AGVLNFDVIGSEFIKLVKNLLYRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSIS 6879
            D+ WL++QE  F  W+N +                   FN   + TK E   K         +L  + C++        AI+++  EV  K  L  KD   +K     + L   +++YN  WL     + ++  F   + L SN++      F+  ++LWN DIA + R   +    +   + +L+R  L++ L +V  LD AK++ +   D  LF  D+  K + ++L  F   FL GEG + +  +   L VSH+QT + E+ F V NL+ D+  G+RL R+ ++   +  + SKLR PA+   +K  N+++A++  K+ G ++    G  ID   I  GHREKTL LLW ++    ++ ++D  +L  EI   +                        +P          LL+ WV +VC  YN+   N++ +  DGR  C LIH+Y P YL    I+  TT T   +L  K                 E LLENEK NFQ+    +  +GG P ++  E   N IP+ + +   L+F  +RL+DL    RAA  IQ  WR+Y                       R+F + K     H +    +Q+  R F   K+ + +K                                  +I Q+  + +LAR +I++   +A+ IQ  YR   C+ +Y  IKS  + +Q+ FR      NYL        K ++S ++IQ+  R  L R   +R+R+S  IIQ++ +  L     R++++++  A V +Q+AFRG+  R     + +AA++IQ+ YR  V +R +L+L++SV+I+Q+     +F  KL K  ++     +  Q   RG   R+   +      +++ ++  Y+ ++QF+ ++++ +++Q+  +   +                       + +F+A K A  +IQ+  R +  R +      AA +IQK  R +  RK+FL Q  +A++IQ++ R+ I +++    Y++++Q+ + +Q   +G  V++  KK      + Q+  R Y  +  Y+  + + IIIQ+ +RA       R  +L  +   + +Q   +  + R+   K++    TIQ   R   QR +Y + K A   IQR+FR+ + K    KQ     +AA  +Q  ++    +++  K   + T+IQ Y R  +CRK+F  +    I++Q   R  I     +  Y +   AT+++    +G   R++    + +  VIQ  FR +  R  +L+ K +AI+IQ+  R  +     R  Y    TAI  IQ   RG  VR+ L     +AT IQ  +R +  R  +  ++ AA VIQ++FR    K+ + +QY   +K  + IQ                                    +L +  I IQ+              Y+ M+KAA  +Q   +G  +R+++  +  +A +IQ   R Y  R +FQ  + + +++Q+  R  L R   ++  L    +A +IQ + RG   R+ I     A  +IQ  Y A+  R  F+        CQ+                   NA I +Q   RG  +R+     R   I +QS  +  I+++ YQKL                           + +++++Q  FRG  A ++ LKLK+ A+I +Q   R +C    Y   + A+I IQ+  R  L   K ++  L    AAI LQ HFR   + R I  + +AA +IQ  +R +     +   + S + +Q ++++++     R+KYL +R+  I IQ   R Y  R     +  +  IIQ V R +             R   K+ KA   +Q   R   + + +   + A ++IQ  +R +  R ++ + R   V IQ + R    + K    FK ++ ATL +Q  +RG+F R +  K     V IQ  +R ++ R+ ++ ++   + +Q+FYRMH   + Y   +                           +S+  +Q + R FI  +RF ++K++ + IQ                       +FR   A+R +    + I F+   +R +L + +Y+ +R      +KT+     R  +  ++KS + +Q   RG+ +RK   K+          A++ I    RG L R                   H+            +A +  +K++ + + IQ +FR  + ++RY   +   +++Q+  +  +  R  +A VIQR                       +WRG   R   + KKI   IS IR+R  + NR   + + +      AL+ L   +   A +L  L  LE  T LS E C+ L+ES A   +  L+  CNR V  +E+++    V  NL K       V          + L++  +YR     K   KG +IF   C LLV+L++ +++++ 
Sbjct:  266 DERWLEKQERGFTWWMNYVLTPDDFKVTTEVAKGVLSKFNIPKAPTKEEMSFKTYTARRRLNRLRRAACQLFTSDSMVKAIQRLELEVEAKRLLVRKDRHLWKDIGERQKLLNWLLSYNPLWL----RIGLETIFGELIPLESNSDVMGLAMFVLGRLLWNPDIATEFRHPKVPHLYRDGHDEALSRFTLKKLLLLVCFLDKAKESRLIEHDPCLFCMDAEFKQTKDLLLAFARDFLSGEGILSRHLNLLGLPVSHVQTPLAEFSFAVQNLAVDLRCGIRLVRIMELFTQDWSLSSKLRMPAISRLQKVHNVDIALQVLKEKGVSLKDEHGTVIDSRDIVDGHREKTLNLLWKIIFTFQVEVLLDEVQLKDEISFLKKTWRTKQKLALLKADKCAVMSSKGSPRFEQPTEKLTLLMDWVNAVCDFYNLKAENLTVSFSDGRVLCYLIHHYHPNYLVAESIHQKTTQTIECDLRGKVELNNSSSDSDCSFDSLEQLLENEKSNFQLVNKAVSYLGGVPAMISPEDMSNTIPNEKVVTCYLSFLCARLLDLRNETRAARVIQSAWRRYKLQKDIQLNQQRNLAACKIQALVRSF-IQKRRVKRHNRAATTIQAFWRGFSAQKELRRLKEAKHFAIQNRAAVLIQKTYRGWRTRTFLKKNHACVIIQTAFRNWLAR-KIARRNAAALRIQTWYRMQRCQRQYMAIKSVAICIQAWFR-----GNYLRRRFQTLKKQHQSAVVIQSAFRASLVRKQIRRMRQSAVIIQRWYQACLQRNAERRRYLEIKSATVTLQAAFRGWKARTEMAQRHQAALMIQTAYRRFVAQRFFLSLKRSVVIVQQRYRAKVFGDKLRKEYQTLKHAAVKAQALWRGRAERKRINQLHQCATVIQSHYRRYVMQRQFVALKHAALVIQRRYKAFRVGKKI-------------------QSDFLAMKKAVTVIQSAYRGMKSRCELVKKHKAATLIQKFTRAFMCRKEFLAQKCAAVIIQQHYRAHILRRSERDCYVQLRQATVSLQAIYRGSRVRRELKKKQQAATVIQACFRMYKARMSYMATKCAAIIIQQRYRAHVYGKRTRASYLRMKTAIVTIQSGFRGMKVRRDLQKMRLAATTIQARFRGHSQRVKYRRQKWAACVIQRRFRAVQMKNAVEKQYTAMKKAALCIQSAYRGMRTRRELFKKHTAATLIQTYVRAFLCRKKFLAQKSAAIIIQQHYRAHILRCSERDCYVQLRQATVSLQAIYRGSRVRRELKKKQQAATVIQACFRMYKARMSYLATKCAAIIIQQRYRAHVYAKRTRASYLRMKTAIVTIQSGFRGMKVRRDLQKMRLAATTIQARFRGHSQRVKYRRQKWAAYVIQRRFRANKMKNAVEKQYTAMKKAALCIQSAYRGIRTRKQIAEMHMAARVIQQRYRVYKQYNNYQTLKQATIIIQRKYRVKLLGKHQRERYRTMQKAAISLQAAYRGMSVRREFQKRHEAATVIQAWYRMYRVRMAFQAMRLAAVLVQRQYRCHLKRKEARKSFLKLRHSAVVIQSVFRGNRTRREIAKLHSAAAVIQRRYMAYKERKSFLSIKTTVELCQRKWRAVLAARRERKVYLAKHNAVIAIQAACRGIKVRRQMRMEREAAITIQSHFRKLISKRYYQKLLWATRTVQQRFRARKLMKQDVESFKEKKRAAVVLQAAFRGMKA-RQALKLKHQAAIVLQSAYRAHCAQTRYLCMKYAAIAIQQRYRSMLAARKQRQDFLKLRYAAISLQAHFRGQKVRREIIQKHQAAMLIQASFRKHREVTKYQAMRLSAIILQRHYRSFVEAKVDREKYLMVRKSVILIQAAFRGYTVRRTVAEMNKAATIIQAVFRMHKQRSAFKRQGKQARDLTKRIKAARTVQSYLRMSIQRRRYLKTRAAIVLIQSAYRRHCCRIQYARMRNCAVLIQQWYRSCKLVQKQRNDFKAVQKATLTLQCALRGMFSR-RLAKRRHAAVKIQSVLRMHVHRSCYVKLRSCTVMLQAFYRMHTARRTYLRWQTAAVAVQTFYRAYRAKLEQRQRYLRTLESVRTLQAHVRGFIEYRRFQKMKASAVTIQAGFHAYQTRKLRGQTLAALKIQAWFRGCQARRDFISKQTAIAFIHRCLRTRLQRARYRSVRVIQRRWRKTLIARKQRADFLTIRKSAVDIQALWRGYRVRKSLQKVIKEHRRRRNAAAVTIQAFCRGWLTRQQEAARAVRRQRFIAAAYHHLCAVRIQRALRAHWALKAAKKQISSVVYIQRWFRAKLHRKRYLEQRQKIIMVQRAVKVWLGYRNQAATVIQRAAKCFLLRRRKERQRQGVIKLLALWRGHCSRKLHDTKKI---IS-IRHRLRKVNREAKEEDKLCNKTATALSYLLGYQ-NYAYILAALKHLETATRLSPECCEHLVESGATHTIFTLIRSCNRSVPSMEIITLATQVLLNLSKYNKTIEAVYEVPDSVDTLLDLLQ--IYREKAGDKVADKGGSIFTKACFLLVILVQDQERAMG 2735          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Match: ENSAMXT00000036226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:19209457:19235971:1 gene:ENSAMXG00000030872.1 transcript:ENSAMXT00000036226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.462 bits (672), Expect = 1.308e-70
Identity = 302/1204 (25.08%), Postives = 536/1204 (44.52%), Query Frame = 1
Query: 3610 NQAATVVQKYFKSYICKKQFRKMKESVTVIQK-YQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFI----KRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNE----TRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL----AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLI----RKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYIL----RKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMH----YEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSN----------------IIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLK-------YQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQR---------------------------FIRGFLIR------KIFLKLKNA-SIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQR----W----------------RFIV------LKRSAVVIQRIWRGRQLR-CHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSEFIKLVKNLL-----YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSI 6876
            N+   V ++++++Y  + ++R +K++  +IQ+ Y+ +L+ ++Q +K   +                 QK   A +T+    +G  ARK+    + +  +IQ  +R +  R  + ++K   IVIQ   R  +    +R+ YCS   A   +Q   RG  VRK      ++AT++Q +YR Y+++  F   R AA+++Q+++R H  R++  E     R   I +Q++ R     ++   +  AAT IQ+    Y  RKK+++ R + V  Q+  R  L+ +                        Y  K  AA  IQ   RG  VR+R+ +E+KA   IQ   R H  + ++     A   +Q+  R                    +MK  +  K  ++ R +++++Q  FRG  A     +   A+I IQ   R +C    Y   R A++ IQ+  R  L   K +   L    A+I LQ  FR     R I L+ +AA++IQ  +R +  R  +   + S + IQ +F+AY++    R++YL +R+  I IQ L R Y  R+   ++  +   IQ   R +  HR   K++ A++ IQ  +R       +  ++ ++++IQ+ +R   L    R EFK+ +K  + +Q  +RR + + +    + A + IQ  +     R +Y K+    V +Q   R   +R  +L  + + + +Q+FYR +     + + Y    +++  +Q + R FI  +RF ++K                   + IQ +FR   A+R Y    + +  +   ++ K  + +        QK R A +LIQ T +GY  R+ +K  + S + +QR                           F RG+L R      +  L LK+  +     H+  V ++   + +      +A +  +K++ + I +Q +F+   Q++RY L +   ++  QR    W                RF++      LK+  + +Q +WRG   R  H   K I      +R+RF + N    + + +      AL+ L   +   A +L  L  LE  T LS E C+ L+ S A + +  L+  CNR V  +E+++  I V  NL K      D +  E    V  LL     YR     K   KG +IF   C LLV+L++ E+++I
Sbjct:  170 NKTFHVSRQHYRAYKQRNEYRALKQATFLIQRRYRAKLLAKQQREKYCSM-----------------QK---AAITLQAAYRGMQARKRIAEMQLAAKIIQRKYRAYKQRNEYCALKQVTIVIQGRYRAKLLAKQQRQRYCSMQKAAITLQAAYRGMRVRKEAQKRQEAATVLQAWYRMYRVKMAFQAMRLAAVLVQRRYRCHLERKEARERFVKLRHSAIVVQAVFRGNRTRREIGNLHSAATVIQRKYLAYKERKKFLSVRDTVVHCQQKWRAVLASRQQL-------------------KAYLAKRSAAIAIQAAFRGMKVRRRVQIERKAAITIQAHVRMHKTKVYYQRLLWATKTVQRRYRA-----------------NQMMKEEM--KSLKQKRMATVVLQAAFRGMKARHTLKQKHKAAIVIQSAYRAHCAQTRYLCMRYAAVAIQQRYRATLAARKQREHFLQLRCASISLQACFRGQRARREIGLQHQAAKVIQASFRSHRERTKYQAMRVSAMIIQRHFRAYIVAKDNRERYLSLRKSAILIQTLFRGYSVRHHIAKMHKAATTIQAALRMH-KHRSAFKRQSAIVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVAM-RLATRRRAAIKIQSVLHMHVHRRRYLKLRSCAVMLQAQYRMCTMRRAYLKKQTAAVTVQTFYRAYRAKVEQRECYLRTLRNVRTLQAHVRGFIQHRRFQQMKEAGFRAYKTRKLAAQTRAALKIQAWFRGHQARRDYISKQTAVATIHRCLQTKFQRARCSVVRRSIQKERNAAVLIQSTFRGYRQRQAFKQKKASALLIQRRFRAVQLAKAEKERRRRRNAAAVTIQAFCRGWLTRQKVRFMRFGLTLKHRFTAAAYHHLCAVRIQRALRTH------WALKAAKKQISSVIYVQRWFKAKFQRKRY-LEQRQKIITAQRAVKAWLNHRNQAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRKLHDTTKVIS-----MRHRFRKVNSEAKEEDKLCNKTATALSYLLGYQ-NYAYILAALKHLETATRLSPECCERLVNSGATRTIFTLIRSCNRSVPSMEIITLAIQVLLNLSKYNK-TIDAV-YEVPDSVDTLLDLLQIYREKAGDKVADKGGSIFTKACFLLVILVQDERRAI 1298          

HSP 2 Score: 189.119 bits (479), Expect = 1.612e-47
Identity = 241/987 (24.42%), Postives = 436/987 (44.17%), Query Frame = 1
Query: 2143 KKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKN----YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGY---------------------------LARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRK-----LEKRLRSCIIIQKYIRGF-INRRNFLKFKSAVNILEH--------YFMGYL----------RRKQFLKM--------RNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALI----QRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLIC----------------------RKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFA----RKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKF----------------SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNI-------RGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNE--------------------TRKKVIF-----------------------IQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIR 4626
            +K+ S++   I  Q+  +   AR RI++M+ +A +IQ+ YR Y  R  Y  +K  T+V+Q  +R  L+ K     Y  + ++ + +Q   RG   R   ++ +++  ++Q + + Y                            AR++FVKL  + +V+Q+ FRG   RR       AA +IQ  Y +   R+ +L++R +V+  Q+    VL  R+     L KR  + I IQ   RG  + RR  ++ K+A+ I  H        Y+   L          R  Q +K         R + ++LQ   R +  R++   K K+AI+IQ +++ + A+  ++  + A + IQ + RA +    QR  F  LR A+I +Q  FR    R++  +Q+ +A VIQ + RS   +  Y  ++ S ++IQ+H + ++V K                     +++YL +RKS I+IQ  FR  S R       K    +Q  ++MH+ R  F K +S ++ IQ   R    R +Y + +K+ + IQ+ +RS K             +VQK+      + +F++++++   +Q+  RR++                       R+++ K     ++LQ++ RM   ++ Y KK  A +T+  F + Y A    R+ YL    +V  +Q   R F+  + F  +K                 +A+ IQ + RG   R+ Y S+ TA+  I + +       R  +VR+++     +A LIQ  +R Y+ R+ F  K+ +A++IQ++FR   + +   E                    TR+KV F                       IQ  +R   A++  K+   +  Y+Q+  K    RK+Y+ QR+  +  Q+ V+ +L+ ++                             AAT+IQ  A+ +L+R++    ++ +  +Q  +R H  R
Sbjct:  214 EKYCSMQKAAITLQAAYRGMQARKRIAEMQLAAKIIQRKYRAYKQRNEYCALKQVTIVIQGRYRAKLLAKQQRQRYCSMQKAAITLQAAYRGMRVRKEAQKRQEAATVLQAWYRMYRVKMAFQAMRLAAVLVQRRYRCHLERKEARERFVKLRHSAIVVQAVFRGNRTRREIGNLHSAATVIQRKYLAYKERKKFLSVRDTVVHCQQKWRAVLASRQQLKAYLAKR-SAAIAIQAAFRGMKVRRRVQIERKAAITIQAHVRMHKTKVYYQRLLWATKTVQRRYRANQMMKEEMKSLKQKRMATVVLQAAFRGMKARHTLKQKHKAAIVIQSAYRAHCAQTRYLCMRYAAVAIQQRYRATLAARKQREHFLQLRCASISLQACFRGQRARREIGLQHQAAKVIQASFRSHRERTKYQAMRVSAMIIQRHFRAYIVAKDN-------------------RERYLSLRKSAILIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAF-KRQSAIVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRK-------------LVQKH------RDEFKRIQKATLTLQRALRRMVAMRLATRRRAAIKIQSVLHMHVHRRRYLKLRSCAVMLQAQYRMCTMRRAYLKKQTAAVTVQTFYRAYRAKVEQRECYLRTLRNVRTLQAHVRGFIQHRRFQQMKEAGFRAYKTRKLAAQTRAALKIQAWFRGHQARRDYISKQTAVATIHRCLQTKFQRARCSVVRRSIQKERNAAVLIQSTFRGYRQRQAFKQKKASALLIQRRFRAVQLAKAEKERRRRRNAAAVTIQAFCRGWLTRQKVRFMRFGLTLKHRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHRNQ----------------------------AATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSR 1132          

HSP 3 Score: 188.734 bits (478), Expect = 1.847e-47
Identity = 236/1019 (23.16%), Postives = 452/1019 (44.36%), Query Frame = 1
Query: 2254 KNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKN----YLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGY------------------------LA---RKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL----RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLR-MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLK-IKQ---SVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRA-ISARKQ---FLNFRKFTI-----------------------VVQKYIKMHQCRQKFLKLKSQVITIQKNIRALL----QRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAAT----------------------VVQKYFKSYICKKQFRKMKESVTVIQKY--QRRLI--CRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGF----IKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQ------------SLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRA-----------HTIRSHFIC-----QKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTR 4923
            ++YR Y  R  Y  +K AT ++Q  +R  L+ K     Y  + ++ + +Q   RG   R     ++ + KIIQ+  + Y                        LA   R+++  + KA + +Q+A+RG   R+    + +AA ++Q++YR    +  +  +R + +++Q+     L +++  +R      S I++Q   RG   RR      SA  +++  ++ Y  RK+FL +R++V+  Q+  R +L+ R                       K ++AK+SA I IQ   R +  RR+ Q  R AAI IQ   R +  +  +    ++   +Q+  R+    K  +K +KQ   + +V+Q   +G   + + K+     I+ QS  R +  Q +YL +R + + IQ+ +RA ++ARKQ   FL  R  +I                       V+Q   + H+ R K+  ++   + IQ++ RA +     R RY+  +K+ I IQ  FR    +  I   ++AAT                      ++Q  ++ + C+ Q+ +M++S  +IQ++   R+L+   R +F++  K  + LQ  +R ++  +   ++ AA + I   +  +  R++YL  R   +++Q  +R    R+ +L  + +A+ +Q + R +     +R+ Y      ++ +Q ++RGF+       H +   + +  +R+YK RK    +  AA+ IQ  FR H  R+ Y   +  V  I             S++R+ I     ++ + AA  IQ   +GY  R+ +  ++ SA++IQ+  R     K                     +   +R+  AA  IQ   RG+L R+++   +  + +   F  A             +R+H+       Q ++ I +Q+  +    RK + E R KII  Q  +K ++  +       ++ ++Q   + F   +K  +LK   + +Q   R +C  KL+  T+
Sbjct:  178 QHYRAYKQRNEYRALKQATFLIQRRYRAKLLAKQQREKYCSMQKAAITLQAAYRGMQARKRIAEMQLAAKIIQRKYRAYKQRNEYCALKQVTIVIQGRYRAKLLAKQQRQRYCSMQKAAITLQAAYRGMRVRKEAQKRQEAATVLQAWYRMYRVKMAFQAMRLAAVLVQRRYRCHLERKEARERFVKLRHSAIVVQAVFRGNRTRREIGNLHSAATVIQRKYLAYKERKKFLSVRDTVVHCQQKWRAVLASRQQL--------------------KAYLAKRSAAIAIQAAFRGMKVRRRVQIERKAAITIQAHVRMHKTKVYYQRLLWATKTVQRRYRANQMMKEEMKSLKQKRMATVVLQAAFRGMKARHTLKQKHKAAIVIQSAYRAHCAQTRYLCMRYAAVAIQQRYRATLAARKQREHFLQLRCASISLQACFRGQRARREIGLQHQAAKVIQASFRSHRERTKYQAMRVSAMIIQRHFRAYIVAKDNRERYLSLRKSAILIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQSAIVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVAMRLATRRRAA-IKIQSVLHMHVHRRRYLKLRSCAVMLQAQYRMCTMRRAYLKKQTAAVTVQTFYRAYRAKVEQRECYLRTLRNVRTLQAHVRGFI------QHRRFQQMKEAGFRAYKTRK-LAAQTRAALKIQAWFRGHQARRDYISKQTAVATIHRCLQTKFQRARCSVVRRSI-----QKERNAAVLIQSTFRGYRQRQAFKQKKASALLIQRRFRAVQLAK-------------------AEKERRRRRNAAAVTIQAFCRGWLTRQKVRFMRFGLTLKHRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHR-----NQAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRKLHDTTK 1139          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Match: ENSAMXT00000040686.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:19214723:19233704:1 gene:ENSAMXG00000030872.1 transcript:ENSAMXT00000040686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.741 bits (491), Expect = 3.269e-49
Identity = 219/889 (24.63%), Postives = 385/889 (43.31%), Query Frame = 1
Query:  745 AIEKINSEV-TKDSLKFKDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFN--VSLLSNNEAC-FKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKS----SAEMLTEFTSYFLKGE------GNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVDLARK---TFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFENPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT----------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYR----------------------TFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKM---------RIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLV----QKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS----------CII-IQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLR-MLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRK 3111
            AI+++  EV  K  L  KD   +K     + +   +++YN  WL     + ++  F   + L SN++      FI  ++LWN DIA + R   +    +     +L+R  L++ L +V  LD AK++ +   D  LF  D+  K     +  +  EFT++F +GE        IL   + +     ++   I EYD  + +    +  G    RL +I V   I+   R   ++L  K   TF +E+ +          V +  EEI   +  W  ++K   L W           +  DK   + +   +P +  +     LLL WV +VC  Y++   N + +  DGR  C LIH+Y P +L   +I+  TT T                             +   D ++LLENE+ NFQ+  + +  +GG P ++  E   N IP+ + +   L+F  +RL+DL    RAA  IQ  WR+Y+                        +L K       +   ++Q+  R +   K+ K +K            ++ Q++ + Y  RH I+KM K+A  IQ   R +  R  +++   A  VLQ  FR +      ++ YL++  + + +Q + RG   R +  R+ K+   IQ Y++  + R++F+K   A+V+IQSA+RG+  R  Y    K+AV+IQ +YRS       R  +  ++K+ + +Q+ + +++ K       R           C + IQ+ +R     +   K  S+V  ++ +F    +RK++L+ R  +I  Q+ ++  L+ RN                              A  +IQ   +  + RRK + L+   + +Q  +R +  RK
Sbjct:   31 AIQRLELEVEAKRLLVRKDRHLWKDIGERQKVLNWLLSYNPLWL----RIGLETIFGELIPLESNSDVMGLAMFILGRLLWNPDIAAEFRHPKVPHLYRDGHEEALSRFTLKKLLLLVCFLDKAKESRLIEHDPCLFCMDAEYKVLTYLNYLLSAEFTAFFTEGEKLKSTRDQILLGLTVYIYMNVYMNVCI-EYDIILQSYVYTLFCG----RLIRIFVY--IVDGHREKTLNLLWKIIFTFQVEVLLD---------VEHLKEEISFLKKTWRTKQK---LAW-----------LKADKCAVK-RSNGSPRAEQSSEKLTLLLDWVNAVCEFYSLKAENFTVSFSDGRILCYLIHHYHPNHLNAEKIHQKTTQTIECDQRGKVELNSSSSDSDCSFDSLEQNGSPAVDFKVLLENERSNFQLVNTAVSYLGGVPAMISPEDMSNTIPNEKVVTCYLSFLCARLLDLRNETRAARVIQSAWRRYKLQKDIQLNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSFRGKQAR-DLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHRN-----------------------------QAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRK 854          

HSP 2 Score: 174.866 bits (442), Expect = 2.582e-43
Identity = 168/695 (24.17%), Postives = 300/695 (43.17%), Query Frame = 1
Query: 1516 GHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLFE------------------------NPIXXXXXXXXXXXXVWVKSVCGLYNINVSNIS-NLKDGRGFCLLIHYYLPEYLKLNEINHNTTLT----------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAPIILPKE---NEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVC----RRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALI--------QRRKF---QYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARK 3387
            GHREKTL LLW ++    ++ ++D + L  EI   +                        +P +  +     LLL WV +VC  Y++   N + +  DGR  C LIH+Y P +L   +I+  TT T                             +   D ++LLENE+ NFQ+  + +  +GG P ++  E   N IP+ + +   L+F  +RL+DL    RAA  IQ  WR+Y+                      +++ + L K ++  M     Q+VVK +L + R+ +  ++A +IQ  +R Y  +   +++K A        +RY  Q                              ++  +IQ   +GY  R    K+ KA   IQ+A R +  R  +  Q  AA ++Q  +R+  C    R+ YL L+ + I +QK   +    R L + +++   IQ Y+R  I RR F+K K+AV +++  + G+  R Q+ +M+ S +L+Q+  R   L                       + EF   + AT+ +Q  +R ++        +R++F    Y    A+ IQ+  R +   K    Q  S I +Q+  ++   +K YL+ +Q ++  Q+  K +L             + Q   +++LL+++  ++++  + +Q  +R   +RK
Sbjct:  246 GHREKTLNLLWKIIFTFQVEVLLDVEHLKEEISFLKKTWRTKQKLAWLKADKCAVKRSNGSPRAEQSSEKLTLLLDWVNAVCEFYSLKAENFTVSFSDGRILCYLIHHYHPNHLNAEKIHQKTTQTIECDQRGKVELNSSSSDSDCSFDSLEQNGSPAVDFKVLLENERSNFQLVNTAVSYLGGVPAMISPEDMSNTIPNEKVVTCYLSFLCARLLDLRNETRAARVIQSAWRRYK----------------------LQKDIQLNKQRN--MAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEA--------KRYTTQN-----------------------------RAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSF-RGKQARDLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKH-------------------RDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWL-----NHRNQAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRK 854          

HSP 3 Score: 126.716 bits (317), Expect = 1.859e-28
Identity = 146/572 (25.52%), Postives = 257/572 (44.93%), Query Frame = 1
Query: 5377 SELKTFQNLKNASIIIQKNFRCYILRKEF---KKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKII---------KLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIA----RKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLV--------RNHFQKNKQH----MKI-------FAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQR----W----------------RFIV------LKRSAVVIQRIWRGRQLR-CHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSEFIKLVKNLL-----YRN-INSKRGTKGITIFCHTCLLLVLLIKMEQKSI 6876
            + L   +N   A+ +IQ  +R Y L+K+    K++     KIQ+ ++ ++   + K    A  +IQ   RG   + + K++          +  V IQ   R   VR     + K+   IQ+  RMH     ++    +  V+Q+  R +      R+R+L++K   I +QK FR   A R   R +     +QS +R  + + ++ K + A +LIQ   +G++ R  Y  +QKS + +Q++ R   +    R  F +++ A++ + + +R ++V        R  F     H    ++I       +A +  +K++ + I +Q +F+   Q++RY L +   ++  QR    W                RF++      LK+  + +Q +WRG   R  H   K I      +R+RF + N    + + +      AL+ L   +   A +L  L  LE  T LS E C+ L+ S A + +  L+  CNR V  +E+++  I V  NL K      D +  E    V  LL     YR     K   KG +IF   C LLV+L++ E+++I
Sbjct:  458 ARLLDLRNETRAARVIQSAWRRYKLQKDIQLNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSFRGKQA-RDLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRY-LEQRQKIITAQRAVKAWLNHRNQAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRKLHDTTKVIS-----MRHRFRKVNSEAKEEDKLCNKTATALSYLLGYQ-NYAYILAALKHLETATRLSPECCERLVNSGATRTIFTLIRSCNRSVPSMEIITLAIQVLLNLSKYNK-TIDAV-YEVPDSVDTLLDLLQIYREKAGDKVADKGGSIFTKACFLLVILVQDERRAI 1019          

HSP 4 Score: 105.916 bits (263), Expect = 3.749e-22
Identity = 133/493 (26.98%), Postives = 214/493 (43.41%), Query Frame = 1
Query: 4222 NETRKKVIFIQSLIRQFI---AIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLE----QKAARIIQNFYRGYTIRA---------------HFLC-------------------QKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYIS-RNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQ---SYIRRY----ICISKFKMIKSAT 5553
            NETR   + IQS  R++     IQ  KQ   AA  IQ + K ++ +++   + R+A +IQ   R Y                QK ++R      Y  +  AA LIQ + RGY VR  I    KA   IQ   R H  RS F  Q  AA  LQ+  R +                     G   R+ Y +L+ ++I +QK FRG  A +  ++L  A+  IQ  +R   Q + +  T+ A ++IQ   RG  CR++Y R   +A+++Q+ +R   ++++   E    QKA   +Q   R   ++                H LC                   Q +S + +Q +FKA   RK+YLE RQK I  Q  V+ +++ RN+      +  +IQ   + +   RK  + K+ ++ +Q  +R     K    L + + +I    R   +  E K++ K C K     SY+  Y      ++  K +++AT
Sbjct:  465 NETRAARV-IQSAWRRYKLQKDIQLNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGY--------------SAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKC-------------------GHQQRQRYLQLKDAAICMQKSFRGKQA-RDLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHRNQ------AATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRK----LHDTTKVISMRHRFRKVNSEAKEEDKLCNKTATALSYLLGYQNYAYILAALKHLETAT 912          

HSP 5 Score: 102.064 bits (253), Expect = 5.394e-21
Identity = 107/418 (25.60%), Postives = 197/418 (47.13%), Query Frame = 1
Query: 3055 LRN---AAIIIQKTFRCYSVRKKFLI---QYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRAL----LQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQS--KIRMIITKKRYQ-KKIA-ATLTISKFVK--------GYFARKKYL--SYRHSVIV-IQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETR 4233
            LRN   AA +IQ  +R Y ++K   +   +  +A  IQ  V+S + ++   +  ++  VIQ   +G+                Q  +++    K+Y    ++ ++IQ  FR  S R       K    +Q  ++MH+ R  F +       +Q+  RA      QR+RY++ K A I +Q+ FR  K+ + ++   +AA+ +Q Y +  I ++QF K K +V +IQ   R   CR Q+ +  K  +L+Q   + R ++ K R + K+I  ATLT+ + ++            R+++   +Y H   V IQ + R     K       S I +Q++ +   +RK Y  Q   I   Q+ ++ +     LN  +Q+AT+IQH  + + +R+     +   + +Q  +R H  R+ ++ T+
Sbjct:  463 LRNETRAARVIQSAWRRYKLQKDIQLNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGY--------------SAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSFRG-KQARDLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAW-----LNHRNQAATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSRKLHDTTK 860          

HSP 6 Score: 100.908 bits (250), Expect = 1.226e-20
Identity = 99/441 (22.45%), Postives = 201/441 (45.58%), Query Frame = 1
Query: 4573 EQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIIL-VQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKN---------ASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELK----TFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFR 5853
            E +A R+IQ+ +R +              KLQK+I+         + RN     +Q+++K F+ ++  ++   ++ ++Q  +RG++A K+  ++K          A++ IQ   R Y           A+  IQ  +R    R  ++RQ  AA +LQ  FR +                     G+  R  +L  K++ + +Q  F+    R     I+  +  IQ  +R  I R +F++ K +V++IQ   RG++   +Y + +K+ + IQ+ +R    ++     F+ ++ A++ +Q+  R  ++++     R+      +Y   ++C  +          IQ+ +R  +     KK I  V+++Q+  +A   R R+L  ++ II  Q   +    ++N     Q+ TVIQ   ++F+ R++   +K  I+ +Q  +R
Sbjct:  466 ETRAARVIQSAWRRY--------------KLQKDIQ-------LNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKC-------------------GHQQRQRYLQLKDAAICMQKSFRGKQARDLVRLIKAAST-IQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAY--HHLCAVR----------IQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHRN-----QAATVIQHAAKRFLLRRKKERLKQGILKVQALWR 848          

HSP 7 Score: 92.4337 bits (228), Expect = 4.533e-18
Identity = 100/415 (24.10%), Postives = 178/415 (42.89%), Query Frame = 1
Query: 3544 KAVIFIQRKFRSCKEKKQIILN---NQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQR---------RLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVK---------------------------GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKI----RKNFICKRNAAIVIQKQFRKHYIRQQYNETRKK-----------VIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIR 4626
            +A   IQ  +R  K +K I LN   N AA  +Q   KS++ K++ ++   + TVIQ + R         R+   K++  + +  +L+Q+  R    +    K   A  TI   ++                           G+  R++YL  + + I +Q SFR    R +   IK +A  IQ YLR  I+R+ +     A+ +IQ   RG   R       +SA LIQ +YRS K+    R  F   + A + +Q+  R+  +++  N  R++            + IQ  +R   A++  K+   +  Y+Q+  K    RK+Y+ QR+  +  Q+ V+ +L+ ++                             AAT+IQ  A+ +L+R++    ++ +  +Q  +R H  R
Sbjct:  468 RAARVIQSAWRRYKLQKDIQLNKQRNMAACKIQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSFRGKQARDLVRLIK-AASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAVKAWLNHRNQ----------------------------AATVIQHAAKRFLLRRKKERLKQGILKVQALWRGHCSR 853          

HSP 8 Score: 77.7962 bits (190), Expect = 1.307e-13
Identity = 87/344 (25.29%), Postives = 159/344 (46.22%), Query Frame = 1
Query: 4042 IQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKN---------FICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAK----GYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTI----RSHFICQKNAAIKLQKNIRGYLIRKNFTETRNK-----------IILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRN-ASIVIQKYVRGFLCRIKYQR 4986
            IQ  ++ FL ++ L   +++AT+IQ F+R Y  +K          +  +  AA++IQ  FR + +R    +  K    IQ+ +R       +K+   AA  +Q+  +    G+  R++Y+  + +A+ +QK+ R     +       +   IQ Y+R  + R  + +   A  LIQ   RG+  R +    QK+  +IQ +YR+  +    R  F   + A + LQ+ +R  ++++     R +            + +Q  ++   A K  +K  SS I VQ+ F+     K++L+ +   I  Q+ V      K + + RN A+ VIQ   + FL R K +R
Sbjct:  499 IQAVVKSFLQKRRLKRRNRAATVIQAFWRGYSAQKELKRMKEAKRYTTQNRAAVLIQTLFRGYSVRHHIAKMHKAATTIQAALRMHKHRSAFKRQCWAAGVLQERFRAWKCGHQQRQRYLQLKDAAICMQKSFRGK-QARDLVRLIKAASTIQSYLRMSIQRRQFMKTKAAVVLIQSAYRGHYCRVQYARMQKSAVLIQQWYRSRKLVQKHRDEFKRIQKATLTLQRALRRMVVKETANALRRQRFTAAAYHHLCAVRIQRALRTHWALKAAKKQISSVIYVQRWFKAKFQRKRYLEQRQKIITAQRAV------KAWLNHRNQAATVIQHAAKRFLLRRKKER 835          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Match: myo5ab (myosin VAb [Source:ZFIN;Acc:ZDB-GENE-050411-72])

HSP 1 Score: 72.7886 bits (177), Expect = 4.986e-12
Identity = 69/239 (28.87%), Postives = 115/239 (48.12%), Query Frame = 1
Query: 2173 IICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLR--KSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQK 2877
            + CQ+V+++ +      K  K+ I  +     YL ++R +K+++A V +Q   R Y+ +K YL                       R+R ST  IQ+YV+G  AR   K ++ TKA VVIQ   R  A RR Y  +  AAV++Q   R    R  Y  LR  + V+++Q+ V   L + +  + +++ + +Q  +R  + RR   K K     +EHY      +K  + M N ++ LQ+
Sbjct:  701 LTCQNVLQQLIQDPDKYKFGKTKIFFRAGQVAYLEKLRADKLRAACVQIQKTIRCYVARKKYL-----------------------RLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEARSVEHY------KKLNVGMENKIMQLQR 910          

HSP 2 Score: 70.0922 bits (170), Expect = 3.882e-11
Identity = 54/172 (31.40%), Postives = 85/172 (49.42%), Query Frame = 1
Query: 4774 QKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTR--NASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHF--LCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
             KLR++ + +QK  R + A KK+L+L+ ++I IQ+ VR      L +  R   A++VIQKY R    R  YQR+ LAA++LQR                         RGY  R  +  L  +   V +Q + + +L R +Y    Q  +++QC VRR ++R    +LK+  
Sbjct:  740 DKLRAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQR-----------------------LLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEA 888          

HSP 3 Score: 60.4622 bits (145), Expect = 3.032e-8
Identity = 46/150 (30.67%), Postives = 79/150 (52.67%), Query Frame = 1
Query: 3886 RHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS--QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKR--NAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
            R + + IQ + RC++ RK +L +++S I IQ+Y+RG   R +  S  +T A  VIQK  R    R+       +A L+Q   R Y  R  +   R     +V+Q+  R    R QY  T + V+++Q  +R+ +A ++ K++K  A  ++
Sbjct:  743 RAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEARSVE 892          

HSP 4 Score: 60.4622 bits (145), Expect = 3.136e-8
Identity = 50/171 (29.24%), Postives = 86/171 (50.29%), Query Frame = 1
Query: 5590 RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR--TATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLK 6096
            +L+  K+    V IQK IR  + R ++L ++ S I IQ + R            Q    + K+ R+  A           ++IQK+ R   A+R YQR     + +Q L+RG  A+L+Y+++R     +++Q+ V+G+  R  Y+   ++V+ LQ  +R  L R+   KLK
Sbjct:  736 KLRADKLRAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVR-----------GQQARALCKSLRRTKA----------AVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLK 885          

HSP 5 Score: 58.5362 bits (140), Expect = 1.266e-7
Identity = 47/193 (24.35%), Postives = 101/193 (52.33%), Query Frame = 1
Query: 5164 AYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMI--KSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKN 5736
            AYL + +  ++R   + IQ  +R Y++R ++LRL+ S I IQ+  RG        +Q +A+    K+ RR            A+++IQK  R    R+ +++K+   V +Q  +R Y    ++K +  +   +++Q+ +RG   R++Y++ ++ VV++Q  +R  + R     +K    +++ + +++   +N
Sbjct:  732 AYLEKLRADKLRAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRG--------QQARALC---KSLRR----------TKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEARSVEHYKKLNVGMEN 903          

HSP 6 Score: 55.8398 bits (133), Expect = 7.593e-7
Identity = 43/150 (28.67%), Postives = 84/150 (56.00%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLR--SSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNAS--IVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNF 5088
            A +++QK IR Y+ RK +   R   I +Q  ++G  AR   + LR   +++++QK  R   A + + + + A++ +Q+ +R Y     Y+  R     +V+Q++VRG+L R++Y+R + A + LQ   R+ L  R +   +  AR ++++
Sbjct:  745 ACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEARSVEHY 894          

HSP 7 Score: 55.4546 bits (132), Expect = 1.063e-6
Identity = 40/147 (27.21%), Postives = 83/147 (56.46%), Query Frame = 1
Query: 3400 FRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRR--RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKM--KESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK-KIAA 3825
             R   + +QK I+ +  R+K+L+L+   ITIQ+ +R    R   + ++  KA + IQ+  R C  ++       AA ++Q+  + Y  + Q++++  ++ V V+Q++ R  + R Q+++ M+ V+ LQ  +R ++ ++  +K KI A
Sbjct:  742 LRAACVQIQKTIRCYVARKKYLRLRWSTITIQRYVRGQQARALCKSLRRTKAAVVIQKYQRMCAARRLYQRKQLAAVLLQRLLRGYAARLQYKQLRYEQKVVVVQRWVRGWLARVQYRRTMQAVVYLQCCVRRMLARRELKKLKIEA 888          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Match: myo5b (myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7])

HSP 1 Score: 69.707 bits (169), Expect = 5.409e-11
Identity = 51/159 (32.08%), Postives = 87/159 (54.72%), Query Frame = 1
Query: 2386 IQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRL---RSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMR 2853
            IQ  +RG+L R  Y +IRKS  ++Q+Y +GYLA   +      I + + A         Y    KAA+I Q  YR    RR YL +R++VI IQ    + +F R+L +        IIIQ+ +RG+++R+ FL+ ++A  +++  +   L ++Q  +++
Sbjct:  680 IQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLA--PYFAWIYCIYLTEHA--------EYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFT-RGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQLKQLK 827          

HSP 2 Score: 65.855 bits (159), Expect = 7.717e-10
Identity = 56/207 (27.05%), Postives = 103/207 (49.76%), Query Frame = 1
Query: 2128 RFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLC-------------RSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYT--IQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKL 2703
            R L  KK  ++  +  +C+++++  +      +  K+ I  +     YL ++R +K + A + +Q   R +L ++ YLKI +S +++Q   RGYL               + Y R+ K+  I QK  +    R+ ++ + +A++ IQ+  RG   RR Y   +    A+IIQ   R  + R+ +L  R + I+IQ    +VL KR+L
Sbjct:  617 RVLMTKKDMTVGDKKQVCRNLLESLIKDPDKFQFGKTKIFFRAGQVAYLEKLRADKFRFACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQL 823          

HSP 3 Score: 65.0846 bits (157), Expect = 1.108e-9
Identity = 47/160 (29.38%), Postives = 87/160 (54.37%), Query Frame = 1
Query: 3130 YSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCR---QKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            ++ I IQK VR  + ++ YLKI++S +++Q++ +G+L            I C  L        +YL++ K+ +I QK +R +  R+ +L  R+  I +Q + +    R   Q+FL L  + I IQ+ +R  L R+++++ + A I IQ  +R    K+Q+
Sbjct:  675 FACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLA------PYFAWIYCIYLTE----HAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFL-LHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQL 823          

HSP 4 Score: 64.6994 bits (156), Expect = 1.462e-9
Identity = 51/175 (29.14%), Postives = 84/175 (48.00%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYL-------------RRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQ--YLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIK 3198
            +CI IQK +RG++ RR +LK + +  +L+ Y  GYL                ++L++  + ++ QK  RM+ +R ++L                         + A I IQ   R +  RR +Q   L + AIIIQ+T R +  RKKFL    +AIVIQ   R ++ ++   ++K
Sbjct:  676 ACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTI-----------------------RQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQLKQLK 827          

HSP 5 Score: 63.1586 bits (152), Expect = 4.185e-9
Identity = 50/156 (32.05%), Postives = 83/156 (53.21%), Query Frame = 1
Query: 5410 ASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQ--LMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKR 5871
            A I IQK  R ++ R+ + K RK+ + +Q Y R Y+    F  I    + + +H        +Y ++ K  +  QK  R   VR  +L I++++I IQ+F R  +  + YQ  L+     +IQ+  R ++ RK+FL  ++  I+IQ  +RR LAKR
Sbjct:  676 ACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLA-PYFAWI--YCIYLTEHA-------EYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKR 821          

HSP 6 Score: 62.7734 bits (151), Expect = 5.617e-9
Identity = 55/179 (30.73%), Postives = 82/179 (45.81%), Query Frame = 1
Query: 3484 ITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSY--RHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQ-KYLRGFIKRKI 4011
            I IQK +R  LQRRRY+K +K+ I +QR  R                 +  YF    C      + E    ++  +  LIC+KQ+              RM+  ++ Y     A +TI  F +G F R+ Y  +   H  I+IQ + R ++ RK FL  + +AIVIQ  Y R   KR++
Sbjct:  678 IKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRG---------------YLAPYFAWIYCI----YLTEHAEYLRLTKAALICQKQY--------------RMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQL 823          

HSP 7 Score: 62.003 bits (149), Expect = 1.110e-8
Identity = 61/214 (28.50%), Postives = 101/214 (47.20%), Query Frame = 1
Query: 2041 WRKYRTFYLYKTHFIAHYKEVI--IVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLV-------------QKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK---KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRR 2628
            + +YR     K   +   K+V   +++S+++      KF+  K +I      V  YL + R  K + + I IQK  R +L R RY KI+ + ++LQ + R YL                 YL++ ++ LI Q   R    R  Y  IR++   IQ + +G   R+   +F+   KAI+ IQ   RG+  R+ +     AA++IQ  YR  + +R
Sbjct:  613 YSRYRVLMTKKDMTVGDKKQVCRNLLESLIKD---PDKFQFGKTKIFFRAGQVA-YLEKLRADKFRFACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAII-IQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKR 821          

HSP 8 Score: 60.8474 bits (146), Expect = 2.596e-8
Identity = 45/148 (30.41%), Postives = 80/148 (54.05%), Query Frame = 1
Query: 4651 AAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIA-------------RKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRD--TRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRI 5049
            A IK+QK +RG+L R+ + + R   I++Q   +G++A                Y +L  +++I QK +R     + +L ++ A I IQ   R     +LY++    + +I+IQ+ VRG+L R K+ R   AAI++Q  +R+ L  R++
Sbjct:  676 ACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQL 823          

HSP 9 Score: 60.4622 bits (145), Expect = 3.150e-8
Identity = 45/141 (31.91%), Postives = 72/141 (51.06%), Query Frame = 1
Query: 5767 IQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAK-------------RSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYK--ILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVR 6144
            IQK  R ++ R+R+L+I+ + I++Q++ R +LA                Y R     +  Q   R    +  Y  +R A I IQ   +G F R+ Y+  +L    I +QR +RG+L RK FL+ +NA+I+I    R VL +
Sbjct:  680 IQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAK 820          

HSP 10 Score: 59.6918 bits (143), Expect = 5.487e-8
Identity = 52/168 (30.95%), Postives = 80/168 (47.62%), Query Frame = 1
Query: 4858 ASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLC-------------RIKYQRQLLAAIILQRHFR------KYLIIRRIDLEQKAARIIQNFYRGYTIR---AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKV 5295
            A I IQK VR + Q + Y   R ++I++Q+Y RG+L                +Y R   AA+I Q+ +R       YL IR      +A   IQ F RG   R     FL   +  + IQ   + +L RKK+L  R   I IQC  RR +++ +  +LK+    ++++
Sbjct:  676 ACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIR------QAVITIQAFTRGMFTRRLYQEFLLH-HKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQLKQLKIEARSVKRI 836          

HSP 11 Score: 58.151 bits (139), Expect = 1.737e-7
Identity = 42/137 (30.66%), Postives = 71/137 (51.82%), Query Frame = 1
Query: 4525 IQKIARGYLVRKRIVVEQKAVRIIQNFYRAH-------------TIRSHFICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQK--LRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRR 4890
            IQK  RG+L R+R +  +K+  ++Q + R +             T  + ++    AA+  QK  R   +R+ +   R  +I +Q+  +G   R+ YQ+  L   +II+Q+  RG+   KKFL+ +NA+I IQ   RR
Sbjct:  680 IQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRR 816          

HSP 12 Score: 56.6102 bits (135), Expect = 5.011e-7
Identity = 46/138 (33.33%), Postives = 71/138 (51.45%), Query Frame = 1
Query: 4726 ILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNA-------------HKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLL--AAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR 5094
            I +Q  ++G++ R+ Y K+R S+I++Q+  RG+ A             H ++L+L  A++  QK  R     + Y   R A I IQ + RG   R  YQ  LL   AII+QR  R +L  ++    + AA +IQ  YR
Sbjct:  678 IKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYR 815          

HSP 13 Score: 53.9138 bits (128), Expect = 3.107e-6
Identity = 47/185 (25.41%), Postives = 85/185 (45.95%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKR---KIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQ--MKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
             Y  + +   +R + I IQ + R ++ R+ +L I+ SAI++Q+Y RG++      IYC                              L +H          ++    AA++ QKQ+R   +R+ Y   R+ VI IQ+  R     + Y++  +   A  IQ+  +G++ RKK++  R +A++IQ
Sbjct:  663 AYLEKLRADKFRFACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYC----------------------------IYLTEH--------AEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQ 811          

HSP 14 Score: 53.9138 bits (128), Expect = 3.323e-6
Identity = 42/160 (26.25%), Postives = 73/160 (45.62%), Query Frame = 1
Query: 3760 ILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFA-------------RKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRK 4200
            I +Q  +R  + ++RY K   + + + ++ +GY A               +YL    + ++ Q  +R    R+ +L+I+ + I IQ + RG   R++Y              + FL+       H  A +IQ   R +  RK F+  RNAAIVIQ  +R+
Sbjct:  678 IKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQAVITIQAFTRGMFTRRLY--------------QEFLL-------HHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRR 816          

HSP 15 Score: 52.7582 bits (125), Expect = 7.326e-6
Identity = 56/175 (32.00%), Postives = 81/175 (46.29%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI-------------RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY--CLLKSYTLLIQ-------QRWRFIVLKRSAVVIQ----RIWRGRQLR 6375
            L KL+  K R A I IQKTV+G+  R+ Y  ++KS I LQR+ RG+L                 +L+L  A++I  K  R V VR  +   +Q               A I IQA+ R    +R Y   LL    ++IQ        R +F+  + +A+VIQ    R+   RQL+
Sbjct:  665 LEKLRADKFRFACIKIQKTVRGWLQRRRYLKIRKSAIMLQRYGRGYLAPYFAWIYCIYLTEHAEYLRLTKAALICQKQYRMVRVRRAYLTIRQ---------------AVITIQAFTRGMFTRRLYQEFLLHHKAIIIQRTVRGWLDRKKFLRARNAAIVIQCAYRRVLAKRQLK 824          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Match: myo5aa (myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2])

HSP 1 Score: 68.1662 bits (165), Expect = 1.235e-10
Identity = 56/171 (32.75%), Postives = 88/171 (51.46%), Query Frame = 1
Query: 4774 QKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRY---CQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
             KLR++ I +QK  R + A KKFL++K A+I IQ++VR Y   C     R TR A+I+IQKY R ++ R  Y+R+  AA+ +Q   R Y+           AR     Y+        L +++  V IQ   + +L R+ Y       +++QC VRR  ++    +LK+  
Sbjct:  770 DKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTR-AAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYM-----------AR---QLYK--------LLREHKAVIIQKMVRGWLARQWYKRSLDALVYLQCCVRRMRAKRELKKLKIEA 917          

HSP 2 Score: 62.3882 bits (150), Expect = 7.170e-9
Identity = 48/158 (30.38%), Postives = 82/158 (51.90%), Query Frame = 1
Query: 5164 AYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKS-ATLIIQKHIRGIFVRLKYKKIIKLVVFIQ 5634
            AYL + +  ++R   I IQ  +R +++R +FLR+K + I IQ+  RGY        Q +              L TF     A+IIIQK  R Y+ R  +++K+   + +Q  +R Y+    +K+++    +IIQK +RG   R  YK+ +  +V++Q
Sbjct:  762 AYLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGY--------QARC-------------LATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVIIQKMVRGWLARQWYKRSLDALVYLQ 898          

HSP 3 Score: 60.8474 bits (146), Expect = 2.447e-8
Identity = 44/149 (29.53%), Postives = 82/149 (55.03%), Query Frame = 1
Query: 3886 RHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKR--KIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNF-ICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
            R + I IQ + RC++ RK FL +K +AI IQ+++RG+  R    +  +T A  +IQK  R ++ R        +A  +Q   R+Y  R+ + + + + A++IQK  R    RQ Y  +   ++++Q  +R+  A ++ K++K  A  ++
Sbjct:  773 RAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVIIQKMVRGWLARQWYKRSLDALVYLQCCVRRMRAKRELKKLKIEARSVE 921          

HSP 4 Score: 59.3066 bits (142), Expect = 7.550e-8
Identity = 44/137 (32.12%), Postives = 77/137 (56.20%), Query Frame = 1
Query: 2200 YLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQ--KNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQ 2598
            YL + R  K++ + I IQK  R +L R ++ ++K A + +Q H R Y  +    +L+  R+ +IIQ   R Y+ R+ Y+R + +   +Q  ++ Y+AR+  K ++  KA V+IQ   RG+  R+ Y   + A V +Q
Sbjct:  763 YLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKA-VIIQKMVRGWLARQWYKRSLDALVYLQ 898          

HSP 5 Score: 58.151 bits (139), Expect = 1.736e-7
Identity = 41/125 (32.80%), Postives = 71/125 (56.80%), Query Frame = 1
Query: 2404 GYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKR--RNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS--CIIIQKYIRGFINRR 2766
             YL +    ++R +   IQK ++ +LARKKF+++ +A + IQ   RGY  R    +  + +AA+IIQ + R  V R  Y   + + + +Q ++ +    R+L K LR    +IIQK +RG++ R+
Sbjct:  762 AYLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCIL-RAYMARQLYKLLREHKAVIIQKMVRGWLARQ 885          

HSP 6 Score: 57.3806 bits (137), Expect = 2.471e-7
Identity = 44/139 (31.65%), Postives = 79/139 (56.83%), Query Frame = 1
Query: 2140 LKKFKSIKMRI--IICQSVVKRYLARHRISKMKKSAILIQKNYRRYL--CRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK-IIQKYVKGYLARKKFVKLTKAIVVIQSAFR 2541
            L+K ++ K+R   I  Q  ++ +LAR +  +MK++AI IQ++ R Y   C   + +   A +++Q + R Y+ +  Y +   + L +Q  +R Y+ R  YK +R+    IIQK V+G+LAR+ + +   A+V +Q   R
Sbjct:  764 LEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVIIQKMVRGWLARQWYKRSLDALVYLQCCVR 902          

HSP 7 Score: 56.6102 bits (135), Expect = 4.023e-7
Identity = 56/209 (26.79%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 5440 CYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSN-IIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKIL----QKSVIQLQR 6051
             Y+ +    K R  C++IQ  IR ++   KF  +K A + IQ+H+RG   R        L  F+++  RA I+             IQ + RM+     Y+  + +   +Q   R ++AR+ +  ++ +  +IIQK  R +LA++ Y+R+L  ++++Q  VR   AK + +K++     ++          HYK L    +  ++QLQR
Sbjct:  762 AYLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARC-------LATFLRR-TRAAII-------------IQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVIIQKMVRGWLARQWYKRSLDALVYLQCCVRRMRAKRELKKLKIEARSVE----------HYKKLNIGMENKIMQLQR 939          

HSP 8 Score: 54.299 bits (129), Expect = 2.180e-6
Identity = 42/147 (28.57%), Postives = 73/147 (49.66%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIR--KIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRG 6363
            L KL+  K+R A I IQKT++ +  RK +  ++++ I +QR +RG+  R    FL+   A+III K+ R  + R  +               R++  A++ +Q   R Y+ ++ Y LL+ +                AV+IQ++ RG
Sbjct:  764 LEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMY---------------RRKQAAALAMQCILRAYMARQLYKLLREH---------------KAVIIQKMVRG 880          

HSP 9 Score: 52.373 bits (124), Expect = 9.412e-6
Identity = 40/126 (31.75%), Postives = 72/126 (57.14%), Query Frame = 1
Query: 3025 ALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRS--IICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKS-TIIIQKHFRAISARKQF 3393
            A +++ +   LR A I IQKT RC+  RKKFL    +AI IQ++VR     C   +L+  ++ ++IQK+ + ++ +  Y++     +  Q ++R Y+ ++ Y  +R+   +IIQK  R   AR+ +
Sbjct:  762 AYLEKLRADKLRAACIRIQKTIRCWLARKKFLRMKRAAITIQRHVRGYQARCLATFLRRTRAAIIIQKYQRMYVARTMYRRKQAAALAMQCILRAYMARQLYKLLREHKAVIIQKMVRGWLARQWY 887          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 53.9138 bits (128), Expect = 6.335e-7
Identity = 24/68 (35.29%), Postives = 41/68 (60.29%), Query Frame = 1
Query: 3328 KVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRY 3531
            ++ KS  +I+ H  A  ARK+F   R   + VQ + +   C+++F +L++  IT+QK+ R+ L RR Y
Sbjct:  737 ELHKSATLIRAHVLAYLARKRFRRLRACAVAVQAWFRCRSCQRRFSRLRASAITLQKHRRSALARRLY 804          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000990.1 (pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 gene:ENSPMAG00000000865.1 transcript:ENSPMAT00000000990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.467e-6
Identity = 52/215 (24.19%), Postives = 99/215 (46.05%), Query Frame = 1
Query: 2203 LARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCR------SNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIII---------QKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNIL 2802
            L R R  +M + A LIQK YR Y CR  +  +K + +++ S+ R +  +K Y+K    I+++Q  +RG+  R       + K++  +  +I+ Y  G+  ++   K   AI V +           +++++   + +Q+  R  V +R  L  RK  + +          +  H+  FK    KR+   +I+       I RR FL+ + ++  L
Sbjct:  696 LERKRTERMHELATLIQKTYRGYKCRTHFLLMKKSQIIIASYVRSHQERKRYVKTLECIVLLQRIVRGWKARRLLRHLKHQKKLNDAATVIRAYWCGFQTKRGKRKAFLAIPVSR-----------HSLKLTPILWLQAKVRRQVNQRKELGRRKHAVAVIWAYWTGLKVRKAHRKHFKGNAGKRIYDFLIL------CIMRRYFLRLQDSLPKL 893          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004311.1 (pep scaffold:Pmarinus_7.0:GL481322:4319:21833:1 gene:ENSPMAG00000003937.1 transcript:ENSPMAT00000004311.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 8.093e-6
Identity = 32/106 (30.19%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 5191 EIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIR 5508
            E+ +    IQ   R+Y  R    +  M+  +IQ+  R Y  +  Y K  +A I IQ  FR + E K FQ  + A+++IQ+ +R Y   ++ K+ R+  + +Q  +R
Sbjct:  118 ELYEAAKIIQTAFRKYKGRRLKEQQDMAAAVIQRCYRKYKQYALYKKMTQAAILIQSKFRSYYEQKRFQQSRRAAVLIQQYYRSYKEYEKLKQTRRGTINLQQKMR 223          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 63.1586 bits (152), Expect = 5.689e-10
Identity = 47/144 (32.64%), Postives = 71/144 (49.31%), Query Frame = 1
Query: 3961 SAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQ--SATLIQHFYRSYKIRKNFIC-------------------------KRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAA 4311
            S ++IQK +R    RK Y   + AIK +Q NI+GF++R+ +N   +   ATL+Q  YR + IR N                            + NAA+ IQ + R    R ++  T+K  + +QSLIR+  A +K KQ+K  A
Sbjct:  787 SIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADA 930          

HSP 2 Score: 53.9138 bits (128), Expect = 3.464e-7
Identity = 54/182 (29.67%), Postives = 91/182 (50.00%), Query Frame = 1
Query: 5131 NSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV---IIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK-----NASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRAN 5652
            NS V IQ   +A   RK+YL+I Q   ++Q  ++ +I R R +  +M V    ++Q   RG+          + + N+QK  R+  ELK  Q LK     NA++ IQ   R +  R  F + +K+ V +QS IRR     K K +K+    +  H++ +  +L+  K+I+L   +   ++ N
Sbjct:  786 NSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQR-VNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRK--ELKQRQ-LKQEHEYNAAVTIQSKVRTFEPRSRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSV-NHLKEVSYKLE-NKVIELTQNLASKVKEN 961          

HSP 3 Score: 53.9138 bits (128), Expect = 4.169e-7
Identity = 57/207 (27.54%), Postives = 101/207 (48.79%), Query Frame = 1
Query: 2134 LCLKKFKSIKMRIIICQSVVKRYLARHRISKMK----KSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKI-----IQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNY--TIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS 2721
            L  KK ++ +  II   SVVK  L      K K     + I  +     YL ++R  K+ ++ V++Q   R    +K YL+I ++I  +QNNI+G++ R   +R+    K+     +Q   +G+  R     + + I  +Q   R   K+R      +  AAV IQS  R+   R  +L  +K  +++Q ++ +   +RKL K+L++
Sbjct:  729 LIFKKKETTEEDII---SVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIR---QRVNDEMKVNCATLLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPRSRFLRTKKDTVVVQSLIRRRAAQRKL-KQLKA 928          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 51.9878 bits (123), Expect = 1.433e-6
Identity = 55/193 (28.50%), Postives = 95/193 (49.22%), Query Frame = 1
Query: 5899 IFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIR-KIFLKLKN-ASIIISKHVRGVLVRNHFQKN-KQHMK---------IFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIG--HEISEIRNRFI 6435
            IF ++ +   L KL+  KM    I+IQK ++  + R  Y    +S+ + Q  IR  L+R ++  +LK  A+I++  ++R +  R +++    Q +K         I    N +  L A++ IQ+Y R Y  K  Y  LK  ++L+Q   R  + +R  +V+Q+    R +R    +  IG   E  E +N FI
Sbjct:  762 IFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILLQTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTDYRTLKRSSILVQSAMRMQLARRRYIVLQKEVEERNIRA---SYGIGLLEEAIEFKNSFI 951          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 68.9366 bits (167), Expect = 2.796e-11
Identity = 49/178 (27.53%), Postives = 100/178 (56.18%), Query Frame = 1
Query: 2188 VVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIR--KSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQI--KAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEK 2709
            +++ ++    + +M K+ I  +     YL ++R +K++ + V++Q ++R Y   K YL++ ++ ++IQ  +RG   R+  + +R  KS   IQ+Y +G+  R+ +++   AI+ IQS  RG + RR   + +    A +IQ  +R    R+ Y N  K +I +Q  V ++  +++L+K
Sbjct:  705 ILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFHLRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGVIQRCWRGYKGRQKYRNYFKKIIFLQSCVRRMRARKELKK 882          

HSP 2 Score: 63.1586 bits (152), Expect = 1.376e-9
Identity = 46/150 (30.67%), Postives = 83/150 (55.33%), Query Frame = 1
Query: 3886 RHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCS--QTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIR--KNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
            R S ++IQ ++RC+   K++L ++ +AI+IQ ++RG   R +  S  +  +   IQ+  RGF +R+     H +   IQ + R    R  +  +     A VIQ+ +R +  RQ+Y    KK+IF+QS +R+  A ++ K++K  A  ++
Sbjct:  742 RRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFHLRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGVIQRCWRGYKGRQKYRNYFKKIIFLQSCVRRMRARKELKKLKIEARSVE 891          

HSP 3 Score: 62.003 bits (149), Expect = 3.118e-9
Identity = 43/151 (28.48%), Postives = 84/151 (55.63%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQ--KFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFR--SCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK 3744
            YL + +  K+R+S ++IQK++R     K +L  RK  I++Q +++  Q R   + L+      TIQ+  R    R+ Y++   A++ IQ   R  S + ++Q++L N  A V+Q+ ++ Y  ++++R   + +  +Q   RR+  RK+ +K
Sbjct:  732 YLEKLRGDKLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFHLRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGVIQRCWRGYKGRQKYRNYFKKIIFLQSCVRRMRARKELKK 882          

HSP 4 Score: 56.225 bits (134), Expect = 2.166e-7
Identity = 51/149 (34.23%), Postives = 80/149 (53.69%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCR--IKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARI-IQNFYRGYTIR--AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSV 5277
            KL+ + + IQKN R Y + KLY   R A+I+IQ +VRG   R   +  R+  +A  +QR++R +  +R+  L + AA + IQ++ RG + R     L        IQ  ++ Y  R+KY    +K IF+Q  VRR  +R    +LK+  
Sbjct:  740 KLRRSCVMIQKNYRCYREHKLYLRMRKAAILIQAWVRGDQARNLARSLRRNKSATTIQRYYRGFH-LRQAYLRKHAAILTIQSYARGMSARRQRQVLLYNAKAGVIQRCWRGYKGRQKYRNYFKKIIFLQSCVRRMRARKELKKLKIEA 887          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Nematostella
Match: EDO35658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY6])

HSP 1 Score: 55.0694 bits (131), Expect = 5.354e-7
Identity = 34/116 (29.31%), Postives = 61/116 (52.59%), Query Frame = 1
Query: 5533 KMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ 5880
            +++ S  ++IQK +RG   R  Y ++    V IQK  + +  R ++  I +    +Q+ YR       YQ ++  + + Q  CR F+AR+ ++   +++I IQ   R  LAKR+ Q
Sbjct:  490 RLLTSRAILIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVRMVLAKRTAQ 605          

HSP 2 Score: 53.9138 bits (128), Expect = 1.014e-6
Identity = 33/106 (31.13%), Postives = 56/106 (52.83%), Query Frame = 1
Query: 2452 IIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRN 2769
            +IQK V+G+L RK ++++    V+IQ  ++G+ +R+ Y   ++    +Q+ YR+ V    Y  LR  V I Q      L +R    R+ S I IQ  +R  + +R 
Sbjct:  498 LIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVRMVLAKRT 603          

HSP 3 Score: 53.5286 bits (127), Expect = 1.531e-6
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 1
Query: 4102 ATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYL 4413
            A LIQ   R +  RK ++  R  A++IQK ++ H+ RQ+Y +  +    +Q+L R  +   KY+ ++      Q   +G++ R+ YVT+  S + IQ  VR  L
Sbjct:  496 AILIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVRMVL 599          

HSP 4 Score: 51.2174 bits (121), Expect = 6.498e-6
Identity = 38/144 (26.39%), Postives = 72/144 (50.00%), Query Frame = 1
Query: 2110 VQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFR 2541
              +I  ++L    ++  K +I + +    + L  HR   +   AILIQK  R +L R  Y +++   V++Q  ++ +  ++ Y KI +    +Q   R  +  + Y+ +R    I Q Y +G+LAR+ +V    +++ IQS  R
Sbjct:  454 TNNIAVKYLSNSDWQLGKTKIFL-KDAQDQQLEEHRDRLLTSRAILIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVR 596          

HSP 5 Score: 51.2174 bits (121), Expect = 6.552e-6
Identity = 33/113 (29.20%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 5620 VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR 5958
             + IQK +R  + R  +L ++   + IQ  ++ H++ + YQ + Q    +Q   R  +   ++  ++S + I Q + R FLA+R Y   ++ +I +QS VR  LAK   Q +R
Sbjct:  496 AILIQKVVRGFLTRKVYLRMRMGAVMIQKTWKGHHQRQKYQKILQGYARLQALYRTRVISAKYQTLRSRVCIFQAYCRGFLARRDYVTRINSVIKIQSGVRMVLAKRTAQGLR 608          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 52.373 bits (124), Expect = 2.671e-6
Identity = 29/82 (35.37%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 4774 QKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCR-----IKYQRQLLAAI 5004
              +   ++I+QKIFRG+   K++  ++ + I I K  RR+   + YR  RNA+I+I  Y RG+  R     I Y+RQ + A+
Sbjct:  707 DGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFRDQRDYRRMRNAAILIASYARGWKARKAYRAILYERQCIWAV 788          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Match: aspm (abnormal spindle microtubule assembly [Source:NCBI gene;Acc:101174988])

HSP 1 Score: 596.275 bits (1536), Expect = 1.426e-172
Identity = 563/2158 (26.09%), Postives = 1015/2158 (47.03%), Query Frame = 1
Query:  589 DDIWLKRQEDCFVKWLNCIFNTHLSKTKVEDINK-------------NMP---------------------IYIEATKLLLSECKV-AIEKINSEVTKDSLKF-KDDIFFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEA-CFKKFIACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVAKKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLSVSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKIL-VNIDIMSKLRYPAVDLARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCVLSRHYIDAVIDRDKLISEIKLF--------------------ENPIXXXXXXXXXXXXV-----WVKSVCGLYNINVSNISNL-KDGRGFCLLIHYYLPEYLKLNEINHNTTLT-------------------------------SANLFDKEILLENEKRNFQIFFSKLKQIGGAPIIL---PKENEIPSHEFIMATLAFFSSRLIDLMTFYRAASCIQRVWRKYR---TFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRISKMKKSAIL----------IQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLC----RSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLR----SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLR----RKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRA--LIQRRKFQY--LRNAAIIIQKTFRCYSVRKKF--------LIQYY---------------SAIVIQKNVRSIICQKN----YLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCK----EKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKR----YQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIK----VIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYI----RQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIR----KNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQK----NVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR----GYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQ----KKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICIS----KFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRM----HYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKL----KYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQH------------MKIFAQENLRKRL----EASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLR 6375
            D+ W+++QE  F  W+N +      K   E +NK             N+P                     +   A +L  SE    AI+++  EV    L   KD   ++     + +   +++YN  WL +    +I  +F + L SN++      FI  ++LWN DIA ++R   + +  K     +L+R  L++ L +V  LD AK+  +   +  LF  D+  K++ ++L  F+  FL GEG + +      L VSH+QT +DE+DF V NL+ D+  G+RLAR+ ++L ++  + +KLR PA+   +K  N++LA++  K  G  +    G  ID   I  GHREKTL+LLW ++   +++ ++D ++L  EI                        +P+       +    +     WV++VC  YN+ V N + +  DGR  C LIH+Y P  L    I+H+TT T                               S ++  KE LLENEK NF++  S +  +GG P ++      N IP  + +M  L+F  +RL+DL    RAA  IQ  WRKYR      LY+       K  + +Q +VRRFL  ++        ++ QS  + +LAR +I +M+K A+L          IQ ++R +     Y +++  TV +Q+ +R       Y K+ R++ ++Q   R +      R  Y  +R S   +Q+  + + A  K  +  +A VVIQ+AF+ +   R  T +  AAV IQS++R  VC R Y  +R+S ++IQ   H+   +R+  + L+    S ++IQ+  RG + R+  L+ + A  +++  F   ++    R+ FL MR + + +Q   R    R     + ++A +IQ +F+   A+K+++A + A I +Q + RA  L ++ K QY  LR AA+++Q ++R  + RKK         LIQ                 +A+VIQ+  R+ +  K+    +L+ + + + +Q   +G  V+   K+      + QS +R++L +K+Y  ++ + IIIQ  +RA+    +++K+F   ++  I +Q   +  + RQ+  K  +    IQ + R    R  Y+  K A I IQ ++R+ K    E+++      AA V+Q  ++  + +++  +   +  +IQ+    +  RKQF K   + ++ Q + R +   ++    Y  K  A + +    +GY  RK+    + + ++IQ+ FR    +  +  ++++  V+Q+  R   K ++      A+K    V+Q   RG   R+ L   HQ+A +IQ  +R++   ++++  + + + IQ+++R +      + QY + RK  I +Q++ R     ++  +  +AAT IQ   + Y    K+   R SA IIQ+  R  L  ++ +             R FL          +A ++Q   RG+ VR  +     A  +IQ  +R    +  F  ++ AA+ LQ+  R    +    K + + R   +L+Q+  +G  +R+  Q+   ++ ++Q+ FR    H+ +L LK + + IQ+    N+    Q   Y+  R A+I++Q   RG   R +  R   AA ++Q  FR+Y    +    + +A IIQ  YR    G T R +FL  K S V +Q  F+ + +R     +    + IQ   RR+  +  F R + + +++Q+  R     R  VKQ    +KA + +Q  +R     +  Q    A+ +IQ++FR +   + +   + + + IQ   R  +       +++ I+ AT+++Q   RG  VR +     +    IQ   R      +F  ++ S   IQ  YR       + +N+  MK+S  V+Q   R +  R     + S  ++IQ  FRRF  +++++R     + +Q   R +  K     +Y K+R A +L+Q   +G   R+  +   ++   +QR  R     + ++ LK + + I +  R     N   K ++H              ++  + +RK +     A+  IQ+ FR Y ++ ++  ++    +IQ+R+R           F+ +KRSAVV+Q  +RG ++R
Sbjct:  701 DERWIEKQERGFTWWINYVLTPDDFKVNPE-VNKASAVSLAIGSDKFNVPRAPTKEEMSFSTYTARRKLNRLRRSACQLFTSEAMAKAIQRLELEVEARRLLVRKDRHLWRDIGERKKVLNWLLSYNPLWLRIGLE-TIFGEF-ICLESNSDTLGLAMFILQRLLWNPDIAAEYRHHRVPNLYKEGHEEALSRFTLKKLLLLVCFLDKAKECRLIEHNPCLFCVDAEFKATKDLLLAFSRDFLSGEGILPRHLGYLGLPVSHVQTPLDEFDFAVKNLAVDLKCGIRLARVMELLTLDWRLSAKLRLPAISRLQKIHNVDLALQVLKAKGIDLKDEHGSIIDSRDIVDGHREKTLSLLWKIIFAFHVEVILDENQLRQEIGFLRRTLRTKRRLARVRADQGIQPSPMKTRVSYEHTSTKITLLMEWVRAVCNFYNLKVENFTVMFSDGRVLCYLIHHYHPSLLPEASISHSTTQTVEGSPTGRLELDCSASDSDSSFDALKKGGPDSPSVVFKE-LLENEKSNFKLVNSAVAFLGGVPAMINLADMSNTIPDEKVVMTYLSFLCARLLDLHNETRAARVIQGAWRKYRLKKDLQLYEE----RNKAALKIQLMVRRFLQKRRAARRAQAAVLIQSAWRGFLAR-KILRMQKEALLRAVQHEAATIIQAHWRMFSAFKAYNQLRYYTVSVQAQWRMRRAAATYGKVCRAVRVLQKYSRAWALSRKQRDRYLLLRSSVVKLQRAFRRWKA-TKIEEENRAAVVIQAAFKKWYSHRMAT-KSAAAVRIQSWFRMQVCHRDYSQIRRSAVLIQ-AYHRGQVQRRRFQTLKLQHDSAVVIQRAFRGHVVRKQVLEMRQAAVVIQQRFRASVKRNAQRRAFLTMRCAAVAMQAVFRGKKARELLKKQHEAATVIQAAFRERAARKKYLALRKAAIRVQRRYRATVLARKTKTQYFALRKAALVLQASWRGRADRKKIEMWHRCATLIQASYRRHRIHAEFRSKKGAALVIQRRYRAFVAGKDIRGKFLQKRAASIALQAGFRGMRVRSELKRKHQAATVIQSWIRRFLCEKRYFLMQCAAIIIQSRYRALLLCRASQKEFRKQKQAAIKIQAVFRGLRVRQEHRKRIAAATAIQAHFRMYKMRMAYLAAKFAAIIIQERYRAKKLRDQERQRYKRIKSAAVVIQAAYRGCMVRRRMAERHRAAAIIQRMFLTIQARKQFLKLKSVALICQRRYRALSLARKFHLDYLSKRRAVVCLQAACRGYLVRKQLHVRQRAAVIIQSYFRMHQRKTRYRRLRWACRVVQERCRANKKMRVDMHAMKAVKNAAIVLQSAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKKQKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDR-------------RNFLNMKC------SAVVLQAAFRGHRVRTDVANMHSAAVVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQHAVKQYYKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKKQKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAALVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAETQKHQYQQIRKATILLQAVYRGQQVRKEVGHWHQAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRRDRRNFLRMKRSAVVLQAAFRGYRVRTDVANMHSAAVVIQSNFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYVTLKASVLNIQRRYRA----NMAAKTQKHQYQQIRKATILLQAVYRGQQVRKDVGHWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLRMKRSAVVLQAAFRGHRVR 2823          

HSP 2 Score: 401.749 bits (1031), Expect = 7.422e-112
Identity = 454/1791 (25.35%), Postives = 813/1791 (45.39%), Query Frame = 1
Query: 2092 YKEVIIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYL----ARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRK-----LEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQK----NYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAI----SARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIR---------------ALLQRR------------RYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQK-YQRRLICRKQ---FQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMY----RKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKT------------------------LNSHHQ---SATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQ----KYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLL----AATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIR----KNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQK----NVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYR----GYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQ----KKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICI----SKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIR--------------ANIVRTR-------------FLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFR----RFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLI----RKIFLKLKNASIIISKHVRGVLVRNHFQKNKQH----------------MKI-------FAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQ---RW----------------RFIVLKRSA------VVIQRIWRGRQLRCHL-NAK--KIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDLKESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRGVADLEVVSKVISVFFNLGKAGVLNFDVIGSE-FIKLVKNLLYR---NINSKRGTKGITIFCHTCLLLVLLIKMEQKS 6873
            ++   ++QS +RRFLC K++  ++   II QS  +  L    ++    K K++AI IQ  +R    R  + K  +A   +Q+HFR Y ++  YL    + +IIQ   R        K++R               R+++ ++  A VVIQ+A+RG   RR    + +AA IIQ  + +   R+ +L L+   +I Q+    +   RK     L KR R+ + +Q   RG++ R+     + A  I++ YF  + R+ ++ ++R +  ++Q+  R     N  +     A+                A K+A I++Q+  R +  RR  Q    AA +IQ++FR +   + +L    S + IQ+  R+ +  K     Y +I+++ +++Q   +G  V+K   +      + QS  R+Y  + ++  +R S  IIQ+ +RA+    + R+ FLN +   +V+Q   + H+ R     + S  + IQ N R                +LQ+R            +Y K +KA + +Q  +R  K ++ +   +QAA V+Q+ F+++   + +  +K SV  IQ+ Y+  +  +KQ   +Q+  K  ILLQ+  R    +K   +   A   I    + Y    K+ + R S  +IQ  +R  +     R+ FL++K SA+V+Q   RG   R    +  +A  VIQ N R F  +KT                        +  +H+   +A L+Q  YR  K R+    +  AA VIQ+ FR H   + Y   +  V+ IQ   R  +A +    +Y+Q++KA   +Q + +G  +RK+     ++A +IQ   R+Y     FQ  + S  IIQ+  R  L     +R  L    +A ++Q   RGY VR  +     A  +IQ+ +R    +  F  ++ AA+ LQ+  R    +    K + + R   +L+Q+  +G  +R+  Q+   ++ ++Q+ FR    H+ ++ LK + + IQ+    N+    Q   Y+  R A+I++Q   RG   R        AA ++Q  FR+Y    +    + +A IIQ  YR    G T R +FL  K S V +Q  F+ + +R     +    + IQ   RR+  +  F R + + +++Q+  R     +  VKQ    +KAV+ +Q  +R     +  Q    A+ +IQ++FR +   + +   + + +KIQ   R  +       +++ I+ AT+++Q   RG  VR +  +  +    IQ   R              A I++ R             FLN+K S + +Q+ +R H    +   M  +  VIQ N R+F  +K F   +   +++Q+ FR    +  A + Y +     + +Q+  RG  ++   Q+   A  +IQ++ + +   + Y  L+ SV+ +QR  R  ++    RKI+++ + A+++I +  R    R    +  +                 MKI       +A E+ +K++ + + IQ + R   Q+R Y   +   +  Q+   RW                +F+ +KR        V  Q +WR    R H  NAK  K+ H + +I     E ++  +K ++       AL  L   +   + +L  L +LE  T LS E C+ L++S A  ++  L+  CNR V  ++V++  I +  NL K       V   E  ++ + +LL R       K   KG +IF   C LL LL++ ++++
Sbjct: 1735 HQAATVIQSWIRRFLCEKRYFLMQCAAIIIQSRYRALLLCRASQKEFRKQKQAAIKIQAVFRGLRVRQEHRKRIAAATAIQAHFRMYKMRMAYLAAKFAAIIIQERYRA-------KKLRDQE------------RQRYKRIKSAAVVIQAAYRGCMVRRRMAERHRAAAIIQRMFLTIQARKQFLKLKSVALICQRRYRALSLARKFHLDYLSKR-RAVVCLQAACRGYLVRKQLHVRQRAAVIIQSYFRMHQRKTRYRRLRWACRVVQERCRA----NKKMRVDMHAMK---------------AVKNAAIVLQSAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKKQKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAAVVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQHAVKQYYKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKKQKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAALVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAETQKHQYQQIRKATILLQAVYRGQQVRKEVGHWHQAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRRDRRNFLRMKRSAVVLQAAFRGYRVRTDVANMHSAAVVIQSNFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYVTLKASVLNIQRRYRANMAAKTQKHQYQQIRKATILLQAVYRGQQVRKDVGHWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLRMKRSAVVLQAAFRGHRVRTDVANMHSAALVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQNAVKQYHKIRKAVVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKSSVLKIQRRYRANMAAKTQKHQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRRDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAAVVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQNAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMVAKGERKIYIQKRQATMLIQRSFRAWKARQQVVQAARAEKRLRFTAVVFHHLCAMKIQRALRAHWALESAKKQINSVVTIQRWLRARQQRRHYLEERGKVVTAQRAVRRWLAHRHKAASVIQLTVRKFLDVKRQQRVQRGIVKAQALWRAHCSRQHHDNAKLVKLRHRLRQISAEVREEDKLCNKTSS-------ALDYLLRYK-HFSYILEALQNLETATRLSPECCERLVQSGATNVIFTLIRCCNRSVPCMDVITFSIQILLNLSKYQKTIEAVYSVENSVETLLDLLQRYREKAGDKVAEKGGSIFTKACFLLALLLQDKRRA 3478          

HSP 3 Score: 377.096 bits (967), Expect = 2.400e-104
Identity = 389/1537 (25.31%), Postives = 725/1537 (47.17%), Query Frame = 1
Query: 2221 SKMKKSAILIQKNYRRYLCRIRYEKIK---SATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKR----IRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSV-CRRT---YLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLR----RKQFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALI----QRRKFQYLRNAAI-----------------------IIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQ----KNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAIS-ARKQFLNF--------------------------RKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAV----IFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQK-YQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQK----YLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFR----KHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIR----GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRRYCQ----MKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFR------KYLIIR----------RIDLE-----------QKAARIIQNFYRGYTIRAHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQ----CLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILR----KEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV----RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNL----SIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIR----KIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWR-----------FIVLKRSAVVIQRIWRGRQLR 6375
            S++++SA+LIQ  +R  + R R++ +K    + VV+Q  FR ++V+K  L++ ++ ++IQ   R  + R+  +R    +R +   +Q   +G  AR+   K  +A  VIQ+AFR  A R+ Y    KAA+ +Q  YR++V  R+T   Y  LRK+ +++Q        ++K+E   R   +IQ   R       F   K A  +++  +  ++     R +FL+ R + I LQ   R + +R+    K ++A +IQ   +R+  +K +   + A I+IQ++ RAL+     +++F+  + AAI                        IQ  FR Y +R  +L   ++AI+IQ+  R+   +    + Y +IK + +VIQ   +G +V++   +      I Q +      +KQ+LK++   +I Q+ +RA+S ARK  L++                          ++  +++Q Y +MHQ + ++ +L+     +Q+  RA  + R  +   KAV    I +Q  +R  K ++ +   +QAA V+Q+ F+++   + +  +K SV  IQ+ Y+  +  +KQ                    K +YQ+   AT+ +    +G   RK+   +  +  VIQ++FR +     F +++ SA +IQ+     L+G   R+ + +   +  V+Q   RG  VR  + + H +A +IQ  +R ++ +K F  +R AA+V+Q++FR    K +  +QY + RK  + +Q+  R   + +  +Q  +AA  IQ+  + +   + Y+T + S + IQ+  R  ++ K                     +S Y++   A  L+Q + RG  VRK +    +A  +IQ+ +R +     F   + +A  +Q+  R    G   R+NF   +   +++Q+  +G   R     + S+++++Q  FR F   K F + + A++ +Q+  R   Q    +K Y   R A++++Q   RG   R   Q++  AA ++QR FR       YL ++          R ++            +KA  ++Q  YRG  +R        +   IQ+ F+ Y    K+  +R     IQ     L++    R  FLR+K S +++Q   RGY           A + IQ NFRRF E KTF+  + A++++Q+ FR    +    K++ K RK  V +Q+  R        +    A  +IQ+  R       Y  +   V+ IQ+  RAN+     + ++  I+K+ I +Q+ YR     K+     ++ TVIQ   R++    +F  ++ +  IIQ+ +R  L  R+ +RN        + +Q+  RG   +     M +A ++IQ   + +  +K ++  + + + LQ+  R    +    K + K++ A +++    RG+  R          +I  QE+     +A+  IQ  FR + + R Y  LKS  L IQ+R+R           +  ++++ +++Q ++RG+Q+R
Sbjct: 1487 SQIRRSAVLIQAYHRGQVQRRRFQTLKLQHDSAVVIQRAFRGHVVRKQVLEMRQAAVVIQQRFRASVKRNAQRRAFLTMRCAAVAMQAVFRGKKARELLKKQHEAATVIQAAFRERAARKKYLALRKAAIRVQRRYRATVLARKTKTQYFALRKAALVLQASWRGRADRKKIEMWHRCATLIQASYRRHRIHAEFRSKKGAALVIQRRYRAFVAGKDIRGKFLQKRAASIALQAGFRGMRVRSELKRKHQAATVIQSWIRRFLCEKRYFLMQCAAIIIQSRYRALLLCRASQKEFRKQKQAAIKIQAVFRGLRVRQEHRKRIAAATAIQAHFRMYKMRMAYLAAKFAAIIIQERYRAKKLRDQERQRYKRIKSAAVVIQAAYRGCMVRRRMAERHRAAAIIQRMFLTIQARKQFLKLKSVALICQRRYRALSLARKFHLDYLSKRRAVVCLQAACRGYLVRKQLHVRQRAAVIIQSYFRMHQRKTRYRRLRWACRVVQERCRANKKMRVDMHAMKAVKNAAIVLQSAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKKQ--------------------KSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAAVVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQHAVKQYYKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKK-------------------QKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAALVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAETQKHQYQQIRKATILLQAVYRGQQVRKEVGHWHQAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRRDRRNFLRMKRSAVVLQAAFRGYRVRTDVANMHSAAVVIQSNFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYVTLKASVLNIQRRYRANMAAKTQKHQYQQIRKATILLQAVYRGQQVRKDVGHWHRAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGRTDRRNFLRMKRSAVVLQAAFRGHRVRTDVANMHSAALVIQANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKQNAVKQYHKIRKAVVLLQAAYRGMKSR----------RILQQEH-----QAAAVIQRSFRAHCEHRSYLTLKSSVLKIQRRYRANMAAKTQKHQYQQIRKATILLQAVYRGQQVR 2969          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 80.1073 bits (196), Expect = 3.459e-14
Identity = 50/151 (33.11%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQ--KFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI--ILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK 3744
            YL + +  K+R + + IQK  R   AR+++L  R+  I +QKY + HQ R+   FL+     +TIQ N+R  L+R+RY++ + A I IQ   R+   K+Q   +L  Q A ++QK+ + ++ K+ +R+   +V ++Q   RR+  +K+ +K
Sbjct:  753 YLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRK 903          

HSP 2 Score: 71.2478 bits (173), Expect = 1.746e-11
Identity = 60/239 (25.10%), Postives = 113/239 (47.28%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNL--RKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNL 2883
            C+ ++++ +      +  K+ I  +     YL ++R +K++ A V +Q   R +L ++ YLK  RS++                        IQKY +G+ AR+   F++ T+A V IQ   R + +R+ Y  +  AA+ IQS  R+ + ++ Y  L   +  +IIQK V   L K+   + L + +++Q  +R    ++   K K     +EH+      +   + M N ++ LQ+ L
Sbjct:  723 CKDLLEKLIKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVI-----------------------TIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHF------KNLNVGMENKIVQLQQKL 932          

HSP 3 Score: 67.3958 bits (163), Expect = 2.707e-10
Identity = 46/138 (33.33%), Postives = 75/138 (54.35%), Query Frame = 1
Query: 5590 RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQS--ITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNL--SIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVK 5991
            +L+  K+    V IQK IR  + R ++L  ++S+I IQ + R H   +    ++Q+     IQ N R ++ RKR+L+ +S  I IQ   R  +AK+ Y + L     + +Q  VRG LAK  Y++   A +L+Q  V+
Sbjct:  756 KLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVR 893          

HSP 4 Score: 67.0106 bits (162), Expect = 3.340e-10
Identity = 53/201 (26.37%), Postives = 103/201 (51.24%), Query Frame = 1
Query: 5236 YISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQK-----NFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKF--KMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQL-MKQSITVIQKNCRKFIARKRFLE 5814
            Y+ + R  +L+++ + IQK  R +   RKY+K +++VI IQK       RR+ +   F     A++ IQ N R ++ RK + +KR   + IQS +R ++   ++   + +   +IIQK +RG   +  Y++ +  VV +Q  +R    +     +K    +++ F  ++   +N  + ++Q +   QK  ++F  R   LE
Sbjct:  753 YLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVD---FLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLE 950          

HSP 5 Score: 64.6994 bits (156), Expect = 1.518e-9
Identity = 43/131 (32.82%), Postives = 76/131 (58.02%), Query Frame = 1
Query: 4510 LAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSH--FICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL--RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRR 4890
            LA   IQK  R +L R++ +  +++V  IQ + R H  R +  F+ Q  AA+ +Q N+R +L RK + + R+  I +QS+++  +A++ Y KL     ++I+QK  RG+ A + + +   A + +Q  VRR
Sbjct:  764 LACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRR 894          

HSP 6 Score: 63.929 bits (154), Expect = 2.999e-9
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRK--IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNET--RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
             Y  + +    R + + IQ + RC++ R+ +L  + S I IQKY RG   R+   +  QT A   IQ N+R +L                        RK ++ KR+AAI IQ   R H  +QQY +    +K + IQ  +R ++A Q Y++   A   +Q
Sbjct:  752 AYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLE-----------------------RKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQ 889          

HSP 7 Score: 62.7734 bits (151), Expect = 5.447e-9
Identity = 42/140 (30.00%), Postives = 82/140 (58.57%), Query Frame = 1
Query: 2140 LKKFKSIKMRI--IICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCR--IRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRI--RKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFR 2541
            L+K +S K+R+  +  Q  ++ +LAR +  K ++S I IQK  R +  R  + + +   A V +Q + R +L +K YL+   + + IQ+ +R ++ +  Y ++   +   IIQK+V+G+LA++ + +   A+V++QS  R
Sbjct:  754 LEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVR 893          

HSP 8 Score: 61.6178 bits (148), Expect = 1.507e-8
Identity = 52/166 (31.33%), Postives = 80/166 (48.19%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR--AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRL--KMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK 5406
            R A + IQK +R +L R                 RKYL  RR      +   IQ + RG+  R    FL Q  + VTIQ   + +L RK+YL+ R   I IQ ++R ++++ ++ +L  +   +IIQK  RG+   + Y +   AV+ +Q   RR    K  + LK
Sbjct:  763 RLACVSIQKTIRCWLAR-----------------RKYLKTRR------SVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          

HSP 9 Score: 61.2326 bits (147), Expect = 1.844e-8
Identity = 44/138 (31.88%), Postives = 79/138 (57.25%), Query Frame = 1
Query: 3415 IVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYI---KNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKM--KESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK 3813
            + +QK I+    R+K+LK +  VITIQK  R   Q RRY+   +  +A + IQ   R   E+K+ +    AA  +Q   ++++ K+Q+ K+  ++   +IQK+ R  + ++ +++ +  V+LLQS +R I  KK  +K
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRG-HQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRK 903          

HSP 10 Score: 60.8474 bits (146), Expect = 2.538e-8
Identity = 51/194 (26.29%), Postives = 90/194 (46.39%), Query Frame = 1
Query: 3025 ALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKL--KSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            A +++ +   LR A + IQKT RC+  R+K                       YLK ++SV+ IQK+T+G                     R+Y+    +L+  ++ + IQ + R    RK++L  R   I +Q  ++ H  +Q++ KL  + + + IQK +R  L ++ Y +   AV+ +Q   R  K KK++
Sbjct:  752 AYLEKLRSDKLRLACVSIQKTIRCWLARRK-----------------------YLKTRRSVITIQKYTRGH------------------QARRYV---DFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKEL 901          

HSP 11 Score: 60.077 bits (144), Expect = 3.582e-8
Identity = 48/141 (34.04%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 5548 ATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVR--TRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRF--LEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR 5958
            A + IQK IR    R KY K  + V+ IQK  R +  R    FL   ++ + IQ   RM  E K Y   + +   IQ   R  +A++++  L  +   +IIQK+ R +LAK+ Y+R L+ ++ +QS VR   AK + +K++
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          

HSP 12 Score: 58.9214 bits (141), Expect = 1.016e-7
Identity = 55/250 (22.00%), Postives = 113/250 (45.20%), Query Frame = 1
Query: 3616 AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRK--QFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHF------------------YRSYKIRKNF-----ICKRNAAIVIQKQFRK-HYIRQQYNETRKKVIFIQSLIRQFIAIQK 4287
            A   +QK  + ++ ++++ K + SV  IQKY R    R+   F ++ +  + +Q  +RM + +KRY +K +A + I   ++ + A+++Y                  Y+ +F   +  A++IQK++RG++ ++ Y     A+ ++Q  +R    +K L      A  ++HF                      K  K F     + ++   +  ++Q R+   +R+   ETR K   + SL+ Q   +Q+
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQY------------------YKLLF---EQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLEKTLTLERERQSREIESLRRSEEETRAKAETVPSLLEQLSFLQQ 993          

HSP 13 Score: 55.8398 bits (133), Expect = 7.641e-7
Identity = 38/138 (27.54%), Postives = 76/138 (55.07%), Query Frame = 1
Query: 2104 IIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRIS--KMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIY--RSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKL 2505
            + +Q  +R +L  +K+   +  +I  Q   + + AR  +   +  ++A+ IQ N R +L R RY + +SA + +QS  R ++ ++ Y K+   +  +IIQ  +RG+L + +Y+R   +  ++Q  V+   A+K+  KL
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKL 904          

HSP 14 Score: 55.0694 bits (131), Expect = 1.287e-6
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRK--IFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRG 6363
            L KL+  K+R A + IQKT++ +  R+ Y   ++SVI +Q++ RG   R+   FL+   A++ I  +VR  L R  +              L+KR  A+I IQ+  R ++ K++Y     Y LL +Q+         AV+IQ+  RG
Sbjct:  754 LEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRY--------------LQKR-SAAIAIQSMLRAHMAKQQY-----YKLLFEQK---------AVIIQKWVRG 871          

HSP 15 Score: 54.6842 bits (130), Expect = 1.561e-6
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 4726 ILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHK--KFLKLKNASICIQKNVRRYCQMKLYRDTRNASI-------------------------VIQKYVRGFLCRIKYQRQLLAAIILQ---RHFRKYLIIRRIDLEQKAARIIQNFYRG 5097
            + +Q  ++ ++AR+ Y K R S I +QK  RG  A +   FL+   A++ IQ NVR + + K Y   R+A+I                         +IQK+VRG+L +  Y+R L A ++LQ   R  +    +R++ +E ++    +N   G
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVG 920          

HSP 16 Score: 53.5286 bits (127), Expect = 3.470e-6
Identity = 49/176 (27.84%), Postives = 88/176 (50.00%), Query Frame = 1
Query: 4306 AATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFN 4827
            A   IQK  + ++ R+KY+  RRS + IQK  R +                    RR++    + R+  AA  IQ   R +L RKR + ++ A   IQ+  RAH  +  +  +  +  A+ +QK +RG+L ++++  T   ++L+QS ++   A+K  +KL+  +  V+  F+  N
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGH------------------QARRYV---DFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEH-FKNLN 918          

HSP 17 Score: 53.5286 bits (127), Expect = 4.210e-6
Identity = 43/164 (26.22%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYL--RNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIK 3198
            +C+ IQK IR ++ RR +LK + +V  ++ Y  G+  R+   FL+   + + +Q N+RM                       +  +K ++ K+SA I IQ+ +RA + ++++  L     A+IIQK  R +  ++ +     + +++Q  VR I  +K   K+K
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRM-----------------------WLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Match: myo5ab (unconventional myosin-Va [Source:NCBI gene;Acc:101173462])

HSP 1 Score: 79.7221 bits (195), Expect = 3.881e-14
Identity = 50/151 (33.11%), Postives = 89/151 (58.94%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQ--KFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI--ILNNQAATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRKQFQK 3744
            YL + +  K+R + + IQK  R   AR+++L  R+  I +QKY + HQ R+   FL+     +TIQ N+R  L+R+RY++ + A I IQ   R+   K+Q   +L  Q A ++QK+ + ++ K+ +R+   +V ++Q   RR+  +K+ +K
Sbjct:  753 YLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRK 903          

HSP 2 Score: 71.2478 bits (173), Expect = 1.786e-11
Identity = 60/239 (25.10%), Postives = 113/239 (47.28%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARK--KFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNL--RKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNL 2883
            C+ ++++ +      +  K+ I  +     YL ++R +K++ A V +Q   R +L ++ YLK  RS++                        IQKY +G+ AR+   F++ T+A V IQ   R + +R+ Y  +  AA+ IQS  R+ + ++ Y  L   +  +IIQK V   L K+   + L + +++Q  +R    ++   K K     +EH+      +   + M N ++ LQ+ L
Sbjct:  723 CKDLLEKLIKNQEKYQFGKNKIFFRAGQVAYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVI-----------------------TIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHF------KNLNVGMENKIVQLQQKL 932          

HSP 3 Score: 67.3958 bits (163), Expect = 2.656e-10
Identity = 46/138 (33.33%), Postives = 75/138 (54.35%), Query Frame = 1
Query: 5590 RLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQS--ITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNL--SIIIFVQSLVRGKLAKLKYQKMRTATILIQKTVK 5991
            +L+  K+    V IQK IR  + R ++L  ++S+I IQ + R H   +    ++Q+     IQ N R ++ RKR+L+ +S  I IQ   R  +AK+ Y + L     + +Q  VRG LAK  Y++   A +L+Q  V+
Sbjct:  756 KLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVR 893          

HSP 4 Score: 66.6254 bits (161), Expect = 3.878e-10
Identity = 53/201 (26.37%), Postives = 103/201 (51.24%), Query Frame = 1
Query: 5236 YISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQK-----NFRRFSELKTFQNLKNASIIIQKNFRCYILRKEFKKKRKNCVKIQSYIRRYICISKF--KMIKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQL-MKQSITVIQKNCRKFIARKRFLE 5814
            Y+ + R  +L+++ + IQK  R +   RKY+K +++VI IQK       RR+ +   F     A++ IQ N R ++ RK + +KR   + IQS +R ++   ++   + +   +IIQK +RG   +  Y++ +  VV +Q  +R    +     +K    +++ F  ++   +N  + ++Q +   QK  ++F  R   LE
Sbjct:  753 YLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVD---FLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLE 950          

HSP 5 Score: 64.6994 bits (156), Expect = 1.553e-9
Identity = 43/131 (32.82%), Postives = 76/131 (58.02%), Query Frame = 1
Query: 4510 LAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSH--FICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKL--RSSSIIVQKIFRGFNAHKKFLKLKNASICIQKNVRR 4890
            LA   IQK  R +L R++ +  +++V  IQ + R H  R +  F+ Q  AA+ +Q N+R +L RK + + R+  I +QS+++  +A++ Y KL     ++I+QK  RG+ A + + +   A + +Q  VRR
Sbjct:  764 LACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRR 894          

HSP 6 Score: 63.5438 bits (153), Expect = 3.452e-9
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRK--IYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNET--RKKVIFIQSLIRQFIAIQKYKQMKKAATYIQ 4323
             Y  + +    R + + IQ + RC++ R+ +L  + S I IQKY RG   R+   +  QT A   IQ N+R +L                        RK ++ KR+AAI IQ   R H  +QQY +    +K + IQ  +R ++A Q Y++   A   +Q
Sbjct:  752 AYLEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLE-----------------------RKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQ 889          

HSP 7 Score: 62.7734 bits (151), Expect = 5.482e-9
Identity = 42/140 (30.00%), Postives = 82/140 (58.57%), Query Frame = 1
Query: 2140 LKKFKSIKMRI--IICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCR--IRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRI--RKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFR 2541
            L+K +S K+R+  +  Q  ++ +LAR +  K ++S I IQK  R +  R  + + +   A V +Q + R +L +K YL+   + + IQ+ +R ++ +  Y ++   +   IIQK+V+G+LA++ + +   A+V++QS  R
Sbjct:  754 LEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVR 893          

HSP 8 Score: 61.2326 bits (147), Expect = 1.809e-8
Identity = 52/166 (31.33%), Postives = 80/166 (48.19%), Query Frame = 1
Query: 4921 RNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR--AHFLCQKNSCVTIQNYFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRL--KMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLK 5406
            R A + IQK +R +L R                 RKYL  RR      +   IQ + RG+  R    FL Q  + VTIQ   + +L RK+YL+ R   I IQ ++R ++++ ++ +L  +   +IIQK  RG+   + Y +   AV+ +Q   RR    K  + LK
Sbjct:  763 RLACVSIQKTIRCWLAR-----------------RKYLKTRR------SVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          

HSP 9 Score: 61.2326 bits (147), Expect = 1.935e-8
Identity = 44/138 (31.88%), Postives = 79/138 (57.25%), Query Frame = 1
Query: 3415 IVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYI---KNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYICKKQFRKM--KESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKRYQK 3813
            + +QK I+    R+K+LK +  VITIQK  R   Q RRY+   +  +A + IQ   R   E+K+ +    AA  +Q   ++++ K+Q+ K+  ++   +IQK+ R  + ++ +++ +  V+LLQS +R I  KK  +K
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRG-HQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRK 903          

HSP 10 Score: 60.4622 bits (145), Expect = 2.664e-8
Identity = 51/194 (26.29%), Postives = 90/194 (46.39%), Query Frame = 1
Query: 3025 ALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKL--KSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRSCKEKKQI 3600
            A +++ +   LR A + IQKT RC+  R+K                       YLK ++SV+ IQK+T+G                     R+Y+    +L+  ++ + IQ + R    RK++L  R   I +Q  ++ H  +Q++ KL  + + + IQK +R  L ++ Y +   AV+ +Q   R  K KK++
Sbjct:  752 AYLEKLRSDKLRLACVSIQKTIRCWLARRK-----------------------YLKTRRSVITIQKYTRGH------------------QARRYV---DFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKEL 901          

HSP 11 Score: 60.077 bits (144), Expect = 3.545e-8
Identity = 48/141 (34.04%), Postives = 76/141 (53.90%), Query Frame = 1
Query: 5548 ATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIVR--TRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQKNCRKFIARKRF--LEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRGKLAKLKYQKMR 5958
            A + IQK IR    R KY K  + V+ IQK  R +  R    FL   ++ + IQ   RM  E K Y   + +   IQ   R  +A++++  L  +   +IIQK+ R +LAK+ Y+R L+ ++ +QS VR   AK + +K++
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          

HSP 12 Score: 58.5362 bits (140), Expect = 1.190e-7
Identity = 55/250 (22.00%), Postives = 113/250 (45.20%), Query Frame = 1
Query: 3616 AATVVQKYFKSYICKKQFRKMKESVTVIQKYQRRLICRK--QFQKEMKLVILLQSKIRMIITKKRYQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHF------------------YRSYKIRKNF-----ICKRNAAIVIQKQFRK-HYIRQQYNETRKKVIFIQSLIRQFIAIQK 4287
            A   +QK  + ++ ++++ K + SV  IQKY R    R+   F ++ +  + +Q  +RM + +KRY +K +A + I   ++ + A+++Y                  Y+ +F   +  A++IQK++RG++ ++ Y     A+ ++Q  +R    +K L      A  ++HF                      K  K F     + ++   +  ++Q R+   +R+   ETR K   + SL+ Q   +Q+
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQY------------------YKLLF---EQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVGMENKIVQLQQKLNEQQKENKEFSERLSVLEKTLTLERERQSREIESLRRSEEETRAKAETVPSLLEQLSFLQQ 993          

HSP 13 Score: 55.8398 bits (133), Expect = 8.091e-7
Identity = 38/138 (27.54%), Postives = 76/138 (55.07%), Query Frame = 1
Query: 2104 IIVQSIVRRFLCLKKFKSIKMRIIICQSVVKRYLARHRIS--KMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIY--RSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKL 2505
            + +Q  +R +L  +K+   +  +I  Q   + + AR  +   +  ++A+ IQ N R +L R RY + +SA + +QS  R ++ ++ Y K+   +  +IIQ  +RG+L + +Y+R   +  ++Q  V+   A+K+  KL
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKL 904          

HSP 14 Score: 55.0694 bits (131), Expect = 1.374e-6
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRK--IFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRG 6363
            L KL+  K+R A + IQKT++ +  R+ Y   ++SVI +Q++ RG   R+   FL+   A++ I  +VR  L R  +              L+KR  A+I IQ+  R ++ K++Y     Y LL +Q+         AV+IQ+  RG
Sbjct:  754 LEKLRSDKLRLACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRY--------------LQKR-SAAIAIQSMLRAHMAKQQY-----YKLLFEQK---------AVIIQKWVRG 871          

HSP 15 Score: 54.6842 bits (130), Expect = 1.724e-6
Identity = 44/154 (28.57%), Postives = 75/154 (48.70%), Query Frame = 1
Query: 4726 ILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHK--KFLKLKNASICIQKNVRRYCQMKLYRDTRNASI-------------------------VIQKYVRGFLCRIKYQRQLLAAIILQ---RHFRKYLIIRRIDLEQKAARIIQNFYRG 5097
            + +Q  ++ ++AR+ Y K R S I +QK  RG  A +   FL+   A++ IQ NVR + + K Y   R+A+I                         +IQK+VRG+L +  Y+R L A ++LQ   R  +    +R++ +E ++    +N   G
Sbjct:  767 VSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEHFKNLNVG 920          

HSP 16 Score: 53.5286 bits (127), Expect = 3.675e-6
Identity = 49/176 (27.84%), Postives = 88/176 (50.00%), Query Frame = 1
Query: 4306 AATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVRQYLXXXXXXXXXXXXXXXXXYVRRFLMRSVYKRKLLAATLIQKIARGYLVRKRIVVEQKAVRIIQNFYRAHTIRSHF--ICQKNAAIKLQKNIRGYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFN 4827
            A   IQK  + ++ R+KY+  RRS + IQK  R +                    RR++    + R+  AA  IQ   R +L RKR + ++ A   IQ+  RAH  +  +  +  +  A+ +QK +RG+L ++++  T   ++L+QS ++   A+K  +KL+  +  V+  F+  N
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGH------------------QARRYV---DFLRQTRAAVTIQCNVRMWLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLKVEARSVEH-FKNLN 918          

HSP 17 Score: 53.1434 bits (126), Expect = 4.849e-6
Identity = 43/164 (26.22%), Postives = 82/164 (50.00%), Query Frame = 1
Query: 2719 SCIIIQKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK--QFLKMRNSVILLQKNLRMLSLRNSFLXXXXXXXXXXXXXXRYFAKKEFVAKKSATILIQTKVRALIQRRKFQYL--RNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIK 3198
            +C+ IQK IR ++ RR +LK + +V  ++ Y  G+  R+   FL+   + + +Q N+RM                       +  +K ++ K+SA I IQ+ +RA + ++++  L     A+IIQK  R +  ++ +     + +++Q  VR I  +K   K+K
Sbjct:  765 ACVSIQKTIRCWLARRKYLKTRRSVITIQKYTRGHQARRYVDFLRQTRAAVTIQCNVRM-----------------------WLERKRYLQKRSAAIAIQSMLRAHMAKQQYYKLLFEQKAVIIQKWVRGWLAKQHYRRTLAAVVLLQSCVRRIKAKKELRKLK 905          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Match: myo5c (myosin VC [Source:NCBI gene;Acc:101162444])

HSP 1 Score: 71.633 bits (174), Expect = 1.306e-11
Identity = 47/176 (26.70%), Postives = 95/176 (53.98%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK-----------IIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKA--AVIIQSFYRSSVCRRTYLNLRKSVIIIQ 2667
            C+ V++R +      K  ++ I  +     YL ++R ++++ A V++Q HFR +  ++ YL+I  + +++Q  IRG       K IRK+             +IQ++ +GY  R+ +  + +A + IQ+  RG+  R+ Y   ++A  A+I+Q + R+ + RR +  +R+ V+ +Q
Sbjct:  570 CKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG------QKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 739          

HSP 2 Score: 66.6254 bits (161), Expect = 3.568e-10
Identity = 50/160 (31.25%), Postives = 89/160 (55.62%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS-C-KEKKQIILNNQAATVVQKYFKSYICKKQFRKMKES--VTVIQKYQRRLICRKQFQKEMKLVILLQ 3771
            YL + +  ++R++ +IIQKHFRA S R+++L  R   IV+Q+YI+  +             TI+K + A       +K   A + IQR +R  C ++  Q +   QA   +Q + + ++ +KQ++KM E+    ++QKY R  + R++FQ   +LV+ +Q
Sbjct:  600 YLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQK-------------TIRKTVTA-----EALKQGWAAVVIQRHWRGYCMRQIYQAVC--QATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 739          

HSP 3 Score: 64.6994 bits (156), Expect = 1.430e-9
Identity = 49/153 (32.03%), Postives = 89/153 (58.17%), Query Frame = 1
Query: 3025 ALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVI------QKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKS--TIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQK 3459
            A +++ +   LR A +IIQK FR +S R+K+L    +AIV+      QK +R  +  +  LK   + +VIQ+H +G+ +++ Y+ +    I  Q+  R ++ +KQY K+ ++   +I+QK+ RA  AR++F   R+  + VQ   ++ Q R+K
Sbjct:  599 AYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAE-ALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKK 750          

HSP 4 Score: 60.8474 bits (146), Expect = 2.564e-8
Identity = 42/150 (28.00%), Postives = 80/150 (53.33%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKK-----FLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLA--AIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR 5109
             YL +      R   +++Q   + +  R+ Y ++R ++I++Q+  RG    +K      LK   A++ IQ++ R YC  ++Y+    A+I IQ + RG++ R +Y++ + A  A+ILQ++ R +L  RR    Q   R++ N    Y ++
Sbjct:  599 AYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRF---QTMRRLVLNVQLSYRVQ 745          

HSP 5 Score: 60.077 bits (144), Expect = 3.560e-8
Identity = 50/182 (27.47%), Postives = 88/182 (48.35%), Query Frame = 1
Query: 3853 GYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKA--ATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
             Y  + +    R + ++IQ  FR +  R+ +L I+ +AIV+Q+Y+RG                 QK IR     KT+ +      L Q +               AA+VIQ+ +R + +RQ Y    +  I IQ+  R ++A ++YK+M +A  A  +QK  + ++ R+++ T RR  + +Q
Sbjct:  599 AYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG-----------------QKTIR-----KTVTAE----ALKQGW---------------AAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 739          

HSP 6 Score: 58.9214 bits (141), Expect = 7.786e-8
Identity = 39/130 (30.00%), Postives = 69/130 (53.08%), Query Frame = 1
Query: 5788 FIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRG-----KLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNA--SIIISKHVRGVLVRNHFQ 6156
            ++ + R   ++   +IIQK FR +  +R Y R     I +Q  +RG     K    +  K   A ++IQ+  +GY +R+ Y+ + ++ I +Q F RG++ RK + K+  A  ++I+ K+ R  L R  FQ
Sbjct:  600 YLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQ 729          

HSP 7 Score: 58.9214 bits (141), Expect = 8.120e-8
Identity = 52/198 (26.26%), Postives = 101/198 (51.01%), Query Frame = 1
Query: 5155 YFKAYLIRKKYLE--IRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCY-ILRK----EFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL--VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMH 5721
            ++  Y I   +LE  +R K    +C+++R I      +   + I  +     Y    +  + ++A + IQK+FR +S+ + +  +++A+I++Q+  R    +RK    E  K+    V IQ + R Y     ++ +  AT+ IQ   RG   R +YKK+++    + +QK  RA + R RF  +++ ++N+Q  YR+ 
Sbjct:  548 FYSRYSILMSHLEADVRDKKETCKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQ 745          

HSP 8 Score: 58.9214 bits (141), Expect = 8.613e-8
Identity = 44/152 (28.95%), Postives = 83/152 (54.61%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRA--HFLCQKNSCVTIQNYFKAYLIRKKYLEIRQ--KTIFIQCLVRRYISRNRFLRLKMSVIIIQ 5289
            +L+ A + IQK+ R + Q + Y   R+A+IV+Q+Y+RG     K  R+ + A  L++ +              AA +IQ  +RGY +R     +CQ  + +TIQ + + ++ RK+Y ++ +  K + +Q   R +++R RF  ++  V+ +Q
Sbjct:  608 RLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG----QKTIRKTVTAEALKQGW--------------AAVVIQRHWRGYCMRQIYQAVCQ--ATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 739          

HSP 9 Score: 56.225 bits (134), Expect = 5.816e-7
Identity = 53/201 (26.37%), Postives = 101/201 (50.25%), Query Frame = 1
Query: 2329 FRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAK-RRNYTI----QIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS--CIIIQKYIRGFINRRNFLKFKSAV-NILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNS 2907
             +R +   N  K  R+ +  +     YL +    R+R++  IIQK+ + +  R+K++++  A +V+Q   RG    R+  T     Q  AAV+IQ  +R    R+ Y  + ++ I IQ      + +++ +K + +   +I+QKY R ++ RR F   +  V N+   Y +  LR+K   + + +  L++K   + +L NS
Sbjct:  574 LQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKKIEEQTKENRGLMEK---LTTLANS 771          

HSP 10 Score: 53.9138 bits (128), Expect = 2.666e-6
Identity = 53/180 (29.44%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGF-LIRKIF----LKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY---------CLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRN 6426
            L KL+  ++R A ++IQK  + +  R+ Y  ++ + I LQ++IRG   IRK      LK   A+++I +H RG  +R  +Q   Q               A+I IQA+ R ++ +++Y          +L+ YT     R RF  ++R  + +Q  +R +QLR     KKI  +  E R 
Sbjct:  601 LEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQ---------------ATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLR-----KKIEEQTKENRG 760          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Match: myo5c (myosin VC [Source:NCBI gene;Acc:101162444])

HSP 1 Score: 71.633 bits (174), Expect = 1.377e-11
Identity = 47/176 (26.70%), Postives = 95/176 (53.98%), Query Frame = 1
Query: 2179 CQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKSATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTK-----------IIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKA--AVIIQSFYRSSVCRRTYLNLRKSVIIIQ 2667
            C+ V++R +      K  ++ I  +     YL ++R ++++ A V++Q HFR +  ++ YL+I  + +++Q  IRG       K IRK+             +IQ++ +GY  R+ +  + +A + IQ+  RG+  R+ Y   ++A  A+I+Q + R+ + RR +  +R+ V+ +Q
Sbjct:  586 CKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG------QKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 755          

HSP 2 Score: 66.6254 bits (161), Expect = 3.576e-10
Identity = 50/160 (31.25%), Postives = 89/160 (55.62%), Query Frame = 1
Query: 3304 YLLQKQYLKVRKSTIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNIRALLQRRRYIKNKKAVIFIQRKFRS-C-KEKKQIILNNQAATVVQKYFKSYICKKQFRKMKES--VTVIQKYQRRLICRKQFQKEMKLVILLQ 3771
            YL + +  ++R++ +IIQKHFRA S R+++L  R   IV+Q+YI+  +             TI+K + A       +K   A + IQR +R  C ++  Q +   QA   +Q + + ++ +KQ++KM E+    ++QKY R  + R++FQ   +LV+ +Q
Sbjct:  616 YLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQK-------------TIRKTVTA-----EALKQGWAAVVIQRHWRGYCMRQIYQAVC--QATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 755          

HSP 3 Score: 64.6994 bits (156), Expect = 1.421e-9
Identity = 49/153 (32.03%), Postives = 89/153 (58.17%), Query Frame = 1
Query: 3025 ALIQRRKFQYLRNAAIIIQKTFRCYSVRKKFLIQYYSAIVI------QKNVRSIICQKNYLKIKQSVLVIQKHTKGFLVXXXXXXXXXXXXXCQSLVRKYLLQKQYLKVRKS--TIIIQKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQK 3459
            A +++ +   LR A +IIQK FR +S R+K+L    +AIV+      QK +R  +  +  LK   + +VIQ+H +G+ +++ Y+ +    I  Q+  R ++ +KQY K+ ++   +I+QK+ RA  AR++F   R+  + VQ   ++ Q R+K
Sbjct:  615 AYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAE-ALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKK 766          

HSP 4 Score: 60.8474 bits (146), Expect = 2.547e-8
Identity = 42/150 (28.00%), Postives = 80/150 (53.33%), Query Frame = 1
Query: 4681 GYLIRKNFTETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKK-----FLKLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLA--AIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIR 5109
             YL +      R   +++Q   + +  R+ Y ++R ++I++Q+  RG    +K      LK   A++ IQ++ R YC  ++Y+    A+I IQ + RG++ R +Y++ + A  A+ILQ++ R +L  RR    Q   R++ N    Y ++
Sbjct:  615 AYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRF---QTMRRLVLNVQLSYRVQ 761          

HSP 5 Score: 60.077 bits (144), Expect = 3.783e-8
Identity = 49/171 (28.65%), Postives = 85/171 (49.71%), Query Frame = 1
Query: 3886 RHSVIVIQNSFRCFMYRKMFLSIKFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSATLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQSLIRQFIAIQKYKQMKKA--ATYIQKIAKGYIIRKKYVTQRRSAVIIQ 4392
            R + ++IQ  FR +  R+ +L I+ +AIV+Q+Y+RG                 QK IR     KT+ +      L Q +               AA+VIQ+ +R + +RQ Y    +  I IQ+  R ++A ++YK+M +A  A  +QK  + ++ R+++ T RR  + +Q
Sbjct:  626 REACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG-----------------QKTIR-----KTVTAE----ALKQGW---------------AAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 755          

HSP 6 Score: 59.3066 bits (142), Expect = 7.170e-8
Identity = 39/130 (30.00%), Postives = 69/130 (53.08%), Query Frame = 1
Query: 5788 FIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIFVQSLVRG-----KLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGFLIRKIFLKLKNA--SIIISKHVRGVLVRNHFQ 6156
            ++ + R   ++   +IIQK FR +  +R Y R     I +Q  +RG     K    +  K   A ++IQ+  +GY +R+ Y+ + ++ I +Q F RG++ RK + K+  A  ++I+ K+ R  L R  FQ
Sbjct:  616 YLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQ 745          

HSP 7 Score: 58.9214 bits (141), Expect = 8.272e-8
Identity = 52/198 (26.26%), Postives = 101/198 (51.01%), Query Frame = 1
Query: 5155 YFKAYLIRKKYLE--IRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRGYFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCY-ILRK----EFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYKKIIKL--VVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMH 5721
            ++  Y I   +LE  +R K    +C+++R I      +   + I  +     Y    +  + ++A + IQK+FR +S+ + +  +++A+I++Q+  R    +RK    E  K+    V IQ + R Y     ++ +  AT+ IQ   RG   R +YKK+++    + +QK  RA + R RF  +++ ++N+Q  YR+ 
Sbjct:  564 FYSRYSILMSHLEADVRDKKETCKCVLQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQ 761          

HSP 8 Score: 58.9214 bits (141), Expect = 8.342e-8
Identity = 44/152 (28.95%), Postives = 83/152 (54.61%), Query Frame = 1
Query: 4846 KLKNASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAIILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRA--HFLCQKNSCVTIQNYFKAYLIRKKYLEIRQ--KTIFIQCLVRRYISRNRFLRLKMSVIIIQ 5289
            +L+ A + IQK+ R + Q + Y   R+A+IV+Q+Y+RG     K  R+ + A  L++ +              AA +IQ  +RGY +R     +CQ  + +TIQ + + ++ RK+Y ++ +  K + +Q   R +++R RF  ++  V+ +Q
Sbjct:  624 RLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRG----QKTIRKTVTAEALKQGW--------------AAVVIQRHWRGYCMRQIYQAVCQ--ATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQ 755          

HSP 9 Score: 56.225 bits (134), Expect = 5.538e-7
Identity = 53/201 (26.37%), Postives = 101/201 (50.25%), Query Frame = 1
Query: 2329 FRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAK-RRNYTI----QIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRS--CIIIQKYIRGFINRRNFLKFKSAV-NILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRNS 2907
             +R +   N  K  R+ +  +     YL +    R+R++  IIQK+ + +  R+K++++  A +V+Q   RG    R+  T     Q  AAV+IQ  +R    R+ Y  + ++ I IQ      + +++ +K + +   +I+QKY R ++ RR F   +  V N+   Y +  LR+K   + + +  L++K   + +L NS
Sbjct:  590 LQRLIHDTNQYKFGRTKIFFRAGQVAYLEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLRKKIEEQTKENRGLMEK---LTTLANS 787          

HSP 10 Score: 53.9138 bits (128), Expect = 2.693e-6
Identity = 53/180 (29.44%), Postives = 88/180 (48.89%), Query Frame = 1
Query: 5929 LAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRFIRGF-LIRKIF----LKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRKRLEASIKIQAYFRCYIQKRRY---------CLLKSYTLLIQQRWRFIVLKRSAVVIQRIWRGRQLRCHLNAKKIGHEISEIRN 6426
            L KL+  ++R A ++IQK  + +  R+ Y  ++ + I LQ++IRG   IRK      LK   A+++I +H RG  +R  +Q   Q               A+I IQA+ R ++ +++Y          +L+ YT     R RF  ++R  + +Q  +R +QLR     KKI  +  E R 
Sbjct:  617 LEKLRLDRLREACVIIQKHFRAWSQRRKYLRIRDAAIVLQQYIRGQKTIRKTVTAEALKQGWAAVVIQRHWRGYCMRQIYQAVCQ---------------ATITIQAFTRGWMARKQYKKMMEAHKAMILQKYTRAWLARRRFQTMRRLVLNVQLSYRVQQLR-----KKIEEQTKENRG 776          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.007e-8
Identity = 54/160 (33.75%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 2362 KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKR-KLEKRLRSCIII-QKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK 2835
            KI  S+ +IQ+ +RG + R  Y  I K T  IQ Y++  LA +K  KL+                     QI+A +IIQSFYR  + R+ ++ ++ +V+ I+K   K++  R K   +  +C+II Q  +R FI RR FLK +  V +++++   Y RRK
Sbjct:  773 KIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLS---------------------QIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNH---YRRRK 908          

HSP 2 Score: 52.7582 bits (125), Expect = 5.467e-6
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 5539 IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV---RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQK-----------------NC--------RKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ------RNLSIIIFVQSLVRGKLAKLKYQKMRT 5961
            I+S+  +IQ  +RG   R +Y  I KL V IQ  IR  +     T+   I+  II IQSFYRM+   K +  MK ++  I+K                 NC        R+FI R++FL+I+  +I+IQ  +RR  AK + +      R+++ I FV   +  K+ +L  QK+ T
Sbjct:  774 IESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVII-IQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELT-QKLDT 946          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.040e-8
Identity = 54/160 (33.75%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 2362 KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKR-KLEKRLRSCIII-QKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK 2835
            KI  S+ +IQ+ +RG + R  Y  I K T  IQ Y++  LA +K  KL+                     QI+A +IIQSFYR  + R+ ++ ++ +V+ I+K   K++  R K   +  +C+II Q  +R FI RR FLK +  V +++++   Y RRK
Sbjct:  769 KIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLS---------------------QIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNH---YRRRK 904          

HSP 2 Score: 52.373 bits (124), Expect = 5.600e-6
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 5539 IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV---RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQK-----------------NC--------RKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ------RNLSIIIFVQSLVRGKLAKLKYQKMRT 5961
            I+S+  +IQ  +RG   R +Y  I KL V IQ  IR  +     T+   I+  II IQSFYRM+   K +  MK ++  I+K                 NC        R+FI R++FL+I+  +I+IQ  +RR  AK + +      R+++ I FV   +  K+ +L  QK+ T
Sbjct:  770 IESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVII-IQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELT-QKLDT 942          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.041e-8
Identity = 54/160 (33.75%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 2362 KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKR-KLEKRLRSCIII-QKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK 2835
            KI  S+ +IQ+ +RG + R  Y  I K T  IQ Y++  LA +K  KL+                     QI+A +IIQSFYR  + R+ ++ ++ +V+ I+K   K++  R K   +  +C+II Q  +R FI RR FLK +  V +++++   Y RRK
Sbjct:  769 KIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLS---------------------QIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNH---YRRRK 904          

HSP 2 Score: 52.373 bits (124), Expect = 5.700e-6
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 5539 IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV---RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQK-----------------NC--------RKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ------RNLSIIIFVQSLVRGKLAKLKYQKMRT 5961
            I+S+  +IQ  +RG   R +Y  I KL V IQ  IR  +     T+   I+  II IQSFYRM+   K +  MK ++  I+K                 NC        R+FI R++FL+I+  +I+IQ  +RR  AK + +      R+++ I FV   +  K+ +L  QK+ T
Sbjct:  770 IESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVII-IQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELT-QKLDT 942          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.059e-8
Identity = 54/160 (33.75%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 2362 KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKR-KLEKRLRSCIII-QKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK 2835
            KI  S+ +IQ+ +RG + R  Y  I K T  IQ Y++  LA +K  KL+                     QI+A +IIQSFYR  + R+ ++ ++ +V+ I+K   K++  R K   +  +C+II Q  +R FI RR FLK +  V +++++   Y RRK
Sbjct:  774 KIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLS---------------------QIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNH---YRRRK 909          

HSP 2 Score: 52.373 bits (124), Expect = 5.702e-6
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 5539 IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV---RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQK-----------------NC--------RKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ------RNLSIIIFVQSLVRGKLAKLKYQKMRT 5961
            I+S+  +IQ  +RG   R +Y  I KL V IQ  IR  +     T+   I+  II IQSFYRM+   K +  MK ++  I+K                 NC        R+FI R++FL+I+  +I+IQ  +RR  AK + +      R+++ I FV   +  K+ +L  QK+ T
Sbjct:  775 IESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVII-IQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELT-QKLDT 947          
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Match: SMESG000033540.1 (SMESG000033540.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.067e-8
Identity = 54/160 (33.75%), Postives = 86/160 (53.75%), Query Frame = 1
Query: 2362 KIYRSILIIQNNIRGYLCRSNYKRIRKSTKIIQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSFYRSSVCRRTYLNLRKSVIIIQKVVHKVLFKR-KLEKRLRSCIII-QKYIRGFINRRNFLKFKSAVNILEHYFMGYLRRK 2835
            KI  S+ +IQ+ +RG + R  Y  I K T  IQ Y++  LA +K  KL+                     QI+A +IIQSFYR  + R+ ++ ++ +V+ I+K   K++  R K   +  +C+II Q  +R FI RR FLK +  V +++++   Y RRK
Sbjct:  774 KIESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLS---------------------QIRAVIIIQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNH---YRRRK 909          

HSP 2 Score: 52.373 bits (124), Expect = 5.842e-6
Identity = 57/175 (32.57%), Postives = 87/175 (49.71%), Query Frame = 1
Query: 5539 IKSATLIIQKHIRGIFVRLKYKKIIKLVVFIQKNIRANIV---RTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQSITVIQK-----------------NC--------RKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQ------RNLSIIIFVQSLVRGKLAKLKYQKMRT 5961
            I+S+  +IQ  +RG   R +Y  I KL V IQ  IR  +     T+   I+  II IQSFYRM+   K +  MK ++  I+K                 NC        R+FI R++FL+I+  +I+IQ  +RR  AK + +      R+++ I FV   +  K+ +L  QK+ T
Sbjct:  775 IESSVTLIQSILRGSIERKRYLIIHKLTVQIQTYIRRKLAIEKATKLSQIRAVII-IQSFYRMYLARKLFVKMKCAVLAIEKWRRKIITTRLKQAYKKENCVIICQAIVRRFIQRRKFLKIQRGVILIQNHYRRRKAKETLKILKIEARSINHIKFVNKGLENKIIELT-QKLDT 947          
The following BLAST results are available for this feature:
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ASPM1.864e-16327.19abnormal spindle microtubule assembly [Source:HGNC... [more]
ASPM1.647e-7328.35abnormal spindle microtubule assembly [Source:HGNC... [more]
ASPM1.141e-7127.55abnormal spindle microtubule assembly [Source:HGNC... [more]
MYO5A1.937e-1225.25myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
MYO5A2.003e-1225.25myosin VA [Source:HGNC Symbol;Acc:HGNC:7602][more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hum-29.726e-1529.73Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-29.972e-1529.73Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-63.915e-636.00Unconventional myosin heavy chain 6 [Source:UniPr... [more]
hum-76.902e-626.19Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-77.252e-626.19Heavy chain, Unconventional Myosin [Source:UniPro... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asp1.504e-2423.55gene:FBgn0000140 transcript:FBtr0084692[more]
didum1.486e-1025.98gene:FBgn0261397 transcript:FBtr0089744[more]
didum1.545e-1025.98gene:FBgn0261397 transcript:FBtr0089745[more]
didum1.559e-1025.98gene:FBgn0261397 transcript:FBtr0089743[more]
CG146923.325e-829.86gene:FBgn0037836 transcript:FBtr0347183[more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspm8.551e-17726.41abnormal spindle microtubule assembly [Source:ZFIN... [more]
CR628370.14.968e-8328.48pep chromosome:GRCz11:CHR_ALT_CTG22_1_10:23552945:... [more]
myo5b1.474e-1335.17myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5b1.676e-1333.53myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5b1.685e-1333.53myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp82.884e-16325.68LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp82.954e-16325.68LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp87.564e-16325.68LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp81.774e-16225.68LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
lrp85.803e-16125.55LDL receptor related protein 8 [Source:Xenbase;Acc... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aspm0.000e+026.87abnormal spindle microtubule assembly [Source:MGI ... [more]
Aspm7.284e-7726.79abnormal spindle microtubule assembly [Source:MGI ... [more]
Myo5b9.283e-1428.37myosin VB [Source:MGI Symbol;Acc:MGI:106598][more]
Myo5b9.313e-1428.37myosin VB [Source:MGI Symbol;Acc:MGI:106598][more]
Myo5c7.100e-1329.07myosin VC [Source:MGI Symbol;Acc:MGI:2442485][more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CJ27|ASPM_MOUSE0.000e+026.87Abnormal spindle-like microcephaly-associated prot... [more]
sp|P62291|ASPM_MACFA1.074e-16427.48Abnormal spindle-like microcephaly-associated prot... [more]
sp|P62289|ASPM_GORGO8.829e-16427.57Abnormal spindle-like microcephaly-associated prot... [more]
sp|P62287|ASPM_COLGU6.755e-16327.39Abnormal spindle-like microcephaly-associated prot... [more]
sp|Q8IZT6|ASPM_HUMAN8.953e-16327.19Abnormal spindle-like microcephaly-associated prot... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3ZHZ00.000e+026.40Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A3B3T4R30.000e+025.64Abnormal spindle microtubule assembly OS=Paramormy... [more]
A0A3B3T4M10.000e+025.64Abnormal spindle microtubule assembly OS=Paramormy... [more]
W4Y9U01.053e-12825.42Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A3B4C7U10.000e+025.35Abnormal spindle microtubule assembly OS=Pygocentr... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036226.11.308e-7025.08pep primary_assembly:Astyanax_mexicanus-2.0:5:1920... [more]
ENSAMXT00000040686.13.269e-4924.63pep primary_assembly:Astyanax_mexicanus-2.0:5:1921... [more]
myo5ab4.986e-1228.87myosin VAb [Source:ZFIN;Acc:ZDB-GENE-050411-72][more]
myo5b5.409e-1132.08myosin VB [Source:ZFIN;Acc:ZDB-GENE-031219-7][more]
myo5aa1.235e-1032.75myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2][more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
myo10l16.335e-735.29myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000000990.12.467e-624.19pep scaffold:Pmarinus_7.0:GL476918:15609:106669:1 ... [more]
ENSPMAT00000004311.18.093e-630.19pep scaffold:Pmarinus_7.0:GL481322:4319:21833:1 ge... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MYO25.689e-1032.64Type V myosin motor involved in actin-based transp... [more]
MYO41.433e-628.50Type V myosin motor involved in actin-based transp... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO418192.796e-1127.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356585.354e-729.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495152.671e-635.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aspm1.426e-17226.09abnormal spindle microtubule assembly [Source:NCBI... [more]
myo5ab3.459e-1433.11unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
myo5ab3.881e-1433.11unconventional myosin-Va [Source:NCBI gene;Acc:101... [more]
myo5c1.306e-1126.70myosin VC [Source:NCBI gene;Acc:101162444][more]
myo5c1.377e-1126.70myosin VC [Source:NCBI gene;Acc:101162444][more]
back to top
BLAST of Abnormal spindle-like microcephaly-associated protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033540.11.007e-833.75SMESG000033540.1[more]
SMESG000033540.11.040e-833.75SMESG000033540.1[more]
SMESG000033540.11.041e-833.75SMESG000033540.1[more]
SMESG000033540.11.059e-833.75SMESG000033540.1[more]
SMESG000033540.11.067e-833.75SMESG000033540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006065 ID=SMED30006065|Name=Abnormal spindle-like microcephaly-associated protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=7397bp
AATATGTTAAATTATTCTTCAATCTTTGTATAAATTATTATTAATAATCT
TACAATGAATAAGTTTGATAATGAGTTAATTTTGAAACCTTTCCAATCAA
AATGTATTATTGATTTCGGTGAAATTATTGTTGGTAGATCAGAAATTCAA
TACATTTATTTAATAAATGATTTTGATTTTGATCAAAAACTGGATATAGT
TAAAATCCCGAATAGTTTTATAATAAATATTTCCGATAAATTTGTTATGG
GAAATAGTAAATTAAAATTGGAAGTAAAATGGACTCCAACAACTATTGGG
AAAGTTTCTGAATCTCTAAAATTTCAAAGCGACAGAGTTCCGTTTAGTGT
ACAGTTTATTGGATCCGCAATAGAAACAAAAGATATTTACAAAAAAAAAA
TTCCTTGTGAAATAAAAGCTTCTAAAATGTCAAAAATCAGTAGTAAGTTA
AACGTTGAAGATAAAGAAAACAATTATCCCAAACCTATTAAAAATGTCGT
TGTACAATGTGATGGAACGATATCGAAAATGCATAAATCAAATCAGAATG
TTATAACCTCAAATTGCTCTATAAATCCCCCTACTAATGATGATATCTGG
CTAAAAAGGCAAGAAGATTGTTTTGTAAAATGGTTAAATTGCATTTTTAA
TACCCATTTAAGCAAAACTAAAGTTGAAGATATTAATAAAAACATGCCCA
TTTATATTGAAGCTACAAAACTGTTACTCAGTGAATGTAAAGTGGCAATC
GAAAAAATTAATTCCGAAGTTACAAAGGATTCACTTAAATTCAAAGATGA
CATATTTTTCAAAAGCGGAAAACATCACAGAGATTTGACCGAATTGATTA
TGAATTACAATGATCCTTGGCTGTTTTTGGCATTTAATGTTTCTATAGAT
CCAGACTTCAATGTTTCCTTGCTTTCCAATAATGAGGCATGTTTTAAGAA
ATTTATTGCCTGTAAGATTTTATGGAATAAAGATATTGCCAAGAAGCACC
GAATGAAAGATATTAATTCTTATAGAAAGCCTGAATTCAATTTGTCTCTT
AACCGAAATATTCTTAGGCAATTTCTTTCTATAGTCTATATTTTAGATGT
GGCTAAAAAAAATAATATCTTTCCTTCCGATATTAACCTGTTTCGTAAAG
ATTCCAATGTAAAATCTTCAGCGGAAATGCTAACTGAATTCACAAGTTAT
TTTCTAAAAGGCGAAGGAAATATTCTGAAGAGATTTTCTAATTGGAACCT
TTCAGTAAGTCACATACAGACTGCCATAGACGAGTACGATTTCACCGTGT
CAAATCTGAGCGACGATATCACTGATGGAGTCAGATTAGCGAGACTAGCC
AAAATTCTTGTTAACATTGATATAATGTCCAAACTGAGATATCCAGCTGT
AGATCTTGCGAGAAAAACATTTAACATAGAATTAGCTGTGAAGGCGTTTA
AAGATGCTGGCACAGCTATTGTAACATATTCTGGAGAAGAAATAGATTTA
TCCCAAATACCTTGGGGACATCGAGAAAAGACATTGGCTTTACTTTGGTG
TGTTTTATCTCGGCATTATATAGATGCTGTTATTGACAGAGACAAGTTAA
TATCAGAAATAAAATTATTTGAAAATCCAATCTCACTAACAAATCTGTCT
AGTAATGAACTGTTGTTGGTTTGGGTTAAGTCTGTTTGTGGTTTGTACAA
CATTAATGTCAGTAATATATCCAATTTGAAGGATGGAAGAGGTTTCTGTC
TCTTAATACACTATTATCTCCCAGAATATTTGAAACTTAATGAAATTAAC
CACAATACAACGCTTACTAGTGCAAATTTGTTTGACAAAGAAATTTTACT
TGAAAATGAAAAAAGGAATTTTCAAATTTTTTTCTCAAAACTTAAACAAA
TCGGGGGAGCTCCTATAATCTTGCCGAAAGAAAATGAAATTCCTAGTCAT
GAATTTATCATGGCAACTTTAGCTTTTTTCAGTAGCCGCCTCATAGATTT
GATGACTTTTTATAGAGCAGCTAGCTGTATTCAACGAGTTTGGAGAAAAT
ATAGAACTTTCTATTTATATAAGACGCATTTTATCGCTCATTACAAAGAA
GTAATTATTGTTCAATCCATTGTTCGTCGGTTTTTATGCCTTAAAAAGTT
TAAATCTATTAAAATGAGAATAATCATTTGCCAATCAGTCGTCAAACGCT
ATTTAGCAAGACATAGAATAAGTAAAATGAAAAAGTCAGCTATTCTTATA
CAAAAAAATTATCGAAGATACCTTTGTCGAATAAGATATGAGAAAATAAA
AAGTGCAACTGTTGTATTACAGTCTCATTTTCGAAGGTATTTAGTACAAA
AAAATTATCTTAAAATTTACCGATCAATATTGATAATCCAAAATAACATT
CGAGGTTATTTATGTAGATCAAATTATAAGAGAATTCGAAAATCTACAAA
AATAATTCAAAAATACGTTAAAGGTTACTTAGCTCGCAAGAAATTTGTTA
AATTGACAAAAGCAATAGTAGTTATACAATCGGCTTTCCGTGGTTACGCA
AAAAGGCGAAATTATACTATTCAAATTAAAGCAGCAGTCATTATACAAAG
TTTTTATCGATCTAGCGTCTGTCGTAGAACTTATCTAAATCTCAGGAAAT
CCGTAATAATAATACAGAAAGTAGTTCATAAGGTTTTATTCAAAAGGAAA
CTGGAAAAACGTTTGCGTAGTTGTATTATAATTCAAAAGTATATTAGAGG
ATTTATTAATAGACGAAATTTTCTCAAATTCAAATCTGCAGTCAATATCT
TAGAACATTACTTTATGGGATATTTACGAAGAAAACAATTTTTAAAAATG
AGGAACTCTGTAATTTTATTACAAAAAAATTTAAGAATGTTGAGTCTAAG
AAACTCTTTCTTAATCAAACAAAAATCTGCAATCATAATTCAAAAATCAT
TCAAGCGTTATTTTGCTAAAAAAGAATTTGTAGCTAAAAAATCGGCCACT
ATACTTATTCAGACTAAGGTTCGAGCTTTAATACAACGAAGAAAATTTCA
GTACTTACGAAATGCTGCGATTATTATACAAAAGACATTCCGATGTTATT
CAGTACGAAAAAAGTTTTTGATTCAATATTATAGTGCTATTGTCATTCAG
AAAAATGTTCGGTCGATTATTTGTCAGAAAAATTACTTAAAAATTAAGCA
GTCAGTTTTAGTTATTCAGAAGCATACCAAGGGATTCTTAGTTAAAAAAT
CATATAAGAAAATTATAATTCGCATCATTATATGTCAAAGCTTAGTTCGC
AAATATTTGTTACAAAAGCAGTATCTAAAGGTAAGAAAATCGACAATAAT
CATTCAAAAACATTTCAGAGCAATATCTGCTAGAAAACAATTTTTAAATT
TTCGAAAATTTACTATTGTAGTTCAAAAATATATAAAAATGCATCAATGT
CGACAGAAATTTTTGAAATTAAAGTCACAAGTAATAACTATTCAGAAAAA
TATTCGGGCTTTACTACAACGTCGTCGATATATTAAAAATAAAAAAGCTG
TTATTTTTATTCAACGTAAATTCCGATCTTGCAAAGAAAAAAAACAAATA
ATACTAAACAACCAAGCTGCTACAGTTGTTCAAAAATATTTTAAATCATA
TATTTGTAAAAAACAATTTAGAAAAATGAAAGAATCGGTTACTGTAATAC
AAAAGTATCAAAGAAGATTGATTTGTAGAAAACAATTTCAGAAGGAGATG
AAATTAGTTATTTTATTGCAAAGCAAAATCAGAATGATTATTACAAAAAA
GCGATATCAAAAGAAAATCGCTGCTACATTGACAATTTCAAAATTTGTTA
AAGGATATTTCGCAAGAAAAAAGTATCTCTCATATCGCCATTCGGTTATT
GTCATACAGAATTCGTTCCGTTGTTTTATGTATAGAAAAATGTTTCTATC
AATCAAATTTTCTGCAATTGTTATCCAAAAATACTTGCGAGGTTTTATTA
AACGTAAAATTTATTGTTCTCAAACGACTGCTATAAAAGTTATTCAAAAG
AATATACGAGGATTTTTGGTTAGAAAAACCTTAAATTCGCATCATCAATC
TGCAACACTTATTCAACATTTCTATCGTTCATATAAAATAAGAAAAAATT
TCATTTGCAAAAGAAATGCAGCCATTGTCATTCAAAAACAATTTAGGAAG
CATTATATTAGACAACAATACAATGAGACTAGGAAAAAAGTTATATTCAT
TCAAAGTTTAATTCGACAATTTATCGCAATTCAAAAATATAAACAAATGA
AAAAGGCAGCAACATATATCCAAAAAATTGCCAAGGGGTATATTATTAGA
AAAAAATATGTCACACAGAGACGTTCTGCTGTTATTATTCAAAAAAATGT
CCGGCAATATTTATCAAGAAAATCATTTCAGATTAAAAAGTCATCAATTA
TTATTATCCAGAAATACGTGCGAAGATTTTTGATGCGTTCTGTTTATAAG
CGTAAATTATTAGCTGCAACTTTAATACAAAAGATTGCGCGAGGGTATTT
AGTTAGAAAAAGAATTGTAGTTGAACAAAAAGCAGTTAGAATTATCCAGA
ATTTTTATCGCGCACATACGATTAGATCTCATTTTATTTGCCAGAAAAAT
GCAGCGATAAAATTACAAAAGAATATCAGAGGATATCTTATTAGAAAAAA
TTTTACGGAGACAAGAAATAAAATCATTTTGGTTCAAAGTTTAATGAAAG
GATTTATTGCAAGAAAATGTTATCAAAAATTGAGAAGTTCCTCTATAATT
GTCCAAAAAATATTTCGAGGATTTAATGCTCATAAAAAATTCTTAAAACT
GAAGAACGCAAGTATATGCATTCAAAAAAATGTCCGTAGATATTGTCAAA
TGAAACTTTATCGTGACACAAGAAATGCCTCGATTGTTATTCAAAAATAT
GTGCGAGGATTCCTGTGTCGTATAAAATATCAACGTCAATTACTTGCAGC
AATCATATTACAAAGACATTTTCGAAAATATTTAATAATAAGAAGAATTG
ACTTAGAACAGAAAGCAGCTCGTATAATTCAGAACTTTTATCGCGGATAT
ACAATAAGAGCTCATTTTCTTTGTCAGAAAAATTCGTGTGTTACTATACA
AAATTATTTTAAAGCATATTTGATAAGAAAAAAGTATTTGGAAATTCGAC
AAAAAACAATATTTATTCAATGTTTAGTTCGAAGATATATTTCGAGAAAT
CGTTTCTTGCGTTTGAAAATGTCGGTTATAATTATTCAAAAAGTTACACG
AGGGTATTTTACCCATAGAAAATATGTTAAACAGAAAAAAGCAGTCATAA
ATATTCAAAAAAACTTTCGTCGGTTTTCAGAATTGAAAACATTTCAAAAT
CTTAAAAACGCGTCCATAATTATTCAAAAAAATTTCCGTTGCTATATTTT
GAGAAAAGAATTCAAAAAGAAAAGGAAAAATTGTGTTAAAATCCAGAGTT
ATATTCGTAGATATATTTGCATTTCAAAATTTAAAATGATAAAAAGTGCT
ACCTTAATTATCCAGAAACATATAAGAGGGATATTCGTAAGATTGAAGTA
TAAAAAGATAATCAAATTAGTAGTATTCATCCAGAAAAATATTCGTGCAA
ATATCGTTAGAACAAGATTTTTAAATATCAAGAAAAGTATAATTAATATT
CAGAGTTTCTATAGAATGCATTATGAATATAAAAATTATCAATTAATGAA
ACAGTCGATTACTGTAATACAAAAAAATTGCAGGAAATTTATTGCTAGGA
AAAGATTTTTAGAAATTAAAAGCAATATTATAATTATTCAAAAATTCTTT
CGTCGATTTCTTGCTAAACGAAGTTATCAAAGAAATTTGTCGATTATAAT
TTTTGTTCAATCTTTAGTCCGTGGAAAGTTAGCAAAATTGAAATATCAAA
AAATGAGAACTGCAACTATTCTTATTCAAAAAACTGTAAAAGGATATTTT
ATTAGAAAGCATTACAAGATTTTGCAAAAATCGGTGATTCAATTACAACG
ATTTATTCGAGGTTTTTTAATTCGCAAAATATTTTTAAAATTAAAAAATG
CATCAATAATAATATCTAAACACGTAAGAGGCGTTTTAGTGCGAAATCAT
TTTCAAAAAAATAAACAACATATGAAAATATTTGCCCAAGAAAATCTTAG
AAAGCGGCTTGAAGCTTCCATAAAAATTCAAGCATATTTTCGGTGTTATA
TTCAGAAACGACGATATTGTCTACTCAAATCTTATACATTATTGATTCAA
CAAAGATGGAGATTCATTGTTCTTAAACGATCTGCTGTGGTTATTCAACG
TATTTGGAGGGGTCGGCAACTTCGATGTCATTTAAATGCGAAAAAAATTG
GACATGAAATTTCTGAAATAAGAAATAGATTTATTGAAGCAAATCGAAGA
TTCTCAAAATTCAATACCGTTCGTTACATTGGAAAAAAGGCACTTACAGA
TCTTAAAGAATCAGAATTAACTGTAGCAAAAGTTTTATTTTGCTTAACTT
CATTAGAAAACGTAACCAGTCTTTCACGTGAAATTTGCAAGTGGCTTATT
GAGTCAGATGCTTATAAAATTTTATTAGAGTTGCTTCATGATTGTAATAG
AGGTGTTGCCGATTTAGAAGTCGTATCTAAAGTCATTTCGGTCTTTTTCA
ATCTTGGAAAAGCAGGCGTACTCAATTTTGATGTGATTGGTTCAGAATTT
ATAAAATTGGTGAAAAATTTATTATATCGTAACATCAATTCAAAACGAGG
AACAAAAGGAATTACAATATTTTGTCACACTTGCCTTTTATTAGTTCTTC
TAATAAAAATGGAACAAAAATCTATCTCAAATTCCCAATATTCTATTTCT
AAAGATTCCAATATCAAAGATTCAGTTTCAAAGTATAGACAACAATTATC
GAGTCGCTGTGAAAATATTGTCGGTTCTATTTCTAATTCAGATAAAATCT
TGGAACAGATGAGATTGAATCCATCTTGGGATTTAAAACGAAGATTTAGA
CCTAACTCAAATTCAAAGAAAACGCTTTCAACTAAACTTGGATCCACAAA
TAGCTTGCAAGAAAATAATCTCAGTAGAAAAGCTATTATTCCGCATTGTG
GAATAAAGAAGCCAATAAATTTGCCGATTTCAAGCAGGAATTCTCGTATT
GCTGTCACTGCTCAAAATGTTCCCAGTAGCAATTTGTGTAGAAGTGTTTC
GGTGTCAAATAACCTGCAAAGAAATTCCAGTGTAGATGCGAGTAAGAGAT
CGCCTAATATTTGGGATTCTGGACATCAGTTATATGCCATTAATTTATTA
TGGGAAAGTTTAAATGTTTAAAATGAATAAATAAGTTTTGGCTTTGT
back to top

protein sequence of SMED30006065-orf-1

>SMED30006065-orf-1 ID=SMED30006065-orf-1|Name=SMED30006065-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2439bp
MNKFDNELILKPFQSKCIIDFGEIIVGRSEIQYIYLINDFDFDQKLDIVK
IPNSFIINISDKFVMGNSKLKLEVKWTPTTIGKVSESLKFQSDRVPFSVQ
FIGSAIETKDIYKKKIPCEIKASKMSKISSKLNVEDKENNYPKPIKNVVV
QCDGTISKMHKSNQNVITSNCSINPPTNDDIWLKRQEDCFVKWLNCIFNT
HLSKTKVEDINKNMPIYIEATKLLLSECKVAIEKINSEVTKDSLKFKDDI
FFKSGKHHRDLTELIMNYNDPWLFLAFNVSIDPDFNVSLLSNNEACFKKF
IACKILWNKDIAKKHRMKDINSYRKPEFNLSLNRNILRQFLSIVYILDVA
KKNNIFPSDINLFRKDSNVKSSAEMLTEFTSYFLKGEGNILKRFSNWNLS
VSHIQTAIDEYDFTVSNLSDDITDGVRLARLAKILVNIDIMSKLRYPAVD
LARKTFNIELAVKAFKDAGTAIVTYSGEEIDLSQIPWGHREKTLALLWCV
LSRHYIDAVIDRDKLISEIKLFENPISLTNLSSNELLLVWVKSVCGLYNI
NVSNISNLKDGRGFCLLIHYYLPEYLKLNEINHNTTLTSANLFDKEILLE
NEKRNFQIFFSKLKQIGGAPIILPKENEIPSHEFIMATLAFFSSRLIDLM
TFYRAASCIQRVWRKYRTFYLYKTHFIAHYKEVIIVQSIVRRFLCLKKFK
SIKMRIIICQSVVKRYLARHRISKMKKSAILIQKNYRRYLCRIRYEKIKS
ATVVLQSHFRRYLVQKNYLKIYRSILIIQNNIRGYLCRSNYKRIRKSTKI
IQKYVKGYLARKKFVKLTKAIVVIQSAFRGYAKRRNYTIQIKAAVIIQSF
YRSSVCRRTYLNLRKSVIIIQKVVHKVLFKRKLEKRLRSCIIIQKYIRGF
INRRNFLKFKSAVNILEHYFMGYLRRKQFLKMRNSVILLQKNLRMLSLRN
SFLIKQKSAIIIQKSFKRYFAKKEFVAKKSATILIQTKVRALIQRRKFQY
LRNAAIIIQKTFRCYSVRKKFLIQYYSAIVIQKNVRSIICQKNYLKIKQS
VLVIQKHTKGFLVKKSYKKIIIRIIICQSLVRKYLLQKQYLKVRKSTIII
QKHFRAISARKQFLNFRKFTIVVQKYIKMHQCRQKFLKLKSQVITIQKNI
RALLQRRRYIKNKKAVIFIQRKFRSCKEKKQIILNNQAATVVQKYFKSYI
CKKQFRKMKESVTVIQKYQRRLICRKQFQKEMKLVILLQSKIRMIITKKR
YQKKIAATLTISKFVKGYFARKKYLSYRHSVIVIQNSFRCFMYRKMFLSI
KFSAIVIQKYLRGFIKRKIYCSQTTAIKVIQKNIRGFLVRKTLNSHHQSA
TLIQHFYRSYKIRKNFICKRNAAIVIQKQFRKHYIRQQYNETRKKVIFIQ
SLIRQFIAIQKYKQMKKAATYIQKIAKGYIIRKKYVTQRRSAVIIQKNVR
QYLSRKSFQIKKSSIIIIQKYVRRFLMRSVYKRKLLAATLIQKIARGYLV
RKRIVVEQKAVRIIQNFYRAHTIRSHFICQKNAAIKLQKNIRGYLIRKNF
TETRNKIILVQSLMKGFIARKCYQKLRSSSIIVQKIFRGFNAHKKFLKLK
NASICIQKNVRRYCQMKLYRDTRNASIVIQKYVRGFLCRIKYQRQLLAAI
ILQRHFRKYLIIRRIDLEQKAARIIQNFYRGYTIRAHFLCQKNSCVTIQN
YFKAYLIRKKYLEIRQKTIFIQCLVRRYISRNRFLRLKMSVIIIQKVTRG
YFTHRKYVKQKKAVINIQKNFRRFSELKTFQNLKNASIIIQKNFRCYILR
KEFKKKRKNCVKIQSYIRRYICISKFKMIKSATLIIQKHIRGIFVRLKYK
KIIKLVVFIQKNIRANIVRTRFLNIKKSIINIQSFYRMHYEYKNYQLMKQ
SITVIQKNCRKFIARKRFLEIKSNIIIIQKFFRRFLAKRSYQRNLSIIIF
VQSLVRGKLAKLKYQKMRTATILIQKTVKGYFIRKHYKILQKSVIQLQRF
IRGFLIRKIFLKLKNASIIISKHVRGVLVRNHFQKNKQHMKIFAQENLRK
RLEASIKIQAYFRCYIQKRRYCLLKSYTLLIQQRWRFIVLKRSAVVIQRI
WRGRQLRCHLNAKKIGHEISEIRNRFIEANRRFSKFNTVRYIGKKALTDL
KESELTVAKVLFCLTSLENVTSLSREICKWLIESDAYKILLELLHDCNRG
VADLEVVSKVISVFFNLGKAGVLNFDVIGSEFIKLVKNLLYRNINSKRGT
KGITIFCHTCLLLVLLIKMEQKSISNSQYSISKDSNIKDSVSKYRQQLSS
RCENIVGSISNSDKILEQMRLNPSWDLKRRFRPNSNSKKTLSTKLGSTNS
LQENNLSRKAIIPHCGIKKPINLPISSRNSRIAVTAQNVPSSNLCRSVSV
SNNLQRNSSVDASKRSPNIWDSGHQLYAINLLWESLNV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005516calmodulin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0051301cell division
GO:0007051spindle organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR013783Ig-like_fold
IPR000048IQ_motif_EF-hand-BS
IPR001715CH-domain
IPR031549ASH
IPR027417P-loop_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000048IQ motif, EF-hand binding siteSMARTSM00015iq_5coord: 793..815
e-value: 0.0011
score: 28.2
coord: 1046..1068
e-value: 0.092
score: 21.9
coord: 701..723
e-value: 94.0
score: 5.7
coord: 1391..1413
e-value: 39.0
score: 8.8
coord: 1460..1482
e-value: 0.043
score: 22.9
coord: 1690..1712
e-value: 0.34
score: 20.0
coord: 1000..1022
e-value: 5.3E-4
score: 29.3
coord: 1069..1091
e-value: 120.0
score: 4.7
coord: 770..792
e-value: 0.0043
score: 26.3
coord: 954..976
e-value: 0.1
score: 21.7
coord: 1805..1827
e-value: 0.15
score: 21.2
coord: 1483..1505
e-value: 0.035
score: 23.3
coord: 1713..1735
e-value: 8.0
score: 14.5
coord: 1299..1321
e-value: 38.0
score: 8.9
coord: 1920..1942
e-value: 0.0016
score: 27.7
coord: 1276..1298
e-value: 7.4
score: 14.8
coord: 816..838
e-value: 2.3E-4
score: 30.5
coord: 931..953
e-value: 40.0
score: 8.7
coord: 1943..1965
e-value: 15.0
score: 12.2
coord: 1874..1896
e-value: 16.0
score: 12.1
coord: 1253..1275
e-value: 0.21
score: 20.7
coord: 1184..1206
e-value: 6.5
score: 15.2
coord: 1529..1551
e-value: 2.4E-4
score: 30.4
coord: 977..999
e-value: 17.0
score: 11.7
coord: 2089..2111
e-value: 0.1
score: 21.7
coord: 1966..1988
e-value: 0.0019
score: 27.5
coord: 1323..1344
e-value: 11.0
score: 13.5
coord: 651..673
e-value: 240.0
score: 2.2
coord: 1345..1367
e-value: 7.5
score: 14.7
coord: 1437..1459
e-value: 0.096
score: 21.8
coord: 1023..1045
e-value: 260.0
score: 2.0
coord: 1230..1252
e-value: 71.0
score: 6.6
coord: 747..769
e-value: 0.01
score: 25.0
coord: 2050..2072
e-value: 0.38
score: 19.8
coord: 724..746
e-value: 0.0011
score: 28.3
coord: 1552..1574
e-value: 11.0
score: 13.3
coord: 1506..1528
e-value: 15.0
score: 12.3
coord: 1736..1758
e-value: 0.71
score: 18.9
coord: 1368..1390
e-value: 18.0
score: 11.7
coord: 1092..1114
e-value: 0.23
score: 20.5
coord: 678..700
e-value: 56.0
score: 7.5
coord: 2012..2034
e-value: 0.056
score: 22.6
coord: 1667..1689
e-value: 0.75
score: 18.8
coord: 885..907
e-value: 0.0015
score: 27.8
coord: 1207..1229
e-value: 0.016
score: 24.4
coord: 1897..1919
e-value: 0.17
score: 21.0
coord: 1989..2011
e-value: 0.028
score: 23.6
coord: 1828..1850
e-value: 0.12
score: 21.5
coord: 1644..1666
e-value: 43.0
score: 8.4
coord: 1115..1137
e-value: 6.3
score: 15.3
coord: 1598..1620
e-value: 0.068
score: 22.3
coord: 1782..1804
e-value: 0.0014
score: 27.9
coord: 839..861
e-value: 0.56
score: 19.2
coord: 1161..1183
e-value: 400.0
score: 0.5
coord: 1138..1160
e-value: 2.1
score: 17.3
coord: 1575..1597
e-value: 9.1
score: 14.0
coord: 1414..1436
e-value: 0.016
score: 24.4
coord: 1851..1873
e-value: 16.0
score: 11.9
coord: 1621..1643
e-value: 0.0049
score: 26.1
coord: 1759..1781
e-value: 10.0
score: 13.7
IPR000048IQ motif, EF-hand binding sitePFAMPF00612IQcoord: 842..860
e-value: 0.017
score: 14.9
coord: 1143..1159
e-value: 0.2
score: 11.5
coord: 773..792
e-value: 0.0019
score: 17.8
coord: 1117..1136
e-value: 0.15
score: 11.9
coord: 795..814
e-value: 0.0017
score: 18.0
coord: 727..745
e-value: 0.0014
score: 18.3
coord: 1187..1206
e-value: 0.23
score: 11.3
coord: 1900..1918
e-value: 0.0039
score: 16.9
coord: 1924..1942
e-value: 0.0072
score: 16.0
coord: 1347..1366
e-value: 0.14
score: 12.1
coord: 1970..1988
e-value: 0.023
score: 14.4
coord: 1487..1503
e-value: 0.0026
score: 17.4
coord: 1049..1068
e-value: 0.21
score: 11.4
coord: 1693..1711
e-value: 0.098
score: 12.5
coord: 1623..1643
e-value: 0.0042
score: 16.8
coord: 1094..1113
e-value: 0.045
score: 13.6
coord: 1532..1550
e-value: 1.6E-4
score: 21.2
coord: 957..975
e-value: 0.055
score: 13.3
coord: 1463..1482
e-value: 0.0084
score: 15.8
coord: 1326..1342
e-value: 0.017
score: 14.9
coord: 1785..1804
e-value: 0.0083
score: 15.8
coord: 1992..2010
e-value: 0.014
score: 15.2
coord: 1439..1459
e-value: 0.0099
score: 15.6
coord: 818..837
e-value: 1.9E-4
score: 21.0
coord: 888..906
e-value: 0.0096
score: 15.6
coord: 1002..1021
e-value: 0.0025
score: 17.5
coord: 1739..1757
e-value: 0.095
score: 12.5
coord: 750..768
e-value: 0.0043
score: 16.7
coord: 2092..2110
e-value: 0.012
score: 15.3
coord: 1303..1320
e-value: 0.13
score: 12.1
coord: 2053..2071
e-value: 0.023
score: 14.4
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1461..1489
score: 6.76
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1185..1213
score: 7.675
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1346..1372
score: 6.54
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1990..2017
score: 7.657
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1001..1027
score: 6.778
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1875..1903
score: 6.852
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1737..1766
score: 7.254
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 840..867
score: 7.382
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 773..799
score: 8.865
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1783..1809
score: 8.334
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1323..1351
score: 7.108
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1622..1648
score: 8.187
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1898..1925
score: 6.577
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1300..1328
score: 7.73
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1415..1441
score: 8.736
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 978..1004
score: 7.144
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 2051..2078
score: 7.657
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1530..1557
score: 9.743
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1691..1718
score: 7.785
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1829..1856
score: 7.236
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 725..752
score: 7.291
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 748..775
score: 6.742
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1921..1948
score: 6.815
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 2090..2118
score: 6.65
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1438..1465
score: 7.73
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 2013..2041
score: 7.401
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1668..1694
score: 7.089
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1967..1996
score: 8.663
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 817..843
score: 9.34
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1254..1281
score: 6.906
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1487..1512
score: 8.133
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 794..821
score: 7.785
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 886..914
score: 7.254
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1946..1971
score: 7.144
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1139..1166
score: 6.778
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1369..1396
score: 8.663
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1047..1074
score: 6.705
IPR000048IQ motif, EF-hand binding sitePROSITEPS50096IQcoord: 1553..1580
score: 7.693
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 392..506
e-value: 2.0E-13
score: 52.2
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 527..648
e-value: 3.4E-14
score: 54.5
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 371..642
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 1326..1366
e-value: 4.9E-11
score: 44.2
coord: 1487..1527
e-value: 2.0E-7
score: 32.7
NoneNo IPR availableGENE3DG3DSA:1.20.5.190coord: 1094..1139
e-value: 5.4E-9
score: 37.6
coord: 1900..1947
e-value: 1.4E-9
score: 39.4
coord: 933..979
e-value: 1.3E-6
score: 29.9
coord: 1529..1576
e-value: 3.1E-11
score: 44.7
coord: 1279..1325
e-value: 7.4E-10
score: 40.3
coord: 1854..1899
e-value: 8.7E-7
score: 30.5
coord: 1233..1278
e-value: 4.4E-6
score: 28.2
coord: 980..1024
e-value: 2.4E-7
score: 32.3
coord: 1390..1439
e-value: 8.7E-7
score: 30.5
coord: 1992..2041
e-value: 2.9E-10
score: 41.6
coord: 1440..1486
e-value: 1.9E-9
score: 39.0
coord: 749..796
e-value: 6.0E-11
score: 43.8
coord: 1761..1807
e-value: 1.9E-8
score: 35.8
coord: 1577..1623
e-value: 2.1E-9
score: 38.9
coord: 887..932
e-value: 6.1E-9
score: 37.4
coord: 1668..1715
e-value: 2.4E-11
score: 45.1
coord: 797..841
e-value: 8.1E-11
score: 43.4
coord: 702..748
e-value: 5.2E-7
score: 31.2
coord: 1140..1184
e-value: 3.5E-6
score: 28.6
coord: 1948..1991
e-value: 1.4E-9
score: 39.4
coord: 1624..1667
e-value: 2.2E-9
score: 38.8
coord: 1808..1853
e-value: 7.8E-8
score: 33.9
coord: 842..886
e-value: 3.0E-7
score: 32.0
coord: 1185..1232
e-value: 4.5E-8
score: 34.6
coord: 1025..1071
e-value: 1.2E-9
score: 39.7
coord: 1716..1760
e-value: 3.6E-7
score: 31.7
NoneNo IPR availablePANTHERPTHR22590:SF5coord: 905..1243
coord: 1962..2112
coord: 1133..1435
coord: 231..1125
NoneNo IPR availablePANTHERPTHR22590UNCHARACTERIZEDcoord: 905..1243
NoneNo IPR availablePANTHERPTHR22590UNCHARACTERIZEDcoord: 1962..2112
NoneNo IPR availablePANTHERPTHR22590UNCHARACTERIZEDcoord: 1548..1820
coord: 1317..1601
NoneNo IPR availablePANTHERPTHR22590UNCHARACTERIZEDcoord: 1780..2037
coord: 1133..1435
coord: 231..1125
NoneNo IPR availablePANTHERPTHR22590:SF5coord: 1548..1820
coord: 1317..1601
NoneNo IPR availablePANTHERPTHR22590:SF5coord: 1780..2037
IPR031549Abnormal spindle-like microcephaly-associated protein, ASH domainPFAMPF15780ASHcoord: 7..95
e-value: 1.8E-10
score: 40.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 13..107
e-value: 2.7E-5
score: 26.2
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 370..505
score: 8.752
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 531..650
score: 11.522
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1580..1676
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 978..1055
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 841..939
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 765..848
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1371..1461
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1509..1600
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1075..1166
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1744..1837
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1831..1929
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1902..1993
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1159..1238
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 705..773
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1232..1308