Kinesin protein

Overview
NameKinesin protein
Smed IDSMED30006060
Length (bp)3203
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinesin protein (SMED30006060) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinesin protein (SMED30006060) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinesin protein (SMED30006060) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinesin protein (SMED30006060) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006060

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006060h1SMcG0011597 SmedASXL_014435SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30006060h1SMcG0011597 SmedASXL_014435SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30006060h1SMcG0011597 Contig53564newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006060h1SMcG0011597 Contig53564uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30006060h1SMcG0011597 dd_Smed_v4_3334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006060h1SMcG0011597 dd_Smed_v4_3334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30006060h1SMcG0011597 dd_Smed_v4_15120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006060h1SMcG0011597 dd_Smed_v4_15120_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006060h1SMcG0011597 dd_Smed_v4_3334_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30006060h1SMcG0011597 dd_Smed_v4_15120_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006060h1SMcG0011597 SMED_29032_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30006060h1SMcG0011597 SMED_29032_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF4B (kinesin family member 4B [Source:HGNC Symbol;Acc:HGNC:6322])

HSP 1 Score: 397.127 bits (1019), Expect = 6.008e-119
Identity = 308/886 (34.76%), Postives = 469/886 (52.93%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHI--REENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLR------------AQVTALQAQLKGAVGNGMEALVLKPQ-VVSPSHFSEICELKAEIVAAQR-QKIELLEEFDEELSKKDDILRRIWEKISCS-DMEK-------------DEIYLELEKLVTDMNKSEHMETLENADIA--DQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQ---QYEE--KNREL----LQR-----IKELEEEKLRNN----SKHRQ---DDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQL----------EN-----------FSEVDSE------------EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVN 2418
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++  + +  + G+IPR I  ++  +D  +      +KVS++E+YNE+I DLL  ++E   I  RE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I     S  N C+      SKLHLVDLAGSER  KT A GDR KEG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET +TL YA RAR+I+NKPI+N +D    E+  L+            A    L   +       +++L+ K Q +V  +     C  KA    AQ  ++I L E+ +E+L+ K + LR   + ++C  D++K              EI   L++L+T ++      T    D A  +++  E        +D                   L   L  KEA ++++   D  L     QY++  KN EL    LQ+     ++EL+  K   N    S+HR     +L+ ++ + K++LNE + L K KE +   V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K+++VLRRK E   A  KRLKD L  +++ + KR        + I  +V++W+   +E+     E  +  N L+E+R+ L++ +          EN            SEV  +            E  + +ME++     I+ LQQ  L +E +D   Q CW     I E + A+K++  +LV  +++
Sbjct:   10 VRVALRCRPLVPKEISEGCQMCLSFVPGETQVVVGTDKSFTYDFVFDPCTEQEEVFNKAVAPLIKGIFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGIIPRVIQLLFKEIDK-KSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKSDKN-CS----FRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISAL--GDDKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLSTLRYADRARKIKNKPIVN-IDPHTAELNHLKQQVQQLQVLLLQAHGGTLPGSINAEPSENLQSLMEKNQSLVEENEKLSRCLSKAAGQTAQMLERIILTEQVNEKLNAKLEELR---QHVACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACTAAAIDTAVEEEAQVETSPETSRSSDAFTTQHALHQAQMSKEVVELNNALALKEALVRKMTQNDNQLQPIQFQYQDNIKNLELEVINLQKEKEELVRELQTAKKNVNQAKLSEHRHKLLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIWMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSSVLRRKTEEAAAANKRLKDALQKQREVTDKRKETQSHGKEGIAARVRNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVVQLKEKKESRENPPPKLRKCTFSLSEVHGQVLESEDCITKQIESLETEMELRSAQ--IADLQQKLLDAESEDRPKQ-CWENIATILEAKCALKYLIGELVSSKIH 880          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF4A (kinesin family member 4A [Source:HGNC Symbol;Acc:HGNC:13339])

HSP 1 Score: 389.037 bits (998), Expect = 4.489e-116
Identity = 306/905 (33.81%), Postives = 474/905 (52.38%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHI--REENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICELKAEIV-----------------AAQRQKIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMN----------------KSEHMET-LENADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQ---QYEEKNREL------LQRIKE---LE---------EEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSE--------------------------VDSEEKF-----QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++  + +  + GVIPR I  ++  +D  +      +KVS++E+YNE+I DLL  ++E   I  RE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI +     S  N  ++F    SKLHLVDLAGSER  KT A GDR KEG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N +D    E+  L+ QV  LQ  L  A G  +   +     V PS +   + E    +V                 A   ++I L E+ +E+++ K + LR          ++ E +   +++++ EI   L++L+T ++                +   +ET  E +  +D  T ++     + +  L  L + L  KEA  +++   D  L     QY++  +EL      LQ+ KE   LE         + KL    + R  +L+ ++ + K++LNE + L K KE +   V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K++ VLRRK E   A  KRLKD L  +++ + KR        +    +VK+W+   +E+     E  +  N L+E+R+ L++ +    E                           +SE+        L+ E++  +  I+ LQQ  L +E +D   Q  W     I E + A+K++  +LV  ++      S ++Q +     +QK
Sbjct:   10 VRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDK-KSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISLEQRKKSDKN--SSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISAL--GDDKKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVN-IDPQTAELNHLKQQVQQLQVLLLQAHGGTLPGSI----TVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACMAAAIDTAVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDNIKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQKQREVADKRKETQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVAQLKEKKESGENPPPKLRRRTFSLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQKLLDAESEDRPKQR-WENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQK 900          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21B (kinesin family member 21B [Source:HGNC Symbol;Acc:HGNC:29442])

HSP 1 Score: 316.235 bits (809), Expect = 4.536e-89
Identity = 174/394 (44.16%), Postives = 236/394 (59.90%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKE--MRHIR-------EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY----------------INILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V VR RP    E  +GC  C    PG   +++G  K FT+D VF     QE+IY   V  +I   F GYN TVLAYGQTG+GKTYTMGT F       E G+IPRAI+ ++  +   +  A           V   F+E+YNE+I DL  ST++   RH R       + N  I    +    ++  E++ +CL +G+ +R   ST MN  SSRSHAIFTI+                +  LP  G    + +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHLFGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDANGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCTQPDLVNEAVTGLP-DGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSK-KVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QISALRAEIARLQMEL 399          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21B (kinesin family member 21B [Source:HGNC Symbol;Acc:HGNC:29442])

HSP 1 Score: 316.235 bits (809), Expect = 4.902e-89
Identity = 174/394 (44.16%), Postives = 236/394 (59.90%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKE--MRHIR-------EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY----------------INILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V VR RP    E  +GC  C    PG   +++G  K FT+D VF     QE+IY   V  +I   F GYN TVLAYGQTG+GKTYTMGT F       E G+IPRAI+ ++  +   +  A           V   F+E+YNE+I DL  ST++   RH R       + N  I    +    ++  E++ +CL +G+ +R   ST MN  SSRSHAIFTI+                +  LP  G    + +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHLFGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDANGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCTQPDLVNEAVTGLP-DGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSK-KVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QISALRAEIARLQMEL 399          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIF21B (kinesin family member 21B [Source:HGNC Symbol;Acc:HGNC:29442])

HSP 1 Score: 316.235 bits (809), Expect = 4.963e-89
Identity = 174/394 (44.16%), Postives = 236/394 (59.90%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKE--MRHIR-------EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY----------------INILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V VR RP    E  +GC  C    PG   +++G  K FT+D VF     QE+IY   V  +I   F GYN TVLAYGQTG+GKTYTMGT F       E G+IPRAI+ ++  +   +  A           V   F+E+YNE+I DL  ST++   RH R       + N  I    +    ++  E++ +CL +G+ +R   ST MN  SSRSHAIFTI+                +  LP  G    + +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHLFGGIAERKRRAQEQGVAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDANGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCTQPDLVNEAVTGLP-DGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSK-KVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QISALRAEIARLQMEL 399          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-19 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:O45935])

HSP 1 Score: 314.694 bits (805), Expect = 1.088e-90
Identity = 226/657 (34.40%), Postives = 354/657 (53.88%), Query Frame = 1
Query:   61 MAPLSSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQ---AQLKGAVG----------NGMEALVLKPQVVSPS-HFSEICELKAEIV---AAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDM-EKDEIYLELEKLVTDMNKSEHMETLENADIA----DQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYAL---LQQYEEKNRELLQRIKELEEE--KLRNNSK-----------HRQ--DDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNK 1908
            M+  +S+RV VR RP+   E ++G   CV F      I+I  +  FTFD VF+D + QE +Y+ +   +++ +F G+N TVLAYGQTGSGKTYTMGT  +        G+IPR +S ++  +       +  V VS  EVY ++++DLL   K   ++  + ++  + NL    V   +   K L  G   R    TAMN  SSRSHA+FT+++     +   EC +    S+KL LVDLAGSER  KT A G+R KEG+NIN GLL+L  VI++L      K KH+PYR S +TR+LQDSLGGN+ T+ LACISP+DSN +ET  TL YA RA+QI+NKPI+N+   A+ EI  L+AQ+  LQ   A LK  +           N  E L LK +VV  +    E    ++E +   +A  QK   LE   E+ +K   +L  +   +   +M +  E+   ++++V D  +S  +   +N + A    D +  + + + + +A+ L+ L +++  K+ + Q+      A    +QQ E +  +L+ RI ELE E  KLR   K            RQ   DL+ +  E K+ LN++  L++ +      +K+ + ++  LK    ++ +E + E + F+    + +++   + +K
Sbjct:    1 MSSDASLRVVVRARPMNGRETKEGASRCVQFYENTKQIVINESATFTFDAVFADTSDQESVYETTALPLLDRIFAGFNATVLAYGQTGSGKTYTMGTEDNVGTDEMRRGIIPRLVSALFQRIMNTEAPESFAVTVSMFEVYGDNVYDLLRPDKVKLNVHGDEKNCTVVNLTAVPVIDLKGALKQLAVGCHYRTKAETAMNAMSSRSHAVFTVFVE---KTATAECDS--AFSAKLQLVDLAGSERLKKTEAEGNRMKEGININGGLLILSQVIAALA----TKQKHIPYRNSVITRVLQDSLGGNSFTVFLACISPADSNSQETLNTLRYADRAKQIKNKPIVNKNPKAE-EIAILQAQLKRLQKENADLKQGIAPAEVRFNDANNSAEILSLKEEVVRKTEQLKERAMKQSECIIRMSALTQKNSRLE---EDKAKLQSMLTDVRNTVLNEEMLDAAEVVRSIQQVVGDTEESTTLADDDNDETALGGQDDTIYDTERLPELQAE-LDDLEKQIAMKDENRQKALDEQRAFIEAMQQRESEKTQLVVRISELETEMNKLRQEGKKVTTAAKLAEERRQKLKDLERQHAEDKKVLNDMKKLQETRRRMEETLKKTEDELKNLKTQRLRLLREQRAEASKFQAFKQKHEREMAQMKSK 643          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 283.493 bits (724), Expect = 1.581e-82
Identity = 169/383 (44.13%), Postives = 231/383 (60.31%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIII----GGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTM-GTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS-TKEMRHIREE-NQDIKIPNLLEESVNCSEDIFKC---LMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLK-GAVGNGMEA 1188
            S+RV VR RP    E       CVG  P    + +    G  K FTFD  +   +T E+IY   V  ++ N+  GYN TV AYGQTGSGKT++M G       I ++ GVIPRA   I+       E     V  S++E+YNE++ DLL +  K+   I+E+ ++ + +  L   S++   D+  C   + RG  NR VG+T MN+ SSRSH+IFT+Y+  +  +G+           KL+LVDLAGSER SKT ATGDR KE   IN  L  LGNVIS+LV+    K+KH+PYR+SKLTRLLQDSLGGNTKT+M+AC+SPS  N++ET +TL YA RA+ I+NKP IN  D     + + + ++  L++ ++ GAVG G  A
Sbjct:    4 SVRVAVRCRPFNQREKDLNTTLCVGMTPNVGQVNLNAPDGAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIE----TIPAQRGVIPRAFDHIFT-ATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGL---SMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMTETGSIRM-------GKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDG---KSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINE-DPKDALLREYQEEIARLKSMVQPGAVGVGAPA 367          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-12 (Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc:B3GWD7])

HSP 1 Score: 286.574 bits (732), Expect = 1.096e-79
Identity = 174/389 (44.73%), Postives = 234/389 (60.15%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES--GVIPRAISDIY-------------DYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR---HIREENQ-DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY-----INILPLSGANECTT----FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V +R RP    E  +G + C    P    + IGG + FT+DHVF     Q  +Y+  V  +++ LF GYN TVLAYGQTGSGKT+TMGT F       E   GVIPRAI   +               L+P  E     V V F+E+YN+D+ DLLS  + M     I E+++ +I +  + + SV         L  G+ NR V +T MNE SSRSHAIFT++     +   PL  + E  T     E + +K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVI++L   +  K  HVPYR+SKLTRLLQDSLGGN++TLM+AC SPSDS+F ET  T+ YA RA++I+NK + N+ D +   I +LR+++ AL+A+L
Sbjct:    6 VQVALRIRPQGNREKLEGSRVCTSVLPNDPQVTIGGDRSFTYDHVFDMPTLQYVVYESCVEKLVDGLFDGYNATVLAYGQTGSGKTHTMGTAFDAAVTQKEEDLGVIPRAIQHTFRKIAECKAQAIEQGLLEPAFE-----VSVQFVELYNDDVLDLLSDDRSMSSSIRIHEDSRGEIVLHGVEQRSVFDMHGTMDILKNGALNRTVAATNMNEQSSRSHAIFTLHLKQQRVAANPLDESGEQKTGELEMEMLCAKFHFVDLAGSERMKRTGATGDRAKEGISINVGLLALGNVIAALGGANG-KVSHVPYRDSKLTRLLQDSLGGNSRTLMIACCSPSDSDFVETLNTMKYANRAKEIKNKVVANQ-DKSSKMIGELRSRIAALEAEL 387          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-12 (Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc:B3GWD7])

HSP 1 Score: 286.574 bits (732), Expect = 1.257e-79
Identity = 174/389 (44.73%), Postives = 234/389 (60.15%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES--GVIPRAISDIY-------------DYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR---HIREENQ-DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY-----INILPLSGANECTT----FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V +R RP    E  +G + C    P    + IGG + FT+DHVF     Q  +Y+  V  +++ LF GYN TVLAYGQTGSGKT+TMGT F       E   GVIPRAI   +               L+P  E     V V F+E+YN+D+ DLLS  + M     I E+++ +I +  + + SV         L  G+ NR V +T MNE SSRSHAIFT++     +   PL  + E  T     E + +K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVI++L   +  K  HVPYR+SKLTRLLQDSLGGN++TLM+AC SPSDS+F ET  T+ YA RA++I+NK + N+ D +   I +LR+++ AL+A+L
Sbjct:    6 VQVALRIRPQGNREKLEGSRVCTSVLPNDPQVTIGGDRSFTYDHVFDMPTLQYVVYESCVEKLVDGLFDGYNATVLAYGQTGSGKTHTMGTAFDAAVTQKEEDLGVIPRAIQHTFRKIAECKAQAIEQGLLEPAFE-----VSVQFVELYNDDVLDLLSDDRSMSSSIRIHEDSRGEIVLHGVEQRSVFDMHGTMDILKNGALNRTVAATNMNEQSSRSHAIFTLHLKQQRVAANPLDESGEQKTGELEMEMLCAKFHFVDLAGSERMKRTGATGDRAKEGISINVGLLALGNVIAALGGANG-KVSHVPYRDSKLTRLLQDSLGGNSRTLMIACCSPSDSDFVETLNTMKYANRAKEIKNKVVANQ-DKSSKMIGELRSRIAALEAEL 387          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: osm-3 (Osmotic avoidance abnormal protein 3 [Source:UniProtKB/Swiss-Prot;Acc:P46873])

HSP 1 Score: 273.863 bits (699), Expect = 2.764e-79
Identity = 157/344 (45.64%), Postives = 216/344 (62.79%), Query Frame = 1
Query:  178 GGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTM-GTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS-TKEMRHIREE-NQDIKIPNLLEESVNCSEDIFKC---LMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLK-GAVGNGMEA 1188
            G  K FTFD  +   +T E+IY   V  ++ N+  GYN TV AYGQTGSGKT++M G       I ++ GVIPRA   I+       E     V  S++E+YNE++ DLL +  K+   I+E+ ++ + +  L   S++   D+  C   + RG  NR VG+T MN+ SSRSH+IFT+Y+  +  +G+           KL+LVDLAGSER SKT ATGDR KE   IN  L  LGNVIS+LV+    K+KH+PYR+SKLTRLLQDSLGGNTKT+M+AC+SPS  N++ET +TL YA RA+ I+NKP IN  D     + + + ++  L++ ++ GAVG G  A
Sbjct:   15 GAAKDFTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIE----TIPAQRGVIPRAFDHIFT-ATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKLEIKEQPDRGVYVAGL---SMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVEGMTETGSIRM-------GKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDG---KSKHIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINE-DPKDALLREYQEEIARLKSMVQPGAVGVGAPA 339          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp3A (gene:FBgn0011606 transcript:FBtr0340093)

HSP 1 Score: 350.132 bits (897), Expect = 1.949e-102
Identity = 287/915 (31.37%), Postives = 465/915 (50.82%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCV--GFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSST---KEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEI-CELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKI--SCSDMEKDEIYLELEKLVTDMNKSEHMETLENA-DIADQSTEENKTVN-----KEKADILNCLREEL-RTKE-----AH-----LQQIEHTD---------YALLQQYEEK---------------NRELLQRIKELEEEKLRNNSKHRQDDLDIRLK---------EAKRQ--LNELNMLK------KEKEHSHNEVKQLKMKIDELKKSI-------------------------------CKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN-------KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLS--------EQLENFSEVDSEEKF--QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQ 2475
            S + V +R RPL  +EL  GC+  V     G   + +   + +T+++VF    +Q+++++  V+  +  L  GYNVT+LAYGQTGSGKTYTMGT F+ + +    GVIPRA+ DI+  +  ++      V  SF+E+Y E  +DL SS    K    IRE    I +P L E  V  ++ +   L+RGS  R V +TAMNETSSRSHAIFT+ +    L G    TT     S+ +LVDLAGSER SKT+A+GDRFKEGVNINKGLL LGNVI++L     Q   ++PYR+SKLTRLLQDSLGGN+ TLM+AC+SP+D N  ET +TL YA RA QI+NKP++N +D    E+  L+  +  L+ +L    G  M + ++    V  +    I CE   E +A        ++   E++    D  R++ +++  S  D+ + E+   + +   D  +S H+  L+N  D  +Q+   N+  N     ++ + ++N +  EL RT+E      H     L    HT+         + +L  + E+               NR+L  + +EL E  +RN S+   DD D++L+         EA+R+  +++L  +K      K  E     ++ L+ +I +L++ +                                K+ + ++ E   FR+    ++K+   L +KDR +++++ +Q   H+K+  VL+RK E  +A  KRLKD L+ +    A+R    +N        N   +   W+ + LE+     +       L+E+R  ++        E+  + +E   + +    L+ E++  N  IS LQQ    ++ D  ++++     +++ E R   K +   LVQ+R    +  S + ++R  +D L+
Sbjct:    7 SCVAVALRVRPLVQSELDRGCRIAVERSADGAPQVTVNRNESYTYNYVFDIDDSQKDLFETCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGV-LDDHVGVIPRAVHDIFTAIAEMQSEFRFAVTCSFVELYQEQFYDLFSSKTRDKATVDIREVKNRIIMPGLTELVVTSAQQVTDHLIRGSAGRAVAATAMNETSSRSHAIFTLTLVATKLDGKQSVTT-----SRFNLVDLAGSERCSKTLASGDRFKEGVNINKGLLALGNVINAL--GSGQAAGYIPYRQSKLTRLLQDSLGGNSITLMIACVSPADYNVAETLSTLRYADRALQIKNKPVVN-LDPHAAEVNMLKDVIQKLRVELLS--GGKMSSSLIS--AVGAAGLGAIPCE---ESLAGSMANAAEIQRLKEQVRTLQDRNRKLQQELHQSLLDLTEKEMRAHIAEQAHDKLRS-HVSELKNKLDQREQAQFGNENTNGDNEMRDFSLLVNRVHVELQRTQEELESQGHESRQRLSSRSHTEGGESGGDEVHEMLHSHSEEYTNKQMNFAGELRNINRQLDLK-QELHERIMRNFSRLDSDDEDVKLRLCNQKIDDLEAERRDLMDQLRNIKSKDISAKLAEERRKRLQLLEQEISDLRRKLITQANLLKIRDKEREKIQNLSTEIRTMKESKVKLIRAMRGESEKFRQWKMVREKELTQLKSKDRKMQSEIVRQQTLHSKQRQVLKRKCEEALAANKRLKDALERQASAQAQRHKYKDNGGSAAGSSNANAKTDSWVDRELEIILSLIDAEHSLEQLMEDRAVINNHYHLLQQEKTSDPAEAAEQARILASLEEELEMRNAQISDLQQKVCPTDLDS-RIRSLAEGVQSLGESRTVSKQLLKTLVQQR---RLQASSLNEQRTTLDELR 899          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp3A (gene:FBgn0011606 transcript:FBtr0070448)

HSP 1 Score: 350.132 bits (897), Expect = 1.949e-102
Identity = 287/915 (31.37%), Postives = 465/915 (50.82%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCV--GFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSST---KEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEI-CELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKI--SCSDMEKDEIYLELEKLVTDMNKSEHMETLENA-DIADQSTEENKTVN-----KEKADILNCLREEL-RTKE-----AH-----LQQIEHTD---------YALLQQYEEK---------------NRELLQRIKELEEEKLRNNSKHRQDDLDIRLK---------EAKRQ--LNELNMLK------KEKEHSHNEVKQLKMKIDELKKSI-------------------------------CKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN-------KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLS--------EQLENFSEVDSEEKF--QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQ 2475
            S + V +R RPL  +EL  GC+  V     G   + +   + +T+++VF    +Q+++++  V+  +  L  GYNVT+LAYGQTGSGKTYTMGT F+ + +    GVIPRA+ DI+  +  ++      V  SF+E+Y E  +DL SS    K    IRE    I +P L E  V  ++ +   L+RGS  R V +TAMNETSSRSHAIFT+ +    L G    TT     S+ +LVDLAGSER SKT+A+GDRFKEGVNINKGLL LGNVI++L     Q   ++PYR+SKLTRLLQDSLGGN+ TLM+AC+SP+D N  ET +TL YA RA QI+NKP++N +D    E+  L+  +  L+ +L    G  M + ++    V  +    I CE   E +A        ++   E++    D  R++ +++  S  D+ + E+   + +   D  +S H+  L+N  D  +Q+   N+  N     ++ + ++N +  EL RT+E      H     L    HT+         + +L  + E+               NR+L  + +EL E  +RN S+   DD D++L+         EA+R+  +++L  +K      K  E     ++ L+ +I +L++ +                                K+ + ++ E   FR+    ++K+   L +KDR +++++ +Q   H+K+  VL+RK E  +A  KRLKD L+ +    A+R    +N        N   +   W+ + LE+     +       L+E+R  ++        E+  + +E   + +    L+ E++  N  IS LQQ    ++ D  ++++     +++ E R   K +   LVQ+R    +  S + ++R  +D L+
Sbjct:    7 SCVAVALRVRPLVQSELDRGCRIAVERSADGAPQVTVNRNESYTYNYVFDIDDSQKDLFETCVQAKVKKLLNGYNVTILAYGQTGSGKTYTMGTAFNGV-LDDHVGVIPRAVHDIFTAIAEMQSEFRFAVTCSFVELYQEQFYDLFSSKTRDKATVDIREVKNRIIMPGLTELVVTSAQQVTDHLIRGSAGRAVAATAMNETSSRSHAIFTLTLVATKLDGKQSVTT-----SRFNLVDLAGSERCSKTLASGDRFKEGVNINKGLLALGNVINAL--GSGQAAGYIPYRQSKLTRLLQDSLGGNSITLMIACVSPADYNVAETLSTLRYADRALQIKNKPVVN-LDPHAAEVNMLKDVIQKLRVELLS--GGKMSSSLIS--AVGAAGLGAIPCE---ESLAGSMANAAEIQRLKEQVRTLQDRNRKLQQELHQSLLDLTEKEMRAHIAEQAHDKLRS-HVSELKNKLDQREQAQFGNENTNGDNEMRDFSLLVNRVHVELQRTQEELESQGHESRQRLSSRSHTEGGESGGDEVHEMLHSHSEEYTNKQMNFAGELRNINRQLDLK-QELHERIMRNFSRLDSDDEDVKLRLCNQKIDDLEAERRDLMDQLRNIKSKDISAKLAEERRKRLQLLEQEISDLRRKLITQANLLKIRDKEREKIQNLSTEIRTMKESKVKLIRAMRGESEKFRQWKMVREKELTQLKSKDRKMQSEIVRQQTLHSKQRQVLKRKCEEALAANKRLKDALERQASAQAQRHKYKDNGGSAAGSSNANAKTDSWVDRELEIILSLIDAEHSLEQLMEDRAVINNHYHLLQQEKTSDPAEAAEQARILASLEEELEMRNAQISDLQQKVCPTDLDS-RIRSLAEGVQSLGESRTVSKQLLKTLVQQR---RLQASSLNEQRTTLDELR 899          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0331642)

HSP 1 Score: 322.783 bits (826), Expect = 9.580e-94
Identity = 282/923 (30.55%), Postives = 459/923 (49.73%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGFP-GGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES---GVIPRAISDIYDYLDPLRETAT-----------VCVKVSFIEVYNEDIFDLLSSTKEMRHIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYIN---ILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILR-----RIWEKISCSDMEKDEI----YLELEKLVTDMNKS-EHMETLE--------------NADIADQSTE-----------------ENKTVNKEKADILNCLRE--------------ELRTKEAHLQQIEHTDYALLQ-QYEEKNRELLQRIKELEEEK--------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQ-------LKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMA--EGXXXXXXXXXXXXFSAK---------RVNRVNNKNICVQVKHWIR---------QHLE-LAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQ--VELTSEKDDMQ-----VQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELV 2463
            SS+RV VR RP    EL D C+ C     G   I +G  K FTFD+VF   + Q +IY   V  ++++   GYN TVLAYGQTGSGKTYTMGT F     SS+S   G+IPRA+  I+  ++ L  ++T             + V +IE+YNEDIFDLL    +  + +   + +  I I     + +    D  K L +G+  R   ST MN+ SSRSHA+FTI++    +L  S        E ++SK H VDLAGSER  +T ATG+R +EG++IN GLL LGN IS+L +K K +  HVPYR+SKLTRLLQDSLGGN++TLM+AC+SPSD +F ET  TL YA RAR I+NK  IN+ D +   I QLR ++ ALQ +L      G   +  +        F+E   L +EI   Q Q+++ L+     L++++  L+       W     SD+E  ++     LE+E+L T + +S EH + +E              ++DI  ++ +                 +N+ V+ E+ ++ +   E              E+RTK     ++ ++ Y  ++  YEEK   L  +I+  ++E+               +++ K  + D + ++   + ++ +L   ++E   S  ++K        L+ +++ELK +  K+ K++ ++ N  ++  + K K+   L+ + R  K  +    A+ + +  +L+RK E  +A  + +R K         ++K         R  R   +N+   + H  R         + LE L  ER + ++  N++ E  +    Q + F+EVD+     L+  I  + E I H+QQ  +E    KD +Q     +Q+  ++   + E +  ++      +    N  +A S +Q++  L+
Sbjct:   12 SSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSK-RALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQ-DQSSRTISQLRREIAALQLELL-EYKQGKLIVDCEGNTTISDTFNENKLLLSEIKRLQ-QRLKSLQSTIATLTQRNADLKTNLDLNKWTSDDNSDVEIAKVVGQYMLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDIITKAKKDLERERELLMSRSLPGIQNQNVSSEETEVASSDSEEEVVKDLEAIDNDIEMRTKLIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREHIRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQRGKSGQRAPAHLTSKIATLDGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIM-ENGQTADRQTDEFNEVDN-----LKTNISYIQENIEHVQQAIMEFEDTKDTVQSHVNKIQSLLDEVSTVAEAKFILQKFSDTAIVMSCNLAIAESHLQEKESLL 924          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0302039)

HSP 1 Score: 322.783 bits (826), Expect = 1.002e-93
Identity = 285/926 (30.78%), Postives = 460/926 (49.68%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGFP-GGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES---GVIPRAISDIYDYLDPLRETAT-----------VCVKVSFIEVYNEDIFDLLSSTKEMRHIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYIN---ILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILR-----RIWEKISCSDMEKDEI----YLELEKLVTDMNKS-EHMETLE--------------NADIADQSTEE-----------------NKTVNKEKADILNCLRE---------------ELRTKEAHLQQIEHTDYALLQ---QYEEKNRELLQRIKELEEEK--------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKI-------DELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMA--EGXXXXXXXXXXXXFSAK---------RVNRVNNKNICVQVKHWIR---------QHLE-LAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQ--VELTSEKDDMQ-----VQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELV 2463
            SS+RV VR RP    EL D C+ C     G   I +G  K FTFD+VF   + Q +IY   V  ++++   GYN TVLAYGQTGSGKTYTMGT F     SS+S   G+IPRA+  I+  ++ L  ++T             + V +IE+YNEDIFDLL    +  + +   + +  I I     + +    D  K L +G+  R   ST MN+ SSRSHA+FTI++    +L  S        E ++SK H VDLAGSER  +T ATG+R +EG++IN GLL LGN IS+L +K K +  HVPYR+SKLTRLLQDSLGGN++TLM+AC+SPSD +F ET  TL YA RAR I+NK  IN+ D +   I QLR ++ ALQ +L      G   +  +        F+E   L +EI   Q Q+++ L+     L++++  L+       W     SD+E  ++     LE+E+L T + +S EH + +E              ++DI  ++ ++                 N+ V+ E+ ++ +   E               E+RTK   ++Q+E T+    Q    YEEK   L  +I+  ++E+               +++ K  + D + ++   + ++ +L   ++E   S  ++K  +++I       +ELK +  K+ K++ ++ N  ++  + K K+   L+ + R  K  +    A+ + +  +L+RK E  +A  + +R K         ++K         R  R   +N+   + H  R         + LE L  ER + ++  N++ E  +    Q + F+EVD+     L+  I  + E I H+QQ  +E    KD +Q     +Q+  ++   + E +  ++      +    N  +A S +Q++  L+
Sbjct:   12 SSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSK-RALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQ-DQSSRTISQLRREIAALQLELL-EYKQGKLIVDCEGNTTISDTFNENKLLLSEIKRLQ-QRLKSLQSTIATLTQRNADLKTNLDLNKWTSDDNSDVEIAKVVGQYMLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDIITKAKKDLERERELLMSRSLPGIQNQNVSSEETEVASSDSEAEEVVKDLEAIDNDIEMRTK--LIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREHIRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQRGKSGQRAPAHLTSKIATLDGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIM-ENGQTADRQTDEFNEVDN-----LKTNISYIQENIEHVQQAIMEFEDTKDTVQSHVNKIQSLLDEVSTVAEAKFILQKFSDTAIVMSCNLAIAESHLQEKESLL 925          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp31E (gene:FBgn0032243 transcript:FBtr0080018)

HSP 1 Score: 322.783 bits (826), Expect = 1.002e-93
Identity = 285/926 (30.78%), Postives = 460/926 (49.68%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGFP-GGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES---GVIPRAISDIYDYLDPLRETAT-----------VCVKVSFIEVYNEDIFDLLSSTKEMRHIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYIN---ILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILR-----RIWEKISCSDMEKDEI----YLELEKLVTDMNKS-EHMETLE--------------NADIADQSTEE-----------------NKTVNKEKADILNCLRE---------------ELRTKEAHLQQIEHTDYALLQ---QYEEKNRELLQRIKELEEEK--------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKI-------DELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMA--EGXXXXXXXXXXXXFSAK---------RVNRVNNKNICVQVKHWIR---------QHLE-LAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQ--VELTSEKDDMQ-----VQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELV 2463
            SS+RV VR RP    EL D C+ C     G   I +G  K FTFD+VF   + Q +IY   V  ++++   GYN TVLAYGQTGSGKTYTMGT F     SS+S   G+IPRA+  I+  ++ L  ++T             + V +IE+YNEDIFDLL    +  + +   + +  I I     + +    D  K L +G+  R   ST MN+ SSRSHA+FTI++    +L  S        E ++SK H VDLAGSER  +T ATG+R +EG++IN GLL LGN IS+L +K K +  HVPYR+SKLTRLLQDSLGGN++TLM+AC+SPSD +F ET  TL YA RAR I+NK  IN+ D +   I QLR ++ ALQ +L      G   +  +        F+E   L +EI   Q Q+++ L+     L++++  L+       W     SD+E  ++     LE+E+L T + +S EH + +E              ++DI  ++ ++                 N+ V+ E+ ++ +   E               E+RTK   ++Q+E T+    Q    YEEK   L  +I+  ++E+               +++ K  + D + ++   + ++ +L   ++E   S  ++K  +++I       +ELK +  K+ K++ ++ N  ++  + K K+   L+ + R  K  +    A+ + +  +L+RK E  +A  + +R K         ++K         R  R   +N+   + H  R         + LE L  ER + ++  N++ E  +    Q + F+EVD+     L+  I  + E I H+QQ  +E    KD +Q     +Q+  ++   + E +  ++      +    N  +A S +Q++  L+
Sbjct:   12 SSVRVAVRIRPQNSRELIDMCRICTTVTLGEPQIFLGSDKAFTFDYVFDTNSNQCDIYSDCVEKLVDSTLHGYNATVLAYGQTGSGKTYTMGTGFDHESESSDSVQLGIIPRAVRHIFSGIEQLEGSSTSEHPAAGGSPQFSLAVQYIELYNEDIFDLLDPFNKNSNFKIHEDASGQITISGASIKPIYQPHDALKYLQQGALARTTASTKMNDQSSRSHALFTIFVRRQRLLTPSDNVPDNDLETLTSKFHFVDLAGSERLKRTQATGERAREGISINCGLLALGNCISALGDKSK-RALHVPYRDSKLTRLLQDSLGGNSQTLMIACVSPSDRDFMETLNTLKYANRARNIKNKVKINQ-DQSSRTISQLRREIAALQLELL-EYKQGKLIVDCEGNTTISDTFNENKLLLSEIKRLQ-QRLKSLQSTIATLTQRNADLKTNLDLNKWTSDDNSDVEIAKVVGQYMLEIEELQTKLIESEEHRKQMEIKATTSPRNAKPVYDSDIITKAKKDLERERELLMSRSLPGIQNQNVSSEETEVASSDSEAEEVVKDLEAIDNDIEMRTK--LIEQLELTNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVSTPSKDSLKKVKTDYESKISHMQTEIRKLQNAQREHIRSKQQLKSHEVRIGTLRNELNELKFAKVKLMKKMSQQSNRHKQEESRKSKEIAQLLKEQRRQKNAVLTLEAKVSAKEQILKRKTEEVIALRKSQRGKSGQRAPAHLTSKIATLDGFSTRSARHRWENLYRNILHAARNRQLITQLEKELERLILEREDLSRELNIM-ENGQTADRQTDEFNEVDN-----LKTNISYIQENIEHVQQAIMEFEDTKDTVQSHVNKIQSLLDEVSTVAEAKFILQKFSDTAIVMSCNLAIAESHLQEKESLL 925          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 383.645 bits (984), Expect = 3.301e-114
Identity = 307/922 (33.30%), Postives = 467/922 (50.65%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNF-SDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKE--MRHIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEAL-----------VLKPQVVSPSHFSEICELKAEIV---AAQRQKIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD--------EIYLELEKLVTDMNKSEHMETLENADIADQSTEENKTVNKEKADIL--------------------NCLREE------------LRTKEAHLQQIEHTDYAL--LQ-QYEEKNRELLQRIKELEEEK------------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSE-------------------VDSEEKFQLQMEIKRLNEC-----------ISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   E+ +GCQ C+ F P    +I+G  K FTFD+VF     QEE++  +V  +++ LF GY+ TVLAYGQTGSGKT++MG  + S+ +     GVIPR I  I+      R      + VS++E+YNE+I DLL ++K+  +  IRE+ +D IKI  L E  V  + ++  CL  G+  R VGSTAMN  SSRSHAIFTI      L         + + SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKP++N VD    E+ +L+ QV  LQ  L  A G     L           VL+         S++    +E V   AA  +++ ++E+ +E+L  K D LR          R+ E +   ++ ++        +I LEL++    +  +    T  NA   + +   + +    +ADI                     + LR+             L  KEA ++++   D  L  +Q QY+E  + L   +  L++EK                  L    + R  +L+ ++ E K++L + + L K KE S   V +L  +I  +K    ++ ++++ +   FR    +KDK+   L  KDR  + +M K      K+ +VLRRK E   A  KRLKD L  + + + KR  V     +++  +VK+W+   +E+     E  +    L+E+R+ L+E++    +                    + E K +L+  I +  E            I+ LQQ  L ++ +    Q  W+    + E + A+K +  ++V  +  N    SE+QQE+  +  +QK
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLNFVPSEPQVIVGNDKAFTFDYVFDPTTEQEEVFNTAVSPLLSGLFKGYHATVLAYGQTGSGKTFSMGGTYTSEQENEPTVGVIPRVIRRIFQE-KAKRTDCEFVLAVSYLEIYNEEILDLLCTSKDKPVISIREDPKDGIKIVGLTERDVLNAHEMVCCLEMGNSARTVGSTAMNAASSRSHAIFTIS-----LEQRRNGDKTDVMVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNIEETINTLRYADRARKIKNKPVLN-VDPRAAEMKRLKQQVQELQVMLLHARGGVAPVLSGSEPAENVSKVLEQNRSLQDQNSKLSRELSESVGQTAAMFERMLMMEQTNEKLQSKLDELRQHAACKVDLQRLVETLEDQELRENVEVIQNLQQIILELQRESAGIAATIDAITSGNASSLEAAAHCSPSTAGAQADICPGQDGAVPEAKDSPEAYTAQHALRQAQMSKELIELNKVLALKEAFVKKMCQNDSHLEPMQTQYQESIQSLQAAVGSLQKEKEDLVQTLQSAKKDTNQAKLSEQRRKRLQELEGQMTELKKKLQDQSKLLKLKESSVRNVAKLNQEIQAMKSQRVQLMRQMKDDSEKFRLWKQKKDKEVLQLKEKDRKRQYEMLKLERDFQKQASVLRRKTEEAAAANKRLKDALQKRSEVAEKRKDVQNRGAESVTNRVKNWLLNEIEVLVSTEEARRHLQDLLEDRKMLAEEISQLRQQMEAGEKPVSKVRRRTLTISELEGKCELEASISKQVESLDTEMALRSAQIADLQQKVLDADNEGRMKQR-WDSITTLIEAKSALKILMAEVVASKTLNAKQESELQQEKANLLDMQK 923          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 383.645 bits (984), Expect = 3.301e-114
Identity = 307/922 (33.30%), Postives = 467/922 (50.65%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNF-SDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKE--MRHIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEAL-----------VLKPQVVSPSHFSEICELKAEIV---AAQRQKIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD--------EIYLELEKLVTDMNKSEHMETLENADIADQSTEENKTVNKEKADIL--------------------NCLREE------------LRTKEAHLQQIEHTDYAL--LQ-QYEEKNRELLQRIKELEEEK------------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSE-------------------VDSEEKFQLQMEIKRLNEC-----------ISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   E+ +GCQ C+ F P    +I+G  K FTFD+VF     QEE++  +V  +++ LF GY+ TVLAYGQTGSGKT++MG  + S+ +     GVIPR I  I+      R      + VS++E+YNE+I DLL ++K+  +  IRE+ +D IKI  L E  V  + ++  CL  G+  R VGSTAMN  SSRSHAIFTI      L         + + SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKP++N VD    E+ +L+ QV  LQ  L  A G     L           VL+         S++    +E V   AA  +++ ++E+ +E+L  K D LR          R+ E +   ++ ++        +I LEL++    +  +    T  NA   + +   + +    +ADI                     + LR+             L  KEA ++++   D  L  +Q QY+E  + L   +  L++EK                  L    + R  +L+ ++ E K++L + + L K KE S   V +L  +I  +K    ++ ++++ +   FR    +KDK+   L  KDR  + +M K      K+ +VLRRK E   A  KRLKD L  + + + KR  V     +++  +VK+W+   +E+     E  +    L+E+R+ L+E++    +                    + E K +L+  I +  E            I+ LQQ  L ++ +    Q  W+    + E + A+K +  ++V  +  N    SE+QQE+  +  +QK
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLNFVPSEPQVIVGNDKAFTFDYVFDPTTEQEEVFNTAVSPLLSGLFKGYHATVLAYGQTGSGKTFSMGGTYTSEQENEPTVGVIPRVIRRIFQE-KAKRTDCEFVLAVSYLEIYNEEILDLLCTSKDKPVISIREDPKDGIKIVGLTERDVLNAHEMVCCLEMGNSARTVGSTAMNAASSRSHAIFTIS-----LEQRRNGDKTDVMVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNIEETINTLRYADRARKIKNKPVLN-VDPRAAEMKRLKQQVQELQVMLLHARGGVAPVLSGSEPAENVSKVLEQNRSLQDQNSKLSRELSESVGQTAAMFERMLMMEQTNEKLQSKLDELRQHAACKVDLQRLVETLEDQELRENVEVIQNLQQIILELQRESAGIAATIDAITSGNASSLEAAAHCSPSTAGAQADICPGQDGAVPEAKDSPEAYTAQHALRQAQMSKELIELNKVLALKEAFVKKMCQNDSHLEPMQTQYQESIQSLQAAVGSLQKEKEDLVQTLQSAKKDTNQAKLSEQRRKRLQELEGQMTELKKKLQDQSKLLKLKESSVRNVAKLNQEIQAMKSQRVQLMRQMKDDSEKFRLWKQKKDKEVLQLKEKDRKRQYEMLKLERDFQKQASVLRRKTEEAAAANKRLKDALQKRSEVAEKRKDVQNRGAESVTNRVKNWLLNEIEVLVSTEEARRHLQDLLEDRKMLAEEISQLRQQMEAGEKPVSKVRRRTLTISELEGKCELEASISKQVESLDTEMALRSAQIADLQQKVLDADNEGRMKQR-WDSITTLIEAKSALKILMAEVVASKTLNAKQESELQQEKANLLDMQK 923          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21b (kinesin family member 21B [Source:ZFIN;Acc:ZDB-GENE-130530-537])

HSP 1 Score: 310.842 bits (795), Expect = 2.164e-87
Identity = 174/396 (43.94%), Postives = 242/396 (61.11%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKIS-SESGVIPRAISDIYDYLDPLRETATVC--------VKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKI----------PNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---NILP--------LSGANECTT----FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            S++V +R RP    E  +GC  C    PG   +++G  K FT+D VF   A Q++IY   V  +I   F GYN TV AYGQTGSGKTYTMGT F D+ +S  E G+IPRA+  ++  +   R  A           V   F+E+YNE+I DL  ST++    R    +IKI            +    V+  +++ +CL  G+ +R   ST MN  SSRSHAIFTI++    + P        L+G ++ +     +E +S+K H VDLAGSER  +T ATG+R +EG++IN GLL LGNVIS+L ++ K+   HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK I+N+  ++Q +I  LRA++  LQ ++
Sbjct:    8 SVKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDAHQQQIYSACVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVSVSEDEQGIIPRAVHQLFQGIQKRRLEAQSADIPPPDFKVSAQFLELYNEEILDLFDSTRDP-EARGRKSNIKIHEDGSGGIYTTGVTSRLVSSEDELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQPQLVNGELNGVSDGSMSQSEYETLSAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKRAG-HVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVIVNQDKTSQ-QISALRAEIARLQMEI 399          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 310.457 bits (794), Expect = 2.814e-87
Identity = 174/401 (43.39%), Postives = 245/401 (61.10%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIP----------NLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---------NILP---------LSGAN-ECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            S++RV +R RP    E  +GC  C    P    +++G  K FT+D+VF   +TQ+ IY      +I   F GYN T+ AYGQTGSGKTYTMGT F D+ I  E  G+IPRA++ ++  ++  R+ A           +   F+E+YNE++ DL  +T++M   R++   IKI            +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI+I         +  P         L+G++ E   FE +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K ++ HVPYR+SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L
Sbjct:    4 STVRVALRIRPQLAKEKIEGCHICTFVMPDEPQVVLGKDKAFTYDYVFDMDSTQDNIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGF-DVAIPDEDLGIIPRAVTHLFKGIEQRRQQAAEQSRPVPEFKISAQFLELYNEEVLDLFDTTRDMES-RKQKSHIKIHEDASGGIYTVGVTTRNVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHICQIRVCAPADSPPEQDNETDNRLAGSSSEMEEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDRSK-RSTHVPYRDSKLTRLLQDSLGGNSRTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQ-DRASQQISALRTEIARLQMEL 400          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kif21b (kinesin family member 21B [Source:ZFIN;Acc:ZDB-GENE-130530-537])

HSP 1 Score: 304.679 bits (779), Expect = 2.447e-86
Identity = 168/379 (44.33%), Postives = 233/379 (61.48%), Query Frame = 1
Query:  127 DGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKIS-SESGVIPRAISDIYDYLDPLRETATVC--------VKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKI----------PNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---NILP--------LSGANECTT----FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +GC  C    PG   +++G  K FT+D VF   A Q++IY   V  +I   F GYN TV AYGQTGSGKTYTMGT F D+ +S  E G+IPRA+  ++  +   R  A           V   F+E+YNE+I DL  ST++    R    +IKI            +    V+  +++ +CL  G+ +R   ST MN  SSRSHAIFTI++    + P        L+G ++ +     +E +S+K H VDLAGSER  +T ATG+R +EG++IN GLL LGNVIS+L ++ K+   HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK I+N+  ++Q +I  LRA++  LQ ++
Sbjct:    7 EGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDAHQQQIYSACVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVSVSEDEQGIIPRAVHQLFQGIQKRRLEAQSADIPPPDFKVSAQFLELYNEEILDLFDSTRDP-EARGRKSNIKIHEDGSGGIYTTGVTSRLVSSEDELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQPQLVNGELNGVSDGSMSQSEYETLSAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSKRAG-HVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVIVNQDKTSQ-QISALRAEIARLQMEI 381          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cyp2a6.7 (cytochrome P450 family 2 subfamily A member 6 gene 7 [Source:Xenbase;Acc:XB-GENE-5764740])

HSP 1 Score: 396.741 bits (1018), Expect = 1.398e-119
Identity = 335/1032 (32.46%), Postives = 508/1032 (49.22%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICE-----------LKAEIVAAQRQ------KIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMNK-----SEHMETLENADIADQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEK---EHSHNEVKQLKMKIDE----------LKKSICKVTKELQKEKN-------NFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSE---------------------------QLENFSEVDSE----EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKA---NEKLEAELETIRTDNEITLNQ-----------KLKKRRTSSSW---EPEKERQSKRLKHCSD------------TEXXXXXXXXXXXXXXXLGCRCKTGCKPSRCGCLKSSASCNDKCSC 2763
            +RV +R RPL   EL +GC++C+ F PG   +I+G  K FT+D+VF     QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++ D +     GVIPR +  ++  ++  R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I+       N   +F    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L +++K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L      + PS +   + E           L  E+  A  Q      KI L E+ +E+L+ K + L+          R+ E +   +++++  + L+L++++  +       +  +E +   ++A  S E++    K  +D                   L + L  KEA  +++   D     Q E    E L  IK+LE E      +  ++DL + L  AK+  N+  + ++ +   +    ++ +LK K+ E           +K++ K+  E+Q  K         FR    +K K+   L  KDR  + ++ K      K+  VLRRK E      KRLK+ L  +K+   KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++                           +LEN  E  S     E  + +ME++     I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  +  LQK         AE+ET      + L Q           +L++++        EP  E+ ++R K   +             E    +    +       C CK  C    CGC K+  +C+D C C
Sbjct:    9 VRVALRCRPLVPKELNEGCKTCLTFVPGEPQVIVGTEKSFTYDYVFDPSTEQEEVYNSAVGPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHDQENEPTVGVIPRVVKALFREIEQ-RSEWEFHLKVSYLEIYNEEILDLLYAARDKTNAISIREDPKEGIKICGLTERDVKTALDTVSCLEQGNSSRTVASTAMNSQSSRSHAIFTISIDQRKEGDKN--NSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDENK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKQQVQELQVLLLQAHGGTLPVL----NSMEPSDNLQSLMERNKNLEEENGKLSRELSEAAVQTAQFLEKIILTEQQNEKLASKIEELKQHAACKVDLQRLVETLEDQELKENVGVILDLQQVIMQLQDESSGIAASIEAM--TEVAASSPEDSG--EKRSSDAFTTDHALRQAQLSKELIELNKALLLKEALARKMAQND----SQLEPIQSEYLNNIKQLESEV--GALQKEKEDLIMALHSAKKDTNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVTKLNHEIQVSKTLMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAATANKRLKEALLRQKEAMEKRKDSQNRGMEGAASRVKSWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKKDAGERIPTKMRRRTYTVAELENMEEESSVTKQIESLETEMELRSAQ--IADLQQKLLDADAEEEMVKRRWETITNIMEAKCALKYLITELVSSKVAVSKLESSVKQNRAHIADLQKTIFEERNQMAEMETEHQSQLMQLEQQHQEKILYLLSQLQQKQAPVPVQVEEPPAEQMTEREKQLMERLRFQDEEIEKMKELCEKNQQLLQENDMYKQCSCKARCGNKMCGCRKTKQNCSDDCFC 1016          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cyp2a6.7 (cytochrome P450 family 2 subfamily A member 6 gene 7 [Source:Xenbase;Acc:XB-GENE-5764740])

HSP 1 Score: 391.349 bits (1004), Expect = 1.869e-117
Identity = 313/911 (34.36%), Postives = 467/911 (51.26%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICE-----------LKAEIVAAQRQ------KIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMNK-----SEHMETLENADIADQSTEENKTVNKEKADILNCLRE------------ELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEE-------------------------KLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKE-KNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSE---------------------------QLENFSEVDSE----EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   EL +GC++C+ F PG   +I+G  K FT+D+VF     QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++ D +     GVIPR +  ++  ++  R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I+       N   +F    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L +++K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L      + PS +   + E           L  E+  A  Q      KI L E+ +E+L+ K + L+          R+ E +   +++++  + L+L++++  +       +  +E +   ++A + + E ++ +    D  + LR+             L  KEA  +++   D     Q E    E L  IK+LE E                         KL    + R  +L+ ++ E K++L E + L K +E +   V +L  +I        +V+K L KE    FR    +K K+   L  KDR  + ++ K      K+  VLRRK E      KRLK+ L  +K+   KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++                           +LEN  E  S     E  + +ME++     I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  +  LQK
Sbjct:    9 VRVALRCRPLVPKELNEGCKTCLTFVPGEPQVIVGTEKSFTYDYVFDPSTEQEEVYNSAVGPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHDQENEPTVGVIPRVVKALFREIEQ-RSEWEFHLKVSYLEIYNEEILDLLYAARDKTNAISIREDPKEGIKICGLTERDVKTALDTVSCLEQGNSSRTVASTAMNSQSSRSHAIFTISIDQRKEGDKN--NSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDENK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKQQVQELQVLLLQAHGGTLPVL----NSMEPSDNLQSLMERNKNLEEENGKLSRELSEAAVQTAQFLEKIILTEQQNEKLASKIEELKQHAACKVDLQRLVETLEDQELKENVGVILDLQQVIMQLQDESSGIAASIEAM--TEVAPRDSGEKRSSDAFTTD--HALRQAQLSKELIELNKALLLKEALARKMAQND----SQLEPIQSEYLNNIKQLESEVGALQKEKEDLIMALHSAKKDTNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVTKLNHEI--------QVSKTLMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAATANKRLKEALLRQKEAMEKRKDSQNRGMEGAASRVKSWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKKDAGERIPTKMRRRTYTVAELENMEEESSVTKQIESLETEMELRSAQ--IADLQQKLLDADAEEEMVKRRWETITNIMEAKCALKYLITELVSSKVAVSKLESSVKQNRAHIADLQK 889          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cyp2a6.7 (cytochrome P450 family 2 subfamily A member 6 gene 7 [Source:Xenbase;Acc:XB-GENE-5764740])

HSP 1 Score: 392.504 bits (1007), Expect = 2.454e-117
Identity = 307/910 (33.74%), Postives = 465/910 (51.10%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICE-----------LKAEIVAAQRQ------KIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMNK-----SEHMETLENADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQ------------QYEEKNRELLQRIKELEEE-------------------------KLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSE---------------------------QLENFSEVDSE----EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   EL +GC++C+ F PG   +I+G  K FT+D+VF     QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++ D +     GVIPR +  ++  ++  R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I+       N   +F    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L +++K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L      + PS +   + E           L  E+  A  Q      KI L E+ +E+L+ K + L+          R+ E +   +++++  + L+L++++  +       +  +E +     +   +EE +   ++++         LR  +   + IE     LL+            Q E    E L  IK+LE E                         KL    + R  +L+ ++ E K++L E + L K +E +   V +L  +I  +K    ++  +++++   FR    +K K+   L  KDR  + ++ K      K+  VLRRK E      KRLK+ L  +K+   KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++                           +LEN  E  S     E  + +ME++     I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  +  LQK
Sbjct:    9 VRVALRCRPLVPKELNEGCKTCLTFVPGEPQVIVGTEKSFTYDYVFDPSTEQEEVYNSAVGPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHDQENEPTVGVIPRVVKALFREIEQ-RSEWEFHLKVSYLEIYNEEILDLLYAARDKTNAISIREDPKEGIKICGLTERDVKTALDTVSCLEQGNSSRTVASTAMNSQSSRSHAIFTISIDQRKEGDKN--NSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDENK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKQQVQELQVLLLQAHGGTLPVL----NSMEPSDNLQSLMERNKNLEEENGKLSRELSEAAVQTAQFLEKIILTEQQNEKLASKIEELKQHAACKVDLQRLVETLEDQELKENVGVILDLQQVIMQLQDESSGIAASIEAMTEVAASSPESEEPRDSGEKRSSDAFTTDHALRQAQLSKELIELNKALLLKEALARKMAQNDSQLEPIQSEYLNNIKQLESEVGALQKEKEDLIMALHSAKKDTNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVTKLNHEIQGMKVQRVQLM-QMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAATANKRLKEALLRQKEAMEKRKDSQNRGMEGAASRVKSWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKKDAGERIPTKMRRRTYTVAELENMEEESSVTKQIESLETEMELRSAQ--IADLQQKLLDADAEEEMVKRRWETITNIMEAKCALKYLITELVSSKVAVSKLESSVKQNRAHIADLQK 903          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cyp2a6.7 (cytochrome P450 family 2 subfamily A member 6 gene 7 [Source:Xenbase;Acc:XB-GENE-5764740])

HSP 1 Score: 391.734 bits (1005), Expect = 3.006e-117
Identity = 315/913 (34.50%), Postives = 464/913 (50.82%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICE-----------LKAEIVAAQRQ------KIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMNKSEHMETLENA--DIADQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEE-------------------------KLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKE-KNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSE-----------------------------QLENFSEVDSE----EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   EL +GC++C+ F PG   +I+G  K FT+D+VF     QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++ D +     GVIPR +  ++  ++  R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I+       N   +F    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L +++K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L      + PS +   + E           L  E+  A  Q      KI L E+ +E+L+ K + L+          R+ E +   +++++  + L+L++++  +  S  +     A  ++A  S E++    K  +D                   L + L  KEA  +++   D     Q E    E L  IK+LE E                         KL    + R  +L+ ++ E K++L E + L K +E +   V +L  +I        +V+K L KE    FR    +K K+   L  KDR  + ++ K      K+  VLRRK E      KRLK+ L  +K+   KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++                             +LEN  E  S     E  + +ME++     I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  +  LQK
Sbjct:    9 VRVALRCRPLVPKELNEGCKTCLTFVPGEPQVIVGTEKSFTYDYVFDPSTEQEEVYNSAVGPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHDQENEPTVGVIPRVVKALFREIEQ-RSEWEFHLKVSYLEIYNEEILDLLYAARDKTNAISIREDPKEGIKICGLTERDVKTALDTVSCLEQGNSSRTVASTAMNSQSSRSHAIFTISIDQRKEGDKN--NSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDENK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKQQVQELQVLLLQAHGGTLPVL----NSMEPSDNLQSLMERNKNLEEENGKLSRELSEAAVQTAQFLEKIILTEQQNEKLASKIEELKQHAACKVDLQRLVETLEDQELKENVGVILDLQQVIMQLQVSSGIAASIEAMTEVAASSPEDSG--EKRSSDAFTTDHALRQAQLSKELIELNKALLLKEALARKMAQND----SQLEPIQSEYLNNIKQLESEVGALQKEKEDLIMALHSAKKDTNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVTKLNHEI--------QVSKTLMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAATANKRLKEALLRQKEAMEKRKDSQNRGMEGAASRVKSWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKKDAGERIPTKIFLFRRTYTVAELENMEEESSVTKQIESLETEMELRSAQ--IADLQQKLLDADAEEEMVKRRWETITNIMEAKCALKYLITELVSSKVAVSKLESSVKQNRAHIADLQK 893          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: cyp2a6.7 (cytochrome P450 family 2 subfamily A member 6 gene 7 [Source:Xenbase;Acc:XB-GENE-5764740])

HSP 1 Score: 360.147 bits (923), Expect = 2.941e-106
Identity = 190/377 (50.40%), Postives = 249/377 (66.05%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEAL 1191
            +RV +R RPL   EL +GC++C+ F PG   +I+G  K FT+D+VF     QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++ D +     GVIPR +  ++  ++  R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I+        E   +    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L +++K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L
Sbjct:    9 VRVALRCRPLVPKELNEGCKTCLTFVPGEPQVIVGTEKSFTYDYVFDPSTEQEEVYNSAVGPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHDQENEPTVGVIPRVVKALFREIEQ-RSEWEFHLKVSYLEIYNEEILDLLYAARDKTNAISIREDPKEGIKICGLTERDVKTALDTVSCLEQGNSSRTVASTAMNSQSSRSHAIFTISID-----QRKEGDKYVNFRSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDENK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKQQVQELQVLLLQAHGGTLPVL 377          

HSP 2 Score: 71.633 bits (174), Expect = 5.852e-12
Identity = 115/467 (24.63%), Postives = 196/467 (41.97%), Query Frame = 1
Query: 1552 HLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKE-KNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSE---------------------------QLENFSEVDSE----EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKA-----NEKLEAE---------LETIRTDNEITLNQKLKKRRTSSSW---EPEKERQSKRLKHCSD------------TEXXXXXXXXXXXXXXXLGCRCKTGCKPSRCGCLKSSASCNDKCSC 2763
            +++Q+E    AL ++ E+    L    K+  + KL    + R  +L+ ++ E K++L E + L K +E +   V +L  +I        +V+K L KE    FR    +K K+   L  KDR  + ++ K      K+  VLRRK E      KRLK+ L  +K+   KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++                           +LEN  E  S     E  + +ME++     I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  +  LQK      N+  E E         LE    +  + L  +L++++        EP  E+ ++R K   +             E    +    +       C CK  C    CGC K+  +C+D C C
Sbjct:  564 NIKQLESEVGALQKEKEDLIMALHSAKKDTNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVTKLNHEI--------QVSKTLMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAATANKRLKEALLRQKEAMEKRKDSQNRGMEGAASRVKSWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKKDAGERIPTKMRRRTYTVAELENMEEESSVTKQIESLETEMELRSAQ--IADLQQKLLDADAEEEMVKRRWETITNIMEAKCALKYLITELVSSKVAVSKLESSVKQNRAHIADLQKTIFEERNQMAEMETEHQSQLMQLEQQHQEKILYLLSQLQQKQAPVPVQVEEPPAEQMTEREKQLMERLRFQDEEIEKMKELCEKNQQLLQENDMYKQCSCKARCGNKMCGCRKTKQNCSDDCFC 1020          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif4 (kinesin family member 4 [Source:MGI Symbol;Acc:MGI:108389])

HSP 1 Score: 386.726 bits (992), Expect = 2.521e-115
Identity = 298/882 (33.79%), Postives = 467/882 (52.95%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR---HIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEI------------YQLRAQVTALQAQLKGAVGNGMEALVLKPQ--VVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRR----------IWEKISCSDMEKD-EIYLELEKLVTDMNKSEH---METLENADIADQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQ---QYEEKNREL------LQRIKE---LE---------EEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQL----------EN-----------FSEVDSEEKF----------QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERV 2415
            +RV +R RPL   E+++GCQ+C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++ + +  S  GVIPR I  ++  ++  +      +KVS++E+YNE+I DLL S++E     +IRE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I     +  N  ++F    SKLHLVDLAGSER  KT A GDR +EG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPIIN +D    E+              L+A    L   +       +++L+ K Q  V      S      A   A   ++I L E+ +E+++ K + LRR          + E +   +++++ EI   L++++  ++         T++ A  AD   + +   ++  +D+ +                L + L  KEA  +++   D  L     QY++  + L      LQR KE   LE         + KL    + R  +L+ ++ + K++L E + L K KE + + V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K++ VLRRK E   A  KRLKD L  +K+ + KR        ++   ++K+W+   +E+     E  +  N L+EER+ L++ +          EN           + E+  ++             L+ E++  +  I+ LQQ  L +E +D   Q  W     I E + AIK++  +LV  ++
Sbjct:   10 VRVALRCRPLVSKEIKEGCQTCLSFVPGEPQVVVGNDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINK-KSDFEFTLKVSYLEIYNEEILDLLCSSREKATQINIREDPKEGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDKN--SSFR---SKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISAL--GDDKKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIIN-IDPQAAELNHLKQQVQQLQILLLQAHGGTLPGDINVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRRHAACKVDLQKLVETLEDQELKENIEIICNLQQVIAQLSDEAAACMTATIDTAGEADTQVQSSPDTSR-SSDVFSTQHALRQAQMSKELIELNKALALKEALAKKMTQNDNQLQPIQFQYQDNIKNLESEVLSLQREKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLQEQSKLLKLKESTEHTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQQKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQKQKEVAEKRKETQSRGMESTAARMKNWLGNEIEVMVSTEEAKRHLNGLLEERKILAQDVAQLKEKRESGENPPLKLRRRTFSYDEIHGQDSGAEDSIAKQIESLETELELRSAQIADLQQKLLDAESEDRPKQR-WESIATILEAKCAIKYLVGELVSSKI 880          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21b (kinesin family member 21B [Source:MGI Symbol;Acc:MGI:109234])

HSP 1 Score: 326.635 bits (836), Expect = 1.197e-92
Identity = 177/394 (44.92%), Postives = 238/394 (60.41%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTK--EMRHIR-------EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY----------------INILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V VR RP    E  +GC  C    PG   +++G  K FT+D VF     QE+IY   V  +I   F GYN TVLAYGQTG+GKTYTMGT F  +    E G+IPRAI+ ++  +D  +  A           V   F+E+YNE+I DL  ST+  + RH R       + N  I    +    +N  E++ +CL +G+ +R   ST MN  SSRSHAIFTI+                +  LP   A   T +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHLFRGIDERKRRAQEKGVTGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDGAAPTGTEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSK-KVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QISALRAEIARLQMEL 400          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21b (kinesin family member 21B [Source:MGI Symbol;Acc:MGI:109234])

HSP 1 Score: 326.25 bits (835), Expect = 1.582e-92
Identity = 177/394 (44.92%), Postives = 238/394 (60.41%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTK--EMRHIR-------EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIY----------------INILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V VR RP    E  +GC  C    PG   +++G  K FT+D VF     QE+IY   V  +I   F GYN TVLAYGQTG+GKTYTMGT F  +    E G+IPRAI+ ++  +D  +  A           V   F+E+YNE+I DL  ST+  + RH R       + N  I    +    +N  E++ +CL +G+ +R   ST MN  SSRSHAIFTI+                +  LP   A   T +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQEQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDTVTSEEEQGIIPRAIAHLFRGIDERKRRAQEKGVTGPEFKVSAQFLELYNEEILDLFDSTRDPDARHRRSNIKIHEDANGGIYTTGVTSRLINSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRVCAQPDLVNETVTGLPDGAAPTGTEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDQSK-KVVHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QISALRAEIARLQMEL 400          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 318.161 bits (814), Expect = 8.135e-90
Identity = 176/402 (43.78%), Postives = 242/402 (60.20%), Query Frame = 1
Query:   52 LLLMAPLSSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEM------RHIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---NILPLSGANECTT------------FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +L  A  SS+RV VR RP    E  +GC  C    PG   + +G  K FTFD+VF   + QE+IY   +  +I   F GYN TV AYGQTG+GKTYTMGT F    +  E G+I RA+  ++  +D  + +A           V   F+E+YNE++ DL  +T+++       +IR   +    I    +   +VN   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++    + P + A   T             FE +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L +K K+   HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR+++T LQ +L
Sbjct:    1 MLGAADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRAT-HVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQ-DRASQQINALRSEITRLQMEL 400          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kif21a (kinesin family member 21A [Source:MGI Symbol;Acc:MGI:109188])

HSP 1 Score: 317.775 bits (813), Expect = 8.418e-90
Identity = 176/402 (43.78%), Postives = 242/402 (60.20%), Query Frame = 1
Query:   52 LLLMAPLSSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEM------RHIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---NILPLSGANECTT------------FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +L  A  SS+RV VR RP    E  +GC  C    PG   + +G  K FTFD+VF   + QE+IY   +  +I   F GYN TV AYGQTG+GKTYTMGT F    +  E G+I RA+  ++  +D  + +A           V   F+E+YNE++ DL  +T+++       +IR   +    I    +   +VN   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++    + P + A   T             FE +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L +K K+   HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR+++T LQ +L
Sbjct:    1 MLGAADESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYTQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIMEEEQGIISRAVRHLFKSIDEKKTSAIKNGLPPPEFKVNAQFLELYNEEVLDLFDTTRDIDAKNKKSNIRIHEDSTGGIYTVGVTTRTVNTEPEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQTDAENATDNKLISESSPMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISALGDKSKRAT-HVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANRARNIKNKVMVNQ-DRASQQINALRSEITRLQMEL 400          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q2VIQ3|KIF4B_HUMAN (Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 2.885e-118
Identity = 308/886 (34.76%), Postives = 469/886 (52.93%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHI--REENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLR------------AQVTALQAQLKGAVGNGMEALVLKPQ-VVSPSHFSEICELKAEIVAAQR-QKIELLEEFDEELSKKDDILRRIWEKISCS-DMEK-------------DEIYLELEKLVTDMNKSEHMETLENADIA--DQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQ---QYEE--KNREL----LQR-----IKELEEEKLRNN----SKHRQ---DDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQL----------EN-----------FSEVDSE------------EKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVN 2418
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++  + +  + G+IPR I  ++  +D  +      +KVS++E+YNE+I DLL  ++E   I  RE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I     S  N C+      SKLHLVDLAGSER  KT A GDR KEG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET +TL YA RAR+I+NKPI+N +D    E+  L+            A    L   +       +++L+ K Q +V  +     C  KA    AQ  ++I L E+ +E+L+ K + LR   + ++C  D++K              EI   L++L+T ++      T    D A  +++  E        +D                   L   L  KEA ++++   D  L     QY++  KN EL    LQ+     ++EL+  K   N    S+HR     +L+ ++ + K++LNE + L K KE +   V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K+++VLRRK E   A  KRLKD L  +++ + KR        + I  +V++W+   +E+     E  +  N L+E+R+ L++ +          EN            SEV  +            E  + +ME++     I+ LQQ  L +E +D   Q CW     I E + A+K++  +LV  +++
Sbjct:   10 VRVALRCRPLVPKEISEGCQMCLSFVPGETQVVVGTDKSFTYDFVFDPCTEQEEVFNKAVAPLIKGIFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGIIPRVIQLLFKEIDK-KSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKSDKN-CS----FRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISAL--GDDKKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLSTLRYADRARKIKNKPIVN-IDPHTAELNHLKQQVQQLQVLLLQAHGGTLPGSINAEPSENLQSLMEKNQSLVEENEKLSRCLSKAAGQTAQMLERIILTEQVNEKLNAKLEELR---QHVACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACTAAAIDTAVEEEAQVETSPETSRSSDAFTTQHALHQAQMSKEVVELNNALALKEALVRKMTQNDNQLQPIQFQYQDNIKNLELEVINLQKEKEELVRELQTAKKNVNQAKLSEHRHKLLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIWMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSSVLRRKTEEAAAANKRLKDALQKQREVTDKRKETQSHGKEGIAARVRNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVVQLKEKKESRENPPPKLRKCTFSLSEVHGQVLESEDCITKQIESLETEMELRSAQ--IADLQQKLLDAESEDRPKQ-CWENIATILEAKCALKYLIGELVSSKIH 880          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|O95239|KIF4A_HUMAN (Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3)

HSP 1 Score: 389.037 bits (998), Expect = 2.156e-115
Identity = 306/905 (33.81%), Postives = 474/905 (52.38%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHI--REENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICELKAEIV-----------------AAQRQKIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDMN----------------KSEHMET-LENADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQ---QYEEKNREL------LQRIKE---LE---------EEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSE--------------------------VDSEEKF-----QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++  + +  + GVIPR I  ++  +D  +      +KVS++E+YNE+I DLL  ++E   I  RE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI +     S  N  ++F    SKLHLVDLAGSER  KT A GDR KEG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N +D    E+  L+ QV  LQ  L  A G  +   +     V PS +   + E    +V                 A   ++I L E+ +E+++ K + LR          ++ E +   +++++ EI   L++L+T ++                +   +ET  E +  +D  T ++     + +  L  L + L  KEA  +++   D  L     QY++  +EL      LQ+ KE   LE         + KL    + R  +L+ ++ + K++LNE + L K KE +   V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K++ VLRRK E   A  KRLKD L  +++ + KR        +    +VK+W+   +E+     E  +  N L+E+R+ L++ +    E                           +SE+        L+ E++  +  I+ LQQ  L +E +D   Q  W     I E + A+K++  +LV  ++      S ++Q +     +QK
Sbjct:   10 VRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGVIPRVIQLLFKEIDK-KSDFEFTLKVSYLEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISLEQRKKSDKN--SSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISAL--GDDKKGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIVN-IDPQTAELNHLKQQVQQLQVLLLQAHGGTLPGSI----TVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRQHAACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACMAAAIDTAVEQEAQVETSPETSRSSDAFTTQHALRQAQMSKELVELNKALALKEALARKMTQNDSQLQPIQYQYQDNIKELELEVINLQKEKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLNEQSKLLKLKESTERTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQKQREVADKRKETQSRGMEGTAARVKNWLGNEIEVMVSTEEAKRHLNDLLEDRKILAQDVAQLKEKKESGENPPPKLRRRTFSLTEVRGQVSESEDSITKQIESLETEMEFRSAQIADLQQKLLDAESEDRPKQR-WENIATILEAKCALKYLIGELVSSKIQVSKLESSLKQSKTSCADMQK 900          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|P33174|KIF4_MOUSE (Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3)

HSP 1 Score: 386.726 bits (992), Expect = 1.763e-114
Identity = 298/882 (33.79%), Postives = 467/882 (52.95%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS-DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR---HIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEI------------YQLRAQVTALQAQLKGAVGNGMEALVLKPQ--VVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRR----------IWEKISCSDMEKD-EIYLELEKLVTDMNKSEH---METLENADIADQSTEENKTVNKEKADILNC---------------LREELRTKEAHLQQIEHTDYALLQ---QYEEKNREL------LQRIKE---LE---------EEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQL----------EN-----------FSEVDSEEKF----------QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERV 2415
            +RV +R RPL   E+++GCQ+C+ F PG   +++G  K FT+D VF     QEE++  +V  +I  +F GYN TVLAYGQTGSGKTY+MG  ++ + +  S  GVIPR I  ++  ++  +      +KVS++E+YNE+I DLL S++E     +IRE+ ++ IKI  L E++V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I     +  N  ++F    SKLHLVDLAGSER  KT A GDR +EG+NIN+GLL LGNVIS+L   D +K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPIIN +D    E+              L+A    L   +       +++L+ K Q  V      S      A   A   ++I L E+ +E+++ K + LRR          + E +   +++++ EI   L++++  ++         T++ A  AD   + +   ++  +D+ +                L + L  KEA  +++   D  L     QY++  + L      LQR KE   LE         + KL    + R  +L+ ++ + K++L E + L K KE + + V +L  +I  +K    ++ ++++++   FR+   +KDK+   L  +DR  + ++ K      K++ VLRRK E   A  KRLKD L  +K+ + KR        ++   ++K+W+   +E+     E  +  N L+EER+ L++ +          EN           + E+  ++             L+ E++  +  I+ LQQ  L +E +D   Q  W     I E + AIK++  +LV  ++
Sbjct:   10 VRVALRCRPLVSKEIKEGCQTCLSFVPGEPQVVVGNDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINK-KSDFEFTLKVSYLEIYNEEILDLLCSSREKATQINIREDPKEGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDKN--SSFR---SKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISAL--GDDKKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIIN-IDPQAAELNHLKQQVQQLQILLLQAHGGTLPGDINVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIILTEQANEKMNAKLEELRRHAACKVDLQKLVETLEDQELKENIEIICNLQQVIAQLSDEAAACMTATIDTAGEADTQVQSSPDTSR-SSDVFSTQHALRQAQMSKELIELNKALALKEALAKKMTQNDNQLQPIQFQYQDNIKNLESEVLSLQREKEELVLELQTAKKDANQAKLSERRRKRLQELEGQIADLKKKLQEQSKLLKLKESTEHTVSKLNQEIRMMKNQRVQLMRQMKEDAEKFRQWKQQKDKEVIQLKERDRKRQYELLKLERNFQKQSNVLRRKTEEAAAANKRLKDALQKQKEVAEKRKETQSRGMESTAARMKNWLGNEIEVMVSTEEAKRHLNGLLEERKILAQDVAQLKEKRESGENPPLKLRRRTFSYDEIHGQDSGAEDSIAKQIESLETELELRSAQIADLQQKLLDAESEDRPKQR-WESIATILEAKCAIKYLVGELVSSKI 880          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q91784|KIF4_XENLA (Chromosome-associated kinesin KIF4 OS=Xenopus laevis OX=8355 GN=kif4 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 6.060e-110
Identity = 305/907 (33.63%), Postives = 467/907 (51.49%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH---IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEAL-VLKPQVVSPSHF-------SEICELKAEIVAAQRQKIELLEEF------DEEL-SKKDDI---------LRRIWEKISCSDMEKD-EIYLELEKLVTDMN--KSEHMETLENAD--IADQSTEENKTVNKEKADIL---NCLREELRTKE-AHLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKE------KEHSHNEVKQLKMKIDELK-----------------KSICKVTKELQKEK--------------NNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSE-VDSEEKF----------------------------QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            +RV +R RPL   E  +GC+ C+ F PG   +I+G  K FT+D+VF   A QEE+Y  +V  +I  LF GYN TVLAYGQTGSGKTY+MG  ++  + +  + GVIPR +  ++  +   R      +KVS++E+YNE+I DLL + ++  +   IRE+ ++ IKI  L E  V  + D   CL +G+ +R V STAMN  SSRSHAIFTI I        N   +F    SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K K   VPYR+SKLTRLLQDSLGGN+ TLM+AC+SP+DSN EET  TL YA RAR+I+NKPI+N  D    E+ +L+ QV  LQ  L  A G  +  L  ++P     S          E  +L  E+  A  Q  + LE+       +E+L SK +++         L+R+ E +   +++ + E+   L++++  +    S    ++E  D   A     E  +  K  +D     + LR+   +KE   L +      AL ++  + +R+L    + ++ E L NN KH + ++ +  KE +  +  L+  KK+       E     +++L+ ++ ELK                 K++ K+ +E+Q  K                FR    +K K+   L  KDR  + ++ K      K+  VLRRK E   +  KRLK+ L  +K+   KR +  +   +    +VK+W+   +E+     E  +  N L+E+R+ L++ +    +  D+ E+                              L+ E++  +  I+ LQQ  L ++ ++  V+  W    NI E + A+K++  +LV  +V      S ++Q R  V  LQK
Sbjct:    9 VRVALRCRPLVPKENNEGCKMCLTFVPGEQQVIVGTEKSFTYDYVFDPSAEQEEVYNSAVAPLIKGLFKGYNATVLAYGQTGSGKTYSMGGAYTHNQENEPTVGVIPRTVIALFREIHQ-RPEWEFNLKVSYLEIYNEEILDLLYAARDKTNTISIREDPKEGIKICGLTERDVKTALDTLSCLEQGNSSRTVASTAMNSQSSRSHAIFTISIEQRKEGDKN--NSFR---SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDESK-KGGFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNMEETLNTLRYADRARKIKNKPIVN-TDPQAAELQRLKLQVQELQVLLLQAHGGTLPVLNSMEPSENLQSLMERNKNLEKENGKLSRELGEAAVQTAQFLEKIIMTEQQNEKLGSKMEELKQHAACKVNLQRLVETLEDQELKDNVEVIQNLQQVIVQLQDESSGIAGSIEAMDEEAASFPVPEEDSGEKRSSDGFTTNHALRQAQLSKELIELNKALVMKEALAKKMAQNDRQL----EPIQSEYL-NNIKHLESEVGVLQKEKEELILALHSAKKDNNQAKLSERRRKRLQELEGQMTELKKKLGEQSKLLKLRESTEKTVAKMNQEIQGMKMQRVQLMRQMKEDAEKFRTWKQQKTKEVIQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAASANKRLKEALQRQKEAMEKRKDSQSKGMEGAASRVKNWLANEVEVLVSTEEAQRHLNDLLEDRKILAQDIAQLKQKTDAGERIPTKIRRRTYTVAELENLEEEASVTKQIESLETEMELRSAQIADLQQKLLDADGEEEMVKRRWETISNIMEAKCALKYLITELVSSKVAGSKLESSVKQNRAHVADLQK 902          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q8GS71|KN4A_ARATH (Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 2.361e-102
Identity = 253/707 (35.79%), Postives = 378/707 (53.47%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVF-SDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLL-------SSTKEMRH--------------IRE-ENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINIL-------PLSGA-NECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKN-KHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEHMETLENADIADQSTEENKTVNKEKADI------------LNCLREELRTKEAHLQQIEHTDYALLQQY----------------EEKNRELLQRIKEL----EEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKV-ESCMA 2001
            S++V V  RPL  +E   GCQ CV    G   +  G+  FTFDHV+ S  +   E+Y+     +++ LF GYN TVLAYGQTGSGKTYTMGT   D   SS++G+IP+ ++ ++  ++ L++     + VSFIE++ E++ DLL       S T    H              IRE  N  I +    E SV+  +++  CL +GS +R  GST MN  SSRSHAIFTI +  +       P +GA N     E + +KLHLVDLAGSERA +T + G RFKEGV+INKGLL LGNVIS+L ++ K+K+  HVPYR+SKLTRLLQDSLGGN++T+M+ACISP+D N EET  TL YA RAR I+NKP++NR D    E+ ++R QV  LQA+L    G               S  +E+  LK  IV  +    EL  E  E  S+   +     EK    D+  D+I   +      + +S H     N  + + +T +++ +++E  +             L  L   L  KE+ ++  +  D A L+Q+                EE+NR LL  I+ L    + +KL++        L+ ++ + K++      L K+K+ S +  ++L+ +I  +K    ++   +++E   FR+  A ++K+   L  + R  + +  K  A + ++  VL+RK  E+ MA
Sbjct:   11 SVKVAVHIRPLIGDERIQGCQDCVTVVTGKPQVQIGSHSFTFDHVYGSSGSPSTEMYEECAAPLVDGLFQGYNATVLAYGQTGSGKTYTMGTGCGD---SSQTGIIPQVMNALFTKIETLKQQIEFQIHVSFIEIHKEEVQDLLDPCTVNKSDTNNTGHVGKVAHVPGKPPIQIRETSNGVITLAGSTEVSVSTLKEMAACLDQGSVSRATGSTNMNNQSSRSHAIFTITVEQMRKINTDSPENGAYNGSLKEEYLCAKLHLVDLAGSERAKRTGSDGLRFKEGVHINKGLLALGNVISALGDEKKRKDGAHVPYRDSKLTRLLQDSLGGNSRTVMIACISPADINAEETLNTLKYANRARNIRNKPVVNR-DPVSSEMLKMRQQVEYLQAELSLRTGG--------------SSCAEVQALKERIVWLETANEELCRELHEYRSRCPGVEHS--EK-DFKDIRADDIVGSVRP--DGLKRSLHSIESSNYPMVEATTGDSREIDEEAKEWEHKLLQNSMDKELYELNRRLEEKESEMKLFDGYDPAALKQHFGKKIAEVEDEKRSVQEERNR-LLAEIENLASDGQAQKLQDVHAQNLKALEAQILDLKKKQESQVQLLKQKQKSDDAARRLQDEIQSIKAQKVQLQHRMKQEAEQFRQWKASREKELLQLRKEGRKSEYERHKLQALNQRQKMVLQRKTEEAAMA 693          
BLAST of Kinesin protein vs. TrEMBL
Match: G4LW15 (Kif4a, putative OS=Schistosoma mansoni OX=6183 GN=Smp_173450 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 2.260e-127
Identity = 319/927 (34.41%), Postives = 496/927 (53.51%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGFPGG-NDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLS-STKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILP-LSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEAL-VLKP---QVVSPSHFSEI------CELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWE----------------KISCSDME--------------KDEIYLELEKLV--TDMNKSEHMETLENADIAD-----QSTEENKTVNKEKADI----LNCLREELRTKEAHLQQ-----------IEHTD---YALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDL-------DIRLK-------EAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNNKN-------ICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF-SEVDS--EEKFQLQMEIKRLN------EC----ISHLQQ----------VELTSEKDDM--QVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLEAELET 2511
            +S++VGVR RPL+ +E+ DG  +C+ +    N +IIG  K F FD+VF +  +QE +Y+ +   M+ N+  GYN T+ AYGQTGSGKTYTMGT  S+  +   +G++PR I D+++ +       TV  KVSF+E+Y EDI DLL         IREENQ +KIP L E  V   E++   L  GS  R V STAMN  SSRSHAI T+   + P ++  +  +T + +++KLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L E+D +K  H+PYR+S+LTRLLQDSLGGN+ TLMLAC+SP+D N EET  TL YA RAR I+NKPI+NR D    E+ +LR  V  LQA+L     NG     +L P    ++ P   + I       +  +E+V     K + LE   ++ ++  +++  I E                KI+  ++E               D    + E++V  T +N    ++   NA+        ++T + + V++  +++    L C ++ + T EA ++Q            E  D   Y LL++YE + REL  ++ +LE EK +  ++H  ++L       + RLK       + +RQL EL+ LKK KE    E  +L+ +I  LK S+ +  K+L++E   +RK   EK+ + K L   DR L+ +M +  + H ++  VL+R++E+  A  +RLK+ L  +KD   +R  RV+  N       +  +V+ W++  L++           +  ++ R+ L ++L    ++++S  ++     M I+ +N      +C    IS LQQ           + +   D     + +  +Q  NI E RIA+K++F Q     V+ +   ++I    EL   L    +K+E  L+T
Sbjct:    6 TSVKVGVRVRPLSSSEVNDGSSTCLSYLNEENQLIIGNDKLFGFDYVFKETDSQEYVYRKAALPMVENILKGYNATLFAYGQTGSGKTYTMGTCISESVVEESAGIVPRIIKDLFEKMPNYEYEYTV--KVSFLEIYKEDIHDLLGEDVSASLQIREENQLVKIPGLTETVVTSPEEVLYLLHCGSTKRSVASTAMNLKSSRSHAILTLCFLLRPKITELDGESTEDTLTAKLHLVDLAGSERIKKTHAEGDRLKEGIDINRGLLALGNVISALCERDAKKRSHIPYRDSRLTRLLQDSLGGNSATLMLACVSPADINMEETLNTLRYADRARLIKNKPILNRADPKDAELAKLRVLVAQLQARLT----NGSSCFPLLSPCPKTIIKPLSATTINNNSTNSQFSSEVVTNLMNKNKKLEFVRDKFNESPELISYIQELEDILTGLIKNFNESNKITNEELEHAYKQSSDFLAEFQSDSTCFDAEEVVEKTALNIHTEIDVNNNANCISNLSSIKTTAQPQLVDRWGSELRARRLEC-KQRIETIEATIRQKNVLLTSLEAAAEQGDESYYLLLKKYESQIRELESKVIDLEREKSKLLAEHSNEELKDSKMQREARLKTMEQELNQTRRQLTELSRLKKAKEAREAECLRLRNEIQSLKSSMIRSAKQLKEESTAYRKWRKEKETEVKKLQEHDRRLQCEMSRMVSVHERQQTVLKRRIEAAAAAERRLKELLLRQKDIRNERDKRVSEGNNVKNRFDLATRVRAWVKTDLDIQISMDAVRYHLSHFMDSRKTLCDRLRTIEAKMESCRQDGQPYDMYIEEVNSLTESIQCQTQQISDLQQKLMDAGERSSTDASGPPDSTGQMLSSRLSQLHNIQEARIALKYLFRQASSSEVSKINLETQIY---ELESQLNSEKQKVENLLQT 922          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A131Y4Q2 (Putative kinesin-like protein (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 6.476e-127
Identity = 305/885 (34.46%), Postives = 468/885 (52.88%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL----KGAVGN-GMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLE------EFDEELSK----KDDILRRIWEKISCSDMEK-------DEIYLELEKLVTDMNKSEHMETLEN-ADIADQSTEENKTVNKEKADI--LNC---------------------------LREELRTKEAHLQQI----EHTDYALLQQYEEKNRELLQRIKELEEEK---------------------LRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF---------SEVDSEEKF-QLQMEIKRLNECISHLQQVELTSEKD----DMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERE 2457
            +RV VR RPL   E  DGC SCV F P    I++G  K+FT+D+VF  +  Q+ IY+ +V  +I+ LF GYNVTVLAYGQTGSGKT+TMGT+ +   I+ ++G+IPRA+ DI+  +   R +  V VKVSF+E+Y EDI DLL  T++   IRE+N  IKIPNL E  V  +E+    L  GS +R  GST MN  SSRSHAI+T+ +  L   G N+ TT     SK HLVDLAGSERA+KT A G+RF+EGV IN+GLL LGNVIS+L +    ++ H+PYR+SKLTRLLQDSLGGN+ T+M+AC+SP+D NF+ET  TL YA RAR+I+N+P++NR D  Q EI +LR +V  LQ +L      ++G+    +   K  V SP      C L     +  +Q+  LLE      E ++ELS+      D L R  E++    ME        D++  ++E+L +    +E    + N  D   +  E  K+  +  A +  ++C                           L E L+ KE    ++    EH +  +  QY+   +EL + +  L++E+                     +    + R  +L+ R+ E ++++ E   + + KE +    K+LK +I E+K++  ++ ++L++E    R+   E+D++ + L  +++    Q  +Q  Q   +  VLRR++E  +A   RL+  L  ++  + K        ++  +VK  + Q L LA +  +  Q    L+E R+ L+ ++ +           +V   E+  +LQ E++  N  I  LQQ  L  E D    ++   AC        EC++    +F  L +  +       E+ +E E
Sbjct:   17 VRVAVRCRPLVCKEKMDGCGSCVQFVPDEQQIVLGADKRFTYDYVFPPEEAQQAIYEHAVAKLIDELFKGYNVTVLAYGQTGSGKTFTMGTSCASRGIAEDTGIIPRAVQDIFAAVGECRASKDVEVKVSFLEIYKEDILDLL-RTQDPLAIREDNGAIKIPNLTERRVASAEEALHQLEVGSASRSTGSTEMNARSSRSHAIYTLAVE-LKERGGNDVTT-----SKFHLVDLAGSERANKTKAVGERFREGVQINRGLLSLGNVISALCD----ESSHIPYRDSKLTRLLQDSLGGNSHTVMIACVSPADYNFDETLNTLRYADRARKIKNRPVVNR-DPNQAEILRLRQRVHELQVELLRYQAESIGDRSGGSTSAKHDVTSPPDQEATCSL----ASCSQQRRALLEHSADLTERNQELSRNLMSALDQLTRSSEQMLLDQMENQKLKQLVDQLTSKVEQLKSVAGAAERDSVISNIQDTVHEFMEGEKSRREANASLFKVDCDGGEGPLELSLGQLAPQRVDMNRQLAELGEMLQAKEDLAARMHANGEHLEV-VRSQYQATTKELEKEVALLKKERDDLSVLVVSGNNASKKSQHSGISEQRRKRIKELEDRVAELRKKVQEQAKMIRLKEEAERAAKKLKAEILEMKQTRVRLMRQLKEESERHRRAQGERDREVRALRLREQQRAVQAARQERQSGLKMTVLRRRMEEALAAKSRLEAALQKRQVAAGK---TGTPGDMAARVKATVEQELALAVDSRKLEQHVEALVEGRKDLAAEVHSLRQALQKQGSKDVALRERLEELQAELQERNSHIGELQQKILDVEADKRAKNLFAGACA------AECKLIGTHLFQMLSEREIGACQRADEVSREAE 875          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A158P2Q9 (Kinesin motor domain-containing protein OS=Atta cephalotes OX=12957 GN=105627395 PE=3 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 7.015e-124
Identity = 307/884 (34.73%), Postives = 476/884 (53.85%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCV-GFPGGNDIIIGGT-KQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS---TKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKG------AVGNGMEALVLKPQVVSP----------SHFSEICEL--KAEIVAAQRQKIE-----LLEEFDEEL----------SKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEH-----METLE------------NADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQQYEEKNR---ELLQRIKELEEE---------------KLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF---SEVDSEEKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLE 2496
            S++ V +R RPL  NEL  GCQ C+   PG   + I  T K FT+++VF     QE+ Y  +++ +I+N F GYNVT+LAYGQTGSGKT++MGTN++ I    E G+IPR I DI++ +   +E  +  V VSF+E+Y E ++DLLS    ++ +  IRE+ ++I+I  + E+ V  +++  +CL +GS  RV G+TAMN  SSRSHAIFT+ I        N  T      +K HLVDLAGSER+ KT ATG+RFKEGVNINKGLL LGNVIS L   D     ++ YR+SKLTRLLQDSLGGN+ TLM+AC+SP+D N +ET +TL YA RAR+I+NKPI+N+ DS   EI +L   +  L+  L              EAL  +  V+            S+F EI  +  +AEI    R+KI      LL+EF + L           +K + L+ I+EK+   D++ +E     E +  +++ S+H      E +E            N D  D+  EE+     E+ + +  + +EL  KE+ + ++      + Q+  E  R   E+ Q IK L  E               KL    + +  +L+ ++ E  R+  E N + K KE     +K L  +I  LK++  K+ ++++ + NNF K    K+K+   +  +DR    +M +   +H K+  V +RK+E   A  KRLK  L+ +K    ++  + N+K    ++K W+ Q +E+     E       L+++R  L  QLE     +++D +E   +   I+  N  I+ LQQ  L S++ + +    WN  R I + ++A++  FH + Q+R       +E++++ + ++   +  EK E
Sbjct:    4 STVSVALRIRPLVDNELEKGCQMCLDAIPGEPQVRICNTDKAFTYNYVFPPHIGQEDFYNTAIKRLIDNTFQGYNVTILAYGQTGSGKTHSMGTNYTGI---GERGIIPRVIYDIFEIIKS-KEDWSFKVAVSFMELYQEQLYDLLSDKQRSQSVVDIREDGKNIRIVGVTEKQVQDAQETLECLAQGSLGRVTGATAMNAHSSRSHAIFTLCICQQKKDDPNTATV-----AKFHLVDLAGSERSKKTQATGERFKEGVNINKGLLALGNVISQL--GDGASGTYIGYRDSKLTRLLQDSLGGNSMTLMVACVSPADYNLDETLSTLRYADRARKIKNKPIVNQ-DSKIAEINRLNKLIQELRLALANQELGITTCPKEHEALEERYSVLQQKFRDMTEKLNSNFGEIVVMHERAEIAEQAREKIRFAISLLLDEFKQVLQDFDSCPEIDDEKRNKLKAIYEKM--LDIQNNEKKASEELINHEISNSKHCVIHMKEDIECIRTEELNDIEDNLDYFDKKEEEHTLRQAERNNEVQTINKELALKESLVSELLKN---VTQETAESRRNVVEMEQEIKRLHAEKEEHLQAVHTHNVSSKLAETRRKKVQELEKKIAELTRRCMEQNKIIKAKEKQDQRIKTLSSEIQSLKETRVKLIRQMRNDANNFTKWKQSKEKEIIKIRKQDRKRAYEMVRMKIEHNKQENVFKRKMEEAFAVNKRLKGALEIQKKAMQRQEKKANSKE---EIKTWMAQEMEVLMATVEADYSLEKLMQDRASLVHQLEQLKKNNDLDEKELATVTEFIELRNIQIADLQQKILESDQ-ETRTNTRWNMIRTIMDAKVALETAFHVVTQDRKQQCYKYNELKEKYQYLEARLEEYEKQE 866          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A151I0F6 (Chromosome-associated kinesin KIF4A OS=Atta colombica OX=520822 GN=ALC53_10248 PE=3 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 8.361e-124
Identity = 303/856 (35.40%), Postives = 463/856 (54.09%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCV-GFPGGNDIIIGGT-KQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS---TKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKG------AVGNGMEALVLKPQVVSP----------SHFSEICEL--KAEIVAAQRQKIE-----LLEEFDEEL----------SKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEH-----METLE------------NADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQQYEEKNR---ELLQRIKELEEE---------------KLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF---SEVDSEEKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQER 2412
            S++ V +R RPL  NEL  GCQ C+   PG   + I  T K FT+++VF     QE+ Y  +++ +I+N F GYNVT+LAYGQTGSGKT++MGTN++ I    E G+IPR I DI++ +   +E  +  V VSF+E+Y E ++DLLS    ++ +  IRE+ ++I+I  + E+ V  +++  +CL +GS  RV G+TAMN  SSRSHAIFT+ I        N  T      +K HLVDLAGSER+ KT ATG+RFKEGVNINKGLL LGNVIS L   D     ++ YR+SKLTRLLQDSLGGN+ TLM+AC+SP+D N +ET +TL YA RAR+I+NKPI+N+ DS   EI +L   +  L+  L              EAL  +  ++            S+F EI  +  +AEI    R+KI      LL+EF + L           +K + L+ I+EK+   D++ +E     E +  +++ S+H      E +E            N D  D+  EE+     E+ + +  + +EL  KE+ + ++      + Q+  E  R   E+ Q IK L  E               KL    + R  +L+ ++ E  R+  E N + K KE     +K L  +I  LK++  K+ ++++ + NNF K    K+K+   +  +DR    +M +   +H K+  V +RK+E   A  KRLK  L+ +K    ++  + N+K    ++K W+ Q +E+     E       L+++R  L  QLE     +++D +E   +   I+  N  I+ LQQ  L S++ + +    WN  R I + ++A++  FH + Q+R
Sbjct:    4 STVSVALRIRPLVDNELEKGCQMCLDAIPGEPQVRICNTDKAFTYNYVFPPHIGQEDFYNTAIKRLIDNTFQGYNVTILAYGQTGSGKTHSMGTNYTGI---GERGIIPRVIYDIFEIIKS-KEDWSFKVAVSFMELYQEQLYDLLSDKQRSQSVVDIREDGKNIRIVGVTEKQVQDAQETLECLAQGSLGRVTGATAMNAHSSRSHAIFTLCICQQKKDDPNTATV-----AKFHLVDLAGSERSKKTQATGERFKEGVNINKGLLALGNVISQL--GDGASGTYIGYRDSKLTRLLQDSLGGNSMTLMVACVSPADYNLDETLSTLRYADRARKIKNKPIVNQ-DSKIAEINRLNKLIQELRLALANQELGITTCPKEHEALEERYSILQQKFRDMTEKLNSNFGEIVVMHERAEIAEQAREKIRFAISLLLDEFKQVLQDFDSCPEIDDEKRNKLKAIYEKM--LDIQNNEKKASEELINHEISNSKHCVIHMKEDIECIRTEELNDIEDNLDYFDKKEEEHTLRQAERNNEVQTINKELALKESLVSELLKN---VTQETAESRRNVVEMEQEIKRLHAEKEEHLQAVHTHNVSSKLAETRRKRVQELEKKIAELTRRCMEQNKIIKAKEKQDQRIKTLSSEIQSLKETRVKLIRQMRNDANNFTKWKQSKEKEIIKIRKQDRKRAYEMVRMKIEHNKQENVFKRKMEEAFAVNKRLKGALEIQKKAMQRQEKKANSKE---EIKTWMAQEMEVLMATVEADYSLEKLMQDRASLVHQLEQLKKNNDLDEKELATVTEFIELRNIQIADLQQKILESDQ-ETRTNTRWNMIRTIMDAKVALETAFHVVTQDR 838          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A3P8SL06 (Kinesin family member 4 OS=Amphiprion percula OX=161767 PE=3 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 1.078e-123
Identity = 347/1096 (31.66%), Postives = 549/1096 (50.09%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR--HIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICE-----------LKAEIVAAQRQ------KIELLEEFDEELSKKDDILR----------RIWEKISCSDMEKD-EIYLELEKLVTDM-NKSEHMETLENADIADQSTEENKTVNKEKADILNCLREE------------LRTKEAHLQQIEHTDYAL--LQQYEEKNRELLQRI-------------------KELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF---------------------SEVDSEEKFQ---------LQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLV--------------QERVN------------NVMALSEIQQERELVDTLQKANEKLEAELETIRTDNE------ITLNQKLK---KRRTSS--------------------------SWEPEKERQSKRLKHCSDTEXXXXXXXXXXXXXXXLGCRCKTGCKPSRCGCLKSSASCNDKCSCKGE-CSRL-SILPQIEE-DCVEKSHCDIYDDTDVM--NQTF 2871
            +RV +R RPL   E+ +GCQ C+ F PG   +I+G  K FT+D+VF   A QEE++  +V  +++ LF GY+ TVLAYGQTGSGKT++MG  ++  + +  S GVIPR I  I++  D  R     C+ VS++E+YNEDI DLL S+K+     IRE+ +D IKI  L E  V  + ++  CL  G+  R VGSTAMN  SSRSHAIFTI +      G ++  +   V SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K KN  VPYR+SKLTRLLQDSLGGN+ TLM+ACISP+DSN EET  TL YA RAR+I+NKP++N +D    E+ +L+ QV  LQ  L  A G G+  ++  P+  S  + +++ E           L  E+  A  Q      KI + E+ +E+L  K + LR          ++ E +   +++++ E+   L+ ++ ++ N+S  +    +A  A +  +  +  + E     + LR+             L  KEA ++++   D  L  +Q   +KN + LQ                     K+  + KL    + R  +L+ +L + K++L E + L K KE S  +V +L  +I  +K    ++ ++++++   FR    +KD++   L  KDR  + ++ K      K+  VLRRK E   A  KRLKD L  + + + KR +  N   +    +VK W+   +E+     E  +  N L+E+R+ L++++ +                      SE++S+   +         L+ E+   N  I+ LQQ  L ++ +  +++   +   +I + + A++ +  +LV              QE+ N            NVM+  +++ +++LV+  Q+  EK+   L T+  D+E      +    KLK   KR T++                           W+PEK  + +R    S T                 GC CK  C   +C C K   +C + C C  E C  + +++P +   + V +    + D + +   N TF
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLTFVPGEPQVIVGTEKAFTYDYVFDPTAEQEEVFGTAVSPLLSGLFKGYHATVLAYGQTGSGKTFSMGGTYTSAQENDPSVGVIPRVIGRIFEERDK-RTDCEFCLAVSYLEIYNEDILDLLCSSKDKPTISIREDPKDGIKIVGLTERKVFSAHEMVGCLELGNSARTVGSTAMNAASSRSHAIFTITLE--QRRGTDKSDS---VVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESK-KNTFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNMEETINTLRYADRARKIKNKPVVN-IDPRAAEMKRLKQQVQELQVMLLHARG-GVAPVLSGPE--SAENVTKLLERNRALQDENNKLSRELSEAAGQTALMFEKIIMTEQANEKLQSKLEQLRHHAACTVDLEKVVETLEDQELKENIEVMKNLQDIILELKNESAGIAASIDAMAAGEDDDATRKDSPEAYTAHHALRQAQLSKELIELNKVLSLKEAFVRKMCQNDSQLEPMQSEHQKNVQTLQSAVDSLQKEKEDLVLALQSAKKDTNQAKLSEQRRKRLQELEGQLIDMKKKLLEQSKLLKLKETSVQKVSKLMQEIQAMKSQRTQLMRQMREDSEKFRHWKNKKDREVLQLKEKDRKRQYELLKLERDFQKQANVLRRKTEEAAAANKRLKDALQKRSEAAEKRKDAQNRGIEGAAARVKTWLLNEVEVMVSTEEARRHLNDLLEDRKVLAQEISHLKQQIEAGERPAAKIRRRTLIISELESQGALETPLTKQVENLETEMGLRNAQIADLQQKVLVADGEG-RLKQRIDSITSIVDAKCALRLLMSELVSAKTAGAKLESEVKQEKGNGQDLRKMLADERNVMSTMDMEHQQQLVELEQRHQEKV-LHLATL-IDSEFVDCPLLAFFFKLKPRGKRFTTAKAPLNQTINVEELMSPSEDEKEEEEDEWQPEKPEKGRRTSKKSKT----------------TGCACKGRCGNKQCRCRKGKMTCGENCQCDHEKCRNMDNLVPDLSHTESVSRDSVSLQDPSSISPDNSTF 1076          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 368.237 bits (944), Expect = 2.108e-109
Identity = 308/951 (32.39%), Postives = 472/951 (49.63%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKE--MRHIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPS-HFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKL----------------VTDMNKSEHMETLEN----------------ADIADQSTEENKTVNKEKADILNCLREE------------LRTKEAHLQQIEHTDYAL--LQ-QYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKK-----------------SICKVTKELQKEK--------------NNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF-SEVDSEEKF---------------------------QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLEAELETIRTDNEITLNQKL-KKRRTSSSWEPE 2586
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D+VF     QEE++  +V  +++ LF GYN TVLAYGQTGSGKT++MG  ++  + +  + GVIPR +  I+      R  +   + VS++E+YNE+I DLL ++K+  +  IRE+ ++ IKI  L E++V  ++++  CL  G+  R VGSTAMN  SSRSHAIFTI +     S    C       SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K K   VPYR+SKLTRLLQDSLGGN+ TLM+ACISP+DSN EET  TL YA RAR+I+NKP++N +D    E+ +L+ QV  LQ  L  A G            V+P    +E  E  ++I+   R   E   +   EL +       ++E+I  ++   +++  +LE+L                + D    E++E + N                A I   S +     + E     + LR+             L  KEA ++++   D  L  +Q +++E  + L   +  L++EK         ++L + L  AK+  N+  +     E     +++L+ +I +LKK                 S+ K+ +E+Q  K                FR    +KDK+   L  KDR  + +M K      K+  VLRRK E   A  KRLKD L  + + + KR  V       +  +VK W+   +E+     E  +    L+E+R+ L+E++     ++DS E+                             L+ E+   +  I+ LQQ  L ++ ++ +++  W+    I E + A+K +                      E++ T + AN KLE+EL+  +  N I L + L  +RR  S+ E E
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLTFVPGEPQVVVGSDKAFTYDYVFDPTTEQEEVFNMAVSPLLSGLFKGYNATVLAYGQTGSGKTFSMGGTYTSAQENEPTVGVIPRVVRKIFQEKSK-RMDSEFLLNVSYLEIYNEEILDLLCTSKDKPVLSIREDPKEGIKIVGLTEKAVLTAQEMVGCLEVGNSARTVGSTAMNAASSRSHAIFTISLEQRRGS-EKHCDIL----SKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNIEETINTLRYADRARKIKNKPVLN-IDPQAAEMKRLKQQVQELQVMLLHARGG-----------VAPVLSGAEPAENVSKILEKNRSLQEENTKLSRELGEAVGQTAMMFERIIMTEQANEKLQGKLEELRAHAACKVDLQKVVETLEDQELKENVEVIRNLQHIILELQNEGAGIAATIDGGSGDAQMKESPEAYTTQHALRQAQLSKELIELNKVLALKEAFVKKMCQNDSQLEPIQTEHQENIKSLQSAVGSLQKEK---------EELILALHSAKKDTNQAKL----SEQRRKRLQELEGQITDLKKKLQDQSKLLKLKESSVRSVAKLNQEIQAMKAQRVQLMRQMKEDSEKFRLWKQKKDKEVMQLKEKDRKRQYEMLKLERDFQKQANVLRRKTEEAAAANKRLKDALQKRSEVAEKRKDVQSRGMDGVASRVKAWLLNEVEVLVSTEEARRHLQDLLEDRKILAEEISQLRQQMDSGERPVAKRRTLTISELEGKGDLEASISKQVENLETEMGLRSAQIADLQQKVLDAD-NEGRMKQRWDSITTIVEAKSALKILMS--------------------EVISTSKTANAKLESELKQEQA-NHIDLQKVLFDERRLMSTMEME 907          

HSP 2 Score: 57.7658 bits (138), Expect = 6.837e-8
Identity = 107/454 (23.57%), Postives = 185/454 (40.75%), Query Frame = 1
Query: 1633 KELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKR--VNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF-SEVDSEEKF---------------------------QLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLV---------------QERVNNV------------MALSEIQQERELVDTLQKANEKLEAELETIRTDNEITLNQKLKKRRTSSSWEPEKER----QSKRLKHCSDTEXXXXXXXXXXXXXXXLGCRCKTGCKPS----------RCGCLKSSASCNDKCSCKGECSR 2781
            K+  + KL    + R  +L+ ++ + K++L + + L K KE S   V +L  +I  +K    ++ ++++++   FR    +KDK+   L  KDR  + +M K      K+  VLRRK E   A  KRLKD L  + + + KR  V       +  +VK W+   +E+     E  +    L+E+R+ L+E++     ++DS E+                             L+ E+   +  I+ LQQ  L ++ +    Q  W+    I E + A+K +  +++               QE+ N++            M+  E++ +  LV+  Q+  EK      + R   + TL   L     SS  E EK R    Q+++LK   + E       S  +    L      GC  S           C C K   +C + C C  E  R
Sbjct:  581 KDTNQAKLSEQRRKRLQELEGQITDLKKKLQDQSKLLKLKESSVRSVAKLNQEIQAMKAQRVQLMRQMKEDSEKFRLWKQKKDKEVMQLKEKDRKRQYEMLKLERDFQKQANVLRRKTEEAAAANKRLKDALQKRSEVAEKRKDVQSRGMDGVASRVKAWLLNEVEVLVSTEEARRHLQDLLEDRKILAEEISQLRQQMDSGERPVAKRRTLTISELEGKGDLEASISKQVENLETEMGLRSAQIADLQQKVLDADNEGRMKQR-WDSITTIVEAKSALKILMSEVISTSKTANAKLESELKQEQANHIDLQKVLFDERRLMSTMEMEHQSHLVELEQRHQEKASIIFSSFRL--KCTLVVLLCSFSYSSEEELEKMRELTEQNQKLK--DENEQYKQVRESACTNAYYLLQSNMPGCTTSPPGLRRCINKMCRCRKGRMTCGENCLCDHEKCR 1029          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif4 (kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1545])

HSP 1 Score: 355.525 bits (911), Expect = 2.898e-104
Identity = 184/371 (49.60%), Postives = 250/371 (67.39%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKE--MRHIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGN 1176
            +RV +R RPL   E+ +GCQ C+ F PG   +++G  K FT+D+VF     QEE++  +V  +++ LF GYN TVLAYGQTGSGKT++MG  ++  + +  + GVIPR +  I+      R  +   + VS++E+YNE+I DLL ++K+  +  IRE+ ++ IKI  L E++V  ++++  CL  G+  R VGSTAMN  SSRSHAIFTI +           +  + V SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K K   VPYR+SKLTRLLQDSLGGN+ TLM+ACISP+DSN EET  TL YA RAR+I+NKP++N +D    E+ +L+ QV  LQ  L  A G 
Sbjct:   11 VRVALRCRPLVPKEINEGCQCCLTFVPGEPQVVVGSDKAFTYDYVFDPTTEQEEVFNMAVSPLLSGLFKGYNATVLAYGQTGSGKTFSMGGTYTSAQENEPTVGVIPRVVRKIFQEKSK-RMDSEFLLNVSYLEIYNEEILDLLCTSKDKPVLSIREDPKEGIKIVGLTEKAVLTAQEMVGCLEVGNSARTVGSTAMNAASSRSHAIFTISLE------QRRGSENDAVVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLSLGNVISALGDESK-KGSFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNIEETINTLRYADRARKIKNKPVLN-IDPQAAEMKRLKQQVQELQVMLLHARGG 372          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 315.079 bits (806), Expect = 5.512e-89
Identity = 181/410 (44.15%), Postives = 246/410 (60.00%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKIS-SESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKI----------PNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTT-----------FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL------KGAVG-NGMEAL 1191
            S  + VR RP    E  +GC  C    PG   +I+G  K FTFD+VF   + Q+ IY      +I   F GYN T+ AYGQTGSGKTYTMGT F D+ I   E G+IPRA+S ++  ++  R+ AT          +   F+E+YNE++ DL  ST+++  +R++   IKI            +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI+     L     CTT           FE +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K +  HVPYR+SKLTRLLQDSLGGN++T+M+AC SPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L      K  +G +GME++
Sbjct:    4 SFSLSVRIRPQLAREKIEGCHICTFVTPGEPQVILGKDKAFTFDYVFDMDSQQDTIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGF-DVSIPDDELGIIPRAVSHLFKGIEQRRQAATDQGRPVPEFKISAQFLELYNEEVLDLFDSTRDL-EVRKQKSHIKIHEDATGGIYTVGVTTRTVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIH-----LCQVRVCTTSDNVRSVCLTEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSK-RTTHVPYRDSKLTRLLQDSLGGNSQTVMIACTSPSDRDFMETLNTLKYANRARNIKNKVVVNQ-DKASQQISALRTEIARLQMELMEYRTGKRMIGEDGMESI 404          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21a (kinesin family member 21A [Source:ZFIN;Acc:ZDB-GENE-110411-237])

HSP 1 Score: 314.694 bits (805), Expect = 6.252e-89
Identity = 180/415 (43.37%), Postives = 250/415 (60.24%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKIS-SESGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIP----------NLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI----------------NILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL------KGAVG-NGMEAL 1191
            S  + VR RP    E  +GC  C    PG   +I+G  K FTFD+VF   + Q+ IY      +I   F GYN T+ AYGQTGSGKTYTMGT F D+ I   E G+IPRA+S ++  ++  R+ AT          +   F+E+YNE++ DL  ST+++  +R++   IKI            +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++                N L  +G+++   FE +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K +  HVPYR+SKLTRLLQDSLGGN++T+M+AC SPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L      K  +G +GME++
Sbjct:    4 SFSLSVRIRPQLAREKIEGCHICTFVTPGEPQVILGKDKAFTFDYVFDMDSQQDTIYSNCTEKLIEGCFEGYNATIFAYGQTGSGKTYTMGTGF-DVSIPDDELGIIPRAVSHLFKGIEQRRQAATDQGRPVPEFKISAQFLELYNEEVLDLFDSTRDL-EVRKQKSHIKIHEDATGGIYTVGVTTRTVSSEAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCTTSDNENETDNRLA-NGSSDMEEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSK-RTTHVPYRDSKLTRLLQDSLGGNSQTVMIACTSPSDRDFMETLNTLKYANRARNIKNKVVVNQ-DKASQQISALRTEIARLQMELMEYRTGKRMIGEDGMESI 413          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kif21b (kinesin family member 21B [Source:NCBI gene;Acc:103045846])

HSP 1 Score: 306.22 bits (783), Expect = 6.253e-86
Identity = 174/397 (43.83%), Postives = 241/397 (60.71%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSE-SGVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKI----------PNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI---NILP--LSGA-----NECTT-------FEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            ++V +R RP    E  +GC  C    PG   +++G  K FT+D VF   A Q++IY   V  +I   F GYN TV AYGQTGSGKTYTMGT F D+ +  E  G+IPRA+  ++  +   R+ A           V   F+E+YNE+I DL  +T++    R    +IKI            +    V+  E++ +CL  G+ +R   ST MN  SSRSHAIFTI++    + P   +G+     NE T        +E +++K H VDLAGSER  +T ATG+R +EG++IN GLL LGNVIS+L ++ K K  HVPYR+SKLTRLLQDSLGGN++T+M+AC+SPSD +F ET  TL YA RAR I+NK ++N+  ++Q +I  LRA++  LQ +L
Sbjct:    9 VKVSLRIRPQMAKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDIDAHQQQIYGSCVHKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVNVGEEEQGIIPRAVHQLFQGIQRRRQDAQERSTNPPEFKVSAQFLELYNEEILDLFDNTRDP-EARGRKSNIKIHEDGNGGIYTSGVTSRLVSSEEELLQCLKLGALSRTTASTQMNAQSSRSHAIFTIHLCQMRVCPQLANGSASDDVNEVTDGPISQPEYETLTAKFHFVDLAGSERLKRTGATGERAREGISINCGLLALGNVISALGDQSK-KAGHVPYRDSKLTRLLQDSLGGNSRTVMIACVSPSDRDFMETLNTLKYANRARNIKNKVVVNQDKTSQ-QINALRAEIARLQMEL 401          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: KIF27 (kinesin family member 27 [Source:HGNC Symbol;Acc:HGNC:18632])

HSP 1 Score: 331.643 bits (849), Expect = 1.075e-95
Identity = 178/366 (48.63%), Postives = 237/366 (64.75%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLL---SSTKEMRHIREENQDIKIPNLLEESVNCSED-IFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYIN-ILPL----SGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIIN------RVDSAQGEIYQLR 1128
            +RV VR RPL  NE+    Q+CV   PG   I++G  + FTFDHVF  +  QEE+YK  ++ ++ +   GYNVTV AYGQTGSGKT+T+G       I  E G+IPRAI+D++  +     T    V VS+IEVY E++ DLL   + +K+M HIRE+++   +    +ESV  +ED +   L  G+  R  G+T MNE SSRSH IFT+ +    P     SG N     E +SSK H VDLAGSER SKT  TG+RFKE + IN GLL LGNVIS+L +  K+K+ H+PYR++K+TR+L+DSLGGN KTLM+ACISPS  NF+ET  +L YA RA+ I+NKP++N      R+D  + EI  LR
Sbjct:    6 VRVAVRIRPLLRNEILYSQQTCVRVVPGNQQILLGKDRAFTFDHVFGSKVAQEEVYKTCIQPLVKSFVDGYNVTVFAYGQTGSGKTFTIGGANIASSIEDERGIIPRAIADLFFAMKESHNT-DFSVGVSYIEVYKEELRDLLDIETLSKDM-HIREDDKGNTVIIGTKESVVETEDEVLSLLEAGNAARHTGTTQMNEHSSRSHTIFTLTVTQRRPYGSSNSGDNLNNESESLSSKFHFVDLAGSERVSKTGNTGERFKESIQINSGLLALGNVISALGDP-KRKSSHIPYRDAKITRILKDSLGGNAKTLMIACISPSSGNFDETINSLKYANRAKNIRNKPVVNYNPDWDRIDEMEQEIKTLR 368          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 249.98 bits (637), Expect = 4.959e-72
Identity = 151/376 (40.16%), Postives = 216/376 (57.45%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNE------------LRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR-HIREE-NQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLK 1161
            ++RV VR RP+   E            +R G Q  +  P  N       + FTFD V+   A Q +IY+ S R +++++  G+N T+ AYGQTG+GKTYTM    SD       GVIP +   I+ ++   +      V+ S++E+Y E+I DLLS  +  R  +RE  +  I + +L       + +I   +  G++NR VG+T MNE SSRSHAIF I +    L    E         KL+LVDLAGSER +KT A G+R KE   IN  L  LGNVIS+LV+    K+ HVPYR+SKLTRLLQDSLGGN +T+M+A + P+  N++E+ TTL YA RA+ I+N+P +N  D     + + + ++  L+ QL+
Sbjct:   19 TVRVVVRCRPMNPRESAASYESVITIDVRAG-QVAIRNPRAN---ADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSD---PERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIR---VGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDG---KSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNIRNRPRVNE-DPKDALLREFQEEIARLKEQLE 380          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001102.1 (pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1 gene:ENSPMAG00000000949.1 transcript:ENSPMAT00000001102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.144 bits (653), Expect = 1.902e-71
Identity = 142/342 (41.52%), Postives = 197/342 (57.60%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIK-IPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAA---RARQIQNKPIIN 1089
            SI+V  R RPL+  E   G +    F G +++++GG K + FD VF    TQE++Y C  R ++ ++  GYN T+ AYGQT SGKT+TM     D   S   G+IPR I DI++Y+  + E     +KVS+ E+Y + I DLL  +K    + E+   +  +    E  V+  +++   +  G  NR V  T MNE SSRSH+IF I +            T + +S KL+LVDLAGSE+ SKT A G    E  NINK L  LGNVIS+L E  K    HVPYR+SK+TR+LQDSLGGN +T ++ C SPS  N  E+ +TL +     RA+ I+N   +N
Sbjct:    8 SIKVMCRFRPLSDAEQGRGDKFLPKFSGEDNVVMGG-KPYIFDRVFPTNTTQEQVYNCCARQIVKDVLEGYNGTIFAYGQTASGKTHTMEGKLHD---SEYMGIIPRIIQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDISKTNLAVHEDKNKVPYVKGCTERFVSSPDEVMDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINVK------QENVETEQKLSGKLYLVDLAGSEKVSKTGAEGSVLDEAKNINKSLSALGNVISALAEGTKS---HVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNEAESKSTLMFGQRIDRAKTIKNTVTVN 336          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 249.98 bits (637), Expect = 4.789e-71
Identity = 180/511 (35.23%), Postives = 258/511 (50.49%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDG-----------CQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSE-SGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKI--PNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECT------TFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL----------------------KGAVGN----------------GMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWE-KISCSDMEKDEIYLELEKLVTDMNKSEH 1431
            +++V VR RP+   E   G            Q  V  P  ND      K FTFD VF  ++ Q ++Y  + R +++++  GYN T+ AYGQTG+GKT+TM      I+   E  G+IP + + I+ ++          V+VS++E+YNE++ DLL   +  R   +E  D+ +   +L    VN ++D+ + +  G +NR VGST MNE SSRSHAIFTI I         EC+             KLHLVDLAGSER +KT ATG R KE   IN  L  LGNVIS+LV+    K+ HVPYR SKLTRLLQDSLGGN+KT+M A I P+D N++ET +TL YA RA+ I+NK  IN  D     + Q + ++  L+ +L                      +G  GN                     V +  +  P       ++  E +A  + KIE      EE        R++ E ++   + E+D+   ELE+   D+ K++ 
Sbjct:   15 NVKVVVRCRPINGKETGAGHRMAVLVDEMRGQIAVQRPDCNDEP---PKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTM----EGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITI---------ECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDG---KSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINE-DPKDALLRQFQKEIEDLKKKLAEGEEVSGSEFSGSDDDEKEGTEGGDGNEKRRKRRGSTSSSSSDSSTCSVKEKPMDKPYSCGRKKKIPVEKLAEMQAKIE------EE--------RKVLEAQLDMEEEERDKARAELERRENDLLKAQQ 491          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010617.1 (pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 gene:ENSPMAG00000009612.1 transcript:ENSPMAT00000010617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 253.832 bits (647), Expect = 8.344e-71
Identity = 154/362 (42.54%), Postives = 223/362 (61.60%), Query Frame = 1
Query:  283 GYNVTVLAYGQTGSGKTYTM-GTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS-TKEMRHIREENQ-DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPV-----SSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAA---------QRQKIELLEEFDEELSK 1317
            GYN TV AYGQTG GK++TM G +    + S++ GVIPRA   I++ +    E      + S++E+YNE+I DLL   TK+   ++E  +  + + +L   +V+   +  + +  G  NR  G+T MN+ SSRSH+IF+I++ +        CTT +       + KL+LVDLAGSER SKT A GDR KE   IN  L  LGNVIS+LV+    ++KHVPYR+SKLTRLLQDSLGGNTKTLM+ACISP+D+N+EE+ +TL YA RA+ I+N+P +N  D     + + R ++T L+A L+G +     A   +P     +  +E+   K E++AA         +RQKI   +E++E LS+
Sbjct:    6 GYNGTVFAYGQTGCGKSFTMQGVS----EPSAQRGVIPRAFEHIFESIQ-CAENTKFLFRASYLEIYNEEIRDLLGKDTKQRLELKEHPERGVYVRDLSMHTVHSVAECERIMQAGWSNRATGATLMNKDSSRSHSIFSIHLEM--------CTTDDQGEDHIRAGKLNLVDLAGSERQSKTGAQGDRLKEATKINLSLSALGNVISALVDG---RSKHVPYRDSKLTRLLQDSLGGNTKTLMVACISPADNNYEESLSTLRYANRAKSIRNRPRVNE-DPKDAMLREYREEITRLKALLQGQI-----AAPGRPXFTRKAVPAEVPRAKEEVIAAVDHQAEIEKERQKIR--QEYEERLSR 343          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 229.565 bits (584), Expect = 1.751e-63
Identity = 128/313 (40.89%), Postives = 192/313 (61.34%), Query Frame = 1
Query:  178 GGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTM-GTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRH--IREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI----NILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINR 1092
            GG  +F FD +F + ++Q  +YK +   +++++  G+N TV AYG TG GKTYT+ GT        S+ G+I  A+ ++++ +  L++     + +S++E+YNE I DLL      +   IRE+ Q+ IK+ NL     N  ED+   +++G+ NR    T  NE SSRSHA+  I+I     ++ L+  +   T       L ++DLAGSERA+ T   G R  EG NIN+ LL LGN I++L   D  ++ H+PYR+SKLTRLL+ SLGGN KT+M+ CISPS S+++ET  TL YA RA++I+ K I N+
Sbjct:  148 GGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT-------PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFAT-------LSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRNQ 446          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 223.016 bits (567), Expect = 2.947e-60
Identity = 141/375 (37.60%), Postives = 207/375 (55.20%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQ---SCVGFPGGNDIIIG---------GTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFS---------DIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDI--------FDLLSSTKEMRHIR-----EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVS-SKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINR 1092
            S+I V VR R     E+ +      S +G P G +II+            K + FD VF  ++ QE ++  + ++ I  +  GYN T+ AYGQTG+GKTYTM  + +         ++ +   +G+IPR + D++  L  L +  +V  K+SF+E+YNE++         D  +     R IR       N  I +  + E  +N + +    LM+GS  R V +T  N+ SSRSH +FTI  NI+     +       V   KL+LVDLAGSE  +++ A   R +E   INK LL LG VI++LV+     + H+PYRESKLTRLLQDSLGG TKT ++A ISP+  + EET++TL YA RA+ I+N P +N+
Sbjct:   51 SNIHVYVRCRSRNKREIEEKSSVVISTLG-PQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSV--KISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDH----SNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQ 418          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 193.356 bits (490), Expect = 7.844e-52
Identity = 135/352 (38.35%), Postives = 191/352 (54.26%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGFPGGND---------IIIGGTKQ---FTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETAT-VCVKVSFIEVYNEDIFDLLSS---TKE-----MRH-IREENQDIKIPNLLEESVNC-SEDIFKCLMRGSEN-RVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARA 1059
            +IRV  R RP A   L +   S +     +D           I  T Q   F FD +F  Q T  +++K  V  ++ +   GYNV + AYGQTGSGKT+TM        ++   G+IP  IS I+++++ L+       V   FIE+YNE+I DLL S    KE     ++H IR + +          S    SE++ + +++ +   R   STA NE SSRSH+IF I+     LSG+N  T      + L+LVDLAGSER + +   GDR +E  NINK L  LG+VI +L + D  K +H+P+R SKLT LLQ SL G++KTLM   ISPS S+  ET  +L +A++ 
Sbjct:  386 NIRVYCRIRP-ALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFK-EVGQLVQSSLDGYNVCIFAYGQTGSGKTFTM--------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIH-----LSGSNAKTGAHSYGT-LNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTK-RHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKV 720          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 163.696 bits (413), Expect = 3.469e-42
Identity = 113/347 (32.56%), Postives = 165/347 (47.55%), Query Frame = 1
Query:  190 QFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYL--DPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR------------------------HIREENQ-DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSL---------------------------VEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQI 1068
            +F FDHVF+   T  E+Y+ + + MI+ L +G+N T+ AYG TGSGKT+TM  N        E G+IP ++S ++  +    +       V +S++E+YNE I+DLL S  E                           IR+++Q  +K+  L E     SE++ + +  G ++R +G T  N  SSRSHAI  I +       +         SS L L DLAGSERA+      +R KEG  INK LL LG VIS L                                  + H+PYR+SKLTRLLQ +L G++    +  +   +    ET  TL +A+RA+ +
Sbjct:  162 EFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGN------EQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLT------STNVKNGTSRSSTLSLCDLAGSERAT---GQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 148.288 bits (373), Expect = 1.116e-36
Identity = 86/182 (47.25%), Postives = 118/182 (64.84%), Query Frame = 1
Query:  535 EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKP 1080
            ++   I I NL E  +  + +    L +G ++R V ST MN+ SSRSH IFTI      L   ++   F    SK++LVDLAGSE  +++ A   R KE  +IN+ LL LG VI++LV+K    + H+P+RESKLTRLLQDSLGGNTKT ++A ISP+    EET +TL YA++A+ I+NKP
Sbjct:  311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTI-----TLYKKHQDELFRI--SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK----SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481          

HSP 2 Score: 85.1149 bits (209), Expect = 3.956e-17
Identity = 57/161 (35.40%), Postives = 83/161 (51.55%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGFP---GGNDIIIGGT-----------KQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTN--FSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS 510
            +I V VR R     E+       V  P   G  +I I  T           K++T D VF   A+Q+ I+      +  +   GYN TVL YG T +GKTYTM  +    + ++S  +G+IPR +  ++D L+ L++   V VK SFIE+YNE++ DLL S
Sbjct:   36 NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLE-LQQNDYV-VKCSFIELYNEELKDLLDS 194          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFN0])

HSP 1 Score: 372.859 bits (956), Expect = 5.817e-116
Identity = 195/373 (52.28%), Postives = 256/373 (68.63%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES--GVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLL--SSTKEMRHIREENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNG 1179
            ++V VR RPL + E+ + CQ C+   PG   +I+G  K FT+D+VF   ++Q+E+Y   V  +++  F GYN TVLAYGQTGSGKT++MGT+F+      E   GVIPR I D++ +++  ++     +KVSF+E++NE+I DLL  SST E   IRE  +  IKI  L+E+ V+  +D+ +CL  GS +RV G+TAMN  SSRSHAI+TI   I+   G    +      +K HLVDLAGSER  KT A G+RFKEGVNINKGLL LGNVIS+L ++ +  + HVPYR+SKLTRLLQDSLGGN+ TLMLAC+SP+DSN+EET  TL YA RAR I+NKPIINR D    EI +LR Q+  LQA   G + NG
Sbjct:   12 VKVAVRIRPLLHKEISEACQECISVTPGEPQVIMGTNKAFTYDYVFGKSSSQKELYTDVVTPLLDGFFKGYNATVLAYGQTGSGKTHSMGTSFTVCTSDDEDSQGVIPRLIQDLFRHIE--QDKCEYSLKVSFLEIHNEEIHDLLNPSSTDERITIRESCEGGIKIAGLMEKKVDSVQDMVQCLELGSASRVTGATAMNSRSSRSHAIYTI---IMEQRGKGIDSDVR--KAKFHLVDLAGSERVKKTNAQGERFKEGVNINKGLLCLGNVISALSDEQRNPSTHVPYRDSKLTRLLQDSLGGNSNTLMLACVSPADSNYEETLNTLRYADRARHIKNKPIINR-DPQLAEIMRLRQQIEMLQALQGGQLING 376          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REX9])

HSP 1 Score: 263.848 bits (673), Expect = 1.758e-79
Identity = 149/321 (46.42%), Postives = 204/321 (63.55%), Query Frame = 1
Query:  142 CVGFPGGN-DIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLL---SSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINR 1092
            CV F      +I+G  + FTFD+VF   A+Q E+Y+  +  ++ +   GYN TV AYGQTGSGKTYT+G   +   +  + G+IPRA+  I+   +  ++     V VS+IE+Y E++ DLL   +S+K++ HIRE+  D      +E+ V   +++  CL  GS  R  G+T MNE SSRSHAIFT+YI+ +               SK H VDLAGSER  +T   GDRFKE V IN GLL LGNVIS+L +  ++K  HVPYRESK+TRLL+DSLGGN +T M+ C+SP+ ++F E   TL +A RAR I+NKP+INR
Sbjct:   27 CVEFVANKPQLILGKDRGFTFDYVFQPDASQVEVYESCIEPLVKSCLEGYNATVFAYGQTGSGKTYTIGGLDTGGLMDDQYGIIPRAVKQIFQAFES-KQKIVFEVHVSYIEIYLEELRDLLDLDTSSKDI-HIRED--DKGNTGAMEQPVQSLDEVMSCLDTGSAARHTGATNMNEQSSRSHAIFTMYIDYMDYK-----------YSKFHFVDLAGSERVDRTGNVGDRFKESVQINTGLLALGNVISALADA-RKKILHVPYRESKVTRLLKDSLGGNARTTMITCLSPAAADFAENLNTLKFATRARNIRNKPVINR 331          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 259.225 bits (661), Expect = 1.736e-77
Identity = 157/353 (44.48%), Postives = 213/353 (60.34%), Query Frame = 1
Query:   79 IRVGVRTRPLAYNELRDGCQSCVGF-----------PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDP--LRETATVCVKVSFIEVYNEDIFDLL-SSTKEMRHIREE-NQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINI-LPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIIN 1089
            +RV  R RPL YNE++   +  V             PG    +    K FTFD V+  Q   E++Y   V  +++ +  GYN TV AYGQT  GKT+TM       +  S+ G+ PR    I + +     R      + VS++E+YNE+I DLL  +T+    I+E  ++ + +  L   +V+C ED+ + L  GS NR VGST MN  SSRSH+IF I + + +   G  EC      + KL+LVDLAGSER SK+ ATG+RF+E   IN  L  LGNVIS+LV+    K+KH+PYR+SKLTRLLQDSLGGN+KTLM+ACISP  +N+EET +TL YA RA+ I+N+P IN
Sbjct:    6 VRVIARCRPLDYNEIKMKTEIIVSIDSSLRQCSLRKPGDPAKM---RKVFTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQ---GSAQPESQVGITPRCCRHILNSMQGKGRRRNREYLLHVSYLEIYNEEIRDLLVKNTRSNLEIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDLQVNVNKGGEGECVR----NGKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDG---KSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNIKNRPRIN 345          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO37529 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFN7])

HSP 1 Score: 256.529 bits (654), Expect = 1.497e-76
Identity = 161/377 (42.71%), Postives = 222/377 (58.89%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGF-----------PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQD--IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPL-SGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKG 1164
            ++RV VR RPL   E    C++ +             PG         K FTFD  +   +T E IY      ++  +  GYN TV AYGQTG GK+++M    +D    ++ G+IPRA   I++ ++ + + +   V  S++E+YNE+I DLL    + +   +E+ D  + + +L    VNC  +I   +  GS+NR VG+T MN  SSRSH+IF+I + IL   S  NE       + KL+LVDLAGSER SKT ATG R KE   IN  L  LGNVIS+LV+    K KH+PYR+SKLTRLLQDSLGGNTKTLM+AC+SP+D+N++ET +TL YA RA+ I+NKP IN  D     + Q   ++  L+  L G
Sbjct:    4 AVRVIVRCRPLNKREKDLKCETVLEMDSDTGQCRLHKPGDK---TQPPKAFTFDGAYFIDSTTENIYNDICFPLVEGVLEGYNGTVFAYGQTGCGKSFSM-MGITDP--PTQRGIIPRAFEHIFESIN-VADDSKFLVHASYLEIYNEEIRDLLGKDHKAKLDLKEHPDKGVYVKDLTMIPVNCVSEIEHVMDLGSKNRSVGATLMNADSSRSHSIFSINLEILDDDSEGNEHIR----AGKLNLVDLAGSERQSKTGATGGRLKEATKINLSLSALGNVISALVD---GKAKHIPYRDSKLTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIKNKPKINE-DPKDALLRQYSEEIERLKKMLMG 365          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO49352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG40])

HSP 1 Score: 237.269 bits (604), Expect = 2.369e-70
Identity = 139/328 (42.38%), Postives = 193/328 (58.84%), Query Frame = 1
Query:   76 SIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIK-IPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAAR 1056
            +I+V  R RP +  E + G Q  V FP  +  I GG + FTFD VF   ATQE++Y  + + ++ ++  GYN T+ AYGQT SGKT+TM      I  S   G+IPR + DI++++  + E     +KVS+ E+Y + I DLL  TK    + E+   +  +    E  V+  E++ + +  G  NR V  T MNE SSRSH+IF ++I            T + +S KL+LVDLAGSE+ SKT A G    E  NINK L  LGNVIS+L E  K    HVPYR+SK+TR+LQ+SLGGN +T ++ C SPS  N +ET +TL +  R
Sbjct:   12 NIKVFCRFRPQSDAETKAGGQIVVKFPTPDTAIHGG-RTFTFDRVFKPTATQEKVYSEAAQAIVQDVLNGYNGTIFAYGQTSSGKTHTME---GLIDSSLHQGIIPRIVQDIFNHIYNMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLAVHEDKNRVPFVKGGTERFVSSPEEVMEIIDEGKANRHVAVTNMNEHSSRSHSIFLLHIK------QENVETNKKLSGKLYLVDLAGSEKVSKTHAEGSVLDEAKNINKSLSALGNVISALAEGTKS---HVPYRDSKMTRILQESLGGNARTTIIICCSPSSFNDQETRSTLMFGQR 326          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif4 (chromosome-associated kinesin KIF4 [Source:NCBI gene;Acc:101165832])

HSP 1 Score: 397.512 bits (1020), Expect = 3.335e-119
Identity = 317/925 (34.27%), Postives = 483/925 (52.22%), Query Frame = 1
Query:   64 APLSSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT---VCVKVSFIEVYNEDIFDLLSSTKEMRHI--REENQD-IKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL---KGAVG---NGMEA------LVLKPQVVSP--SHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCS-DMEKDEIYLE-------------LEKLVTDM-NKSEHMETLENADIA-DQSTEENKTVNKEKADIL-----------------NCLREE------------LRTKEAHLQQIEHTDYAL--LQQYEEKNRELLQRI-------------------KELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNN--KNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENF---------------------SEVDSEEKFQ---------LQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQK 2478
            A +  +RV +R RPL   E+ +GCQ C+ F PG   +I+G  K FT+D+VF   A QEE++  +V  ++  LF GY+ TVLAYGQTGSGKTY+MG  ++  + +  S GVIPR I  I++     RE  T     + +S++E+YNEDI DLL S+K+   I  RE+ +D IKI  L E  V  ++++  CL  G+  R VGSTAMN  SSRSHAIFTI +      G N+  +   + SKLHLVDLAGSER  KT A GDR KEG++IN+GLL LGNVIS+L ++ K KN  VPYR+SKLTRLLQDSLGGN+ TLM+ACISP+DSN EET  TL YA RAR+I+NKPI+N +D    E+ +L+ QV  LQ  L   +G V    +G E       LV + + +    S  S      A   A   +KI + E+ +E L  K   L  +    +C+ D+EK    LE             L+ L+ ++ N+SE M    NA  A ++  E +    K  AD                   + LR+             L  KEA ++++   D  L  +Q   +KN + LQ                     K+  + KL    + R  +L+ +L + K++L + + L K KE S  +V +L  +I  +K    ++ ++++++   FR   ++KD++   L  KDR  + +M K      K+  VLRRK E   A  KRLKD L  + +   KR + ++   +++  +VK W+   +E+     E  +  + L+E+R+ L+E++ +                      SE++S+   +         L+ E+   N  I+ LQQ  L ++  +++++   +   +I + + A++ +  +LV  +       SE++QE+     L+K
Sbjct:    6 AKVIPVRVALRCRPLVPKEINEGCQCCLAFVPGEPQVIVGTEKAFTYDYVFDPTAEQEEVFSSAVSPLLRGLFRGYHATVLAYGQTGSGKTYSMGGTYTSAQENDPSVGVIPRVIKKIFEE----REKKTDSEFSLSISYLEIYNEDILDLLCSSKDKPSISIREDPKDGIKIVGLTERQVFSAQEMVNCLELGNAARTVGSTAMNAASSRSHAIFTITLE--QRKGLNKVDS---IVSKLHLVDLAGSERQKKTKAEGDRLKEGISINRGLLCLGNVISALGDESK-KNTFVPYRDSKLTRLLQDSLGGNSHTLMIACISPADSNMEETINTLRYADRARKIKNKPIVN-IDPRAAEMNRLKQQVQELQVMLLHARGGVAPVLSGSEPEDNVSKLVERNRALQDENSKLSRELGEAAGQTALMFEKIIMSEQANERLQSK---LEELQHHAACTVDLEKVLATLEDQELKENVEVMKNLQDLILELKNESEGMAASINAMTAGEEPPEASGNGPKNSADTSPTDAAAMRDSPEAFTAHHALRQAQLSKELIELNKVLSLKEAFVRKMCENDSQLEPMQSNHQKNVQTLQSAVDSLQKEKEDLILALQSAKKDTNQAKLSEQRRKRLQELEHQLVDMKKKLLDQSKLLKLKESSVQKVSKLMQEIQAMKSQRTQLMRQMREDSEKFRLWKSKKDREVLQLKEKDRKRQYEMIKLERDFQKQANVLRRKTEEAAAANKRLKDALQKRSEVVEKRKDAMSKGIESVAARVKTWLLNEVEVMVSTEEARRHLSDLLEDRKVLAEEITHLKQQIEAGEKPAPKIRRRTLIISELESQGALETPLTKQVENLETEMGLRNAQIADLQQKVLAAD-GEVRLKQRIDGITSIVDAKCALRLLMSELVSAKTACAKLESELKQEKGNAQDLRK 915          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 322.783 bits (826), Expect = 1.371e-91
Identity = 176/392 (44.90%), Postives = 242/392 (61.73%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMR---HIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPL--------------SGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            SS+RV +R RP    E  +GC  C    PG   +I+G  K FT+D VF   + Q+ IY      +I   F GYN TV AYGQTGSGKTYTMGT F D+ I+ E  G+IPRA+  ++  ++  RE A           +   F+E+YNE++ DL  ST++M+   HI+   + N  I    +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++  + +              +G  E   +E +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K ++ HVPYR+SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L
Sbjct:    8 SSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSK-RSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQ-DKASQQISALRTEIARLQIEL 396          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 322.398 bits (825), Expect = 1.542e-91
Identity = 176/392 (44.90%), Postives = 242/392 (61.73%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMR---HIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPL--------------SGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            SS+RV +R RP    E  +GC  C    PG   +I+G  K FT+D VF   + Q+ IY      +I   F GYN TV AYGQTGSGKTYTMGT F D+ I+ E  G+IPRA+  ++  ++  RE A           +   F+E+YNE++ DL  ST++M+   HI+   + N  I    +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++  + +              +G  E   +E +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K ++ HVPYR+SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L
Sbjct:    8 SSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSK-RSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQ-DKASQQISALRTEIARLQIEL 396          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kif21a (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101173385])

HSP 1 Score: 322.398 bits (825), Expect = 1.682e-91
Identity = 176/392 (44.90%), Postives = 242/392 (61.73%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMR---HIR---EENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPL--------------SGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            SS+RV +R RP    E  +GC  C    PG   +I+G  K FT+D VF   + Q+ IY      +I   F GYN TV AYGQTGSGKTYTMGT F D+ I+ E  G+IPRA+  ++  ++  RE A           +   F+E+YNE++ DL  ST++M+   HI+   + N  I    +   +V+   ++ +CL  G+ +R   ST MN  SSRSHAIFTI++  + +              +G  E   +E +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K ++ HVPYR+SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L
Sbjct:    8 SSVRVALRIRPQLAREKIEGCHICTYVMPGEPQVILGKDKAFTYDFVFDMDSQQDAIYSTCTEKLIEGCFEGYNATVFAYGQTGSGKTYTMGTGF-DVNIADEELGIIPRAVHHLFKGIEERREAAQEQGRPVPEFKINAQFLELYNEEVLDLFDSTRDMKQKAHIKIHEDANGGIYTVGVTTRTVSSKAEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHLCQVRVCASDNQEDETNRVSNGNPEMDEYETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRSK-RSSHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDQDFMETLNTLKYANRARNIKNKVMVNQ-DKASQQISALRTEIARLQIEL 396          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: KIF21A (kinesin-like protein KIF21A [Source:NCBI gene;Acc:101157410])

HSP 1 Score: 303.523 bits (776), Expect = 4.299e-91
Identity = 178/406 (43.84%), Postives = 244/406 (60.10%), Query Frame = 1
Query:   94 RTRPLAYNELRDGCQSCVG-FPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSES-GVIPRAISDIYDYLDPLRETAT--------VCVKVSFIEVYNEDIFDLLSSTKEMRHIREE---------NQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINIL----P----------LSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL------KGAVG-NGMEAL 1191
            R RP    E  + C  C    PG   +++G  K FTFD+VF  ++ QE IY      +I   F GYN T+ AYGQTGSGKT+TMGT F DI I  E  G+IPRAI+ ++  ++  R+ A           +   F+E+YNE++ DL  ST+E+   R++         N  I    +   +V  + ++ +CL  G+ +R   ST MN  SSRSHAIFTI++  +    P          L+  +E   FE +++K H VDLAGSER  +T ATGDR KEG++IN GLL LGNVIS+L ++ K ++ HVPYR+SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TL YA RAR I+NK ++N+ D A  +I  LR ++  LQ +L      K  VG NG+E +
Sbjct:    1 RIRPQLAKEKIESCHICTYVMPGEPQVVLGKDKAFTFDYVFDMESQQETIYTHCTEKLIEGCFEGYNATIFAYGQTGSGKTFTMGTGF-DINIGEEELGIIPRAINHLFRGIEERRQAAAEQGTPVPEFKINAQFLELYNEEVLDLFDSTRELEARRQKSGIKIHEDANGGIYTVGVTTRTVTSAAEMMQCLKLGALSRSTASTQMNVQSSRSHAIFTIHLCQVRVCSPDNHENETDNRLANNSEINEFETLTAKFHFVDLAGSERLKRTGATGDRAKEGISINCGLLALGNVISALGDRGK-RSTHVPYRDSKLTRLLQDSLGGNSQTVMIACISPSDRDFMETLNTLKYANRARNIKNKVVVNQ-DRASQQISVLRTEIARLQMELMEYKAGKRMVGENGVEGI 403          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000063375.1 (SMESG000063375.1)

HSP 1 Score: 2040.39 bits (5285), Expect = 0.000e+0
Identity = 1021/1024 (99.71%), Postives = 1022/1024 (99.80%), Query Frame = 1
Query:   61 MAPLSSIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEHMETLENADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGXXXXXXXXXXXXFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLEAELETIRTDNEITLNQKLKKRRTSSSWEPEKERQSKRLKHCSDTEXXXXXXXXXXXXXXXLGCRCKTGCKPSRCGCLKSSASCNDKCSCKGECSRLSILPQIEEDCVEKSHCDIYDDTDVMNQTFCMSNENQSHVLNQSFTMNRNSTTNFIIPNIDDDEDKENFNATIINTDETLTESLLKKRTVDLPDYSNGKRSTSSNKNYFESLSNSNK 3132
            MAPLSSIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLS ANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEHMETLENAD+ADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGKRLKDKLDCKKDFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLEAELETIRTDNEITLNQKLKKRRTSSSWEPEKERQSKRLKHCSDTESIASSSNSRKSARGSLGCRCKTGCKPSRCGCLKSSASCNDKCSCKGECSRLSILPQIEEDCVEKSHCDIYDDTDVMNQTFCMSNENQSHVLNQSFTMNRNS TNFIIPNIDDDEDKENFNATIINTDETLTESLLKKRTVDLPDYSNGKRSTSSNKNYFESLSNSNK
Sbjct:    1 MAPLSSIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSDANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIVAAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKLVTDMNKSEHMETLENADVADQSTEENKTVNKEKADILNCLREELRTKEAHLQQIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEAKRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFRKIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGKRLKDKLDCKKDFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRFNLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQVELTSEKDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQERELVDTLQKANEKLEAELETIRTDNEITLNQKLKKRRTSSSWEPEKERQSKRLKHCSDTESIASSSNSRKSARGSLGCRCKTGCKPSRCGCLKSSASCNDKCSCKGECSRLSILPQIEEDCVEKSHCDIYDDTDVMNQTFCMSNENQSHVLNQSFTMNRNSATNFIIPNIDDDEDKENFNATIINTDETLTESLLKKRTVDLPDYSNGKRSTSSNKNYFESLSNSNK 1024          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 323.939 bits (829), Expect = 1.848e-92
Identity = 170/388 (43.81%), Postives = 237/388 (61.08%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR-------HIRE-ENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFE-----------------PVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +++RV  R RPL   E  +G +SC+   P    +I+G  + FTFD VF+ ++ Q+EIY+  V+D++ N+F GYN T+ AYGQTGSGKTYTMGT   +  I  E G++PRA+ +I+  +   +      V  SFIEVY E++ DLL  +            IRE E  +  +  + E       D+ +CL  GS NRV  +T MNE SSRSH +FT+  N++    +  C   +                  VS K H VDLAGSERA KT   GDRFKE ++IN GLL LGNVIS+L +  K+K  H+PYRESK+TR+L+DSLGGN +TLM+ CISP+ SN++E+  +L YA RAR I+NKPI+N  D    +I Q+++++ AL+ QL
Sbjct:    9 TNVRVVTRVRPLLVKEKLNGEESCIRVSPDLKQVIVGKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVKFTVTASFIEVYKEEVRDLLDPSGNFSGQDGTSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTV--NVVQ-EWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNH-DHTTRQIVQMQSEIIALREQL 392          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000024428.1 (SMESG000024428.1)

HSP 1 Score: 323.553 bits (828), Expect = 2.404e-92
Identity = 170/388 (43.81%), Postives = 237/388 (61.08%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSSTKEMR-------HIRE-ENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYINILPLSGANECTTFE-----------------PVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +++RV  R RPL   E  +G +SC+   P    +I+G  + FTFD VF+ ++ Q+EIY+  V+D++ N+F GYN T+ AYGQTGSGKTYTMGT   +  I  E G++PRA+ +I+  +   +      V  SFIEVY E++ DLL  +            IRE E  +  +  + E       D+ +CL  GS NRV  +T MNE SSRSH +FT+  N++    +  C   +                  VS K H VDLAGSERA KT   GDRFKE ++IN GLL LGNVIS+L +  K+K  H+PYRESK+TR+L+DSLGGN +TLM+ CISP+ SN++E+  +L YA RAR I+NKPI+N  D    +I Q+++++ AL+ QL
Sbjct:    9 TNVRVVTRVRPLLVKEKLNGEESCIRVSPDLKQVIVGKDRGFTFDAVFNQKSNQDEIYQTCVKDLVKNIFDGYNSTIFAYGQTGSGKTYTMGTFNQEELIHEEKGIVPRAVEEIFTLITEKQNLVKFTVTASFIEVYKEEVRDLLDPSGNFSGQDGTSIQIREDERGNTILCGVYEHLCENQSDLLECLEIGSANRVTEATQMNEHSSRSHCVFTV--NVVQ-EWSTSCVDLDLSYTENSESDKKNEIKNVVSGKFHFVDLAGSERAHKTGNVGDRFKESIHINSGLLALGNVISALGDPKKKKISHIPYRESKITRILKDSLGGNARTLMICCISPTISNYDESLNSLKYANRARNIRNKPIVNH-DHTTRQIVQMQSEIIALREQL 392          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000060958.1 (SMESG000060958.1)

HSP 1 Score: 300.056 bits (767), Expect = 4.692e-84
Identity = 176/387 (45.48%), Postives = 238/387 (61.50%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISS-ESGVIPRAISDIYDYLDPLR--------ETATVCVKVSFIEVYNEDIFDLLS---STKEMRHIR-EENQ--DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI--------NILP-LSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +S++V VR RP    E     Q C    P    I IG  K FT+D VF+  + Q+EI+    + +I+    GYN T+LAYGQTGSGKT+TMG+ F DI + S + G+IPR +  +++ +D +R              +   F+E+YNE++ DLL       +  HI+  EN    I +  +    V+  ED  KCL  G+  R   ST MN  SSRSHAIFT++I        N+   L+G  E T +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L +K K +  HVPYR SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TLNYA RAR I+NK  IN+ D A  ++  +R Q+ +LQA+L
Sbjct:   13 ASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGF-DISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETE-TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAK-RGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQ-DKASKQLAAMRMQIESLQAEL 395          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000060958.1 (SMESG000060958.1)

HSP 1 Score: 300.056 bits (767), Expect = 4.803e-84
Identity = 176/387 (45.48%), Postives = 238/387 (61.50%), Query Frame = 1
Query:   73 SSIRVGVRTRPLAYNELRDGCQSCVGF-PGGNDIIIGGTKQFTFDHVFSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSDIKISS-ESGVIPRAISDIYDYLDPLR--------ETATVCVKVSFIEVYNEDIFDLLS---STKEMRHIR-EENQ--DIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNETSSRSHAIFTIYI--------NILP-LSGANECTTFEPVSSKLHLVDLAGSERASKTMATGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDSLGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQGEIYQLRAQVTALQAQL 1158
            +S++V VR RP    E     Q C    P    I IG  K FT+D VF+  + Q+EI+    + +I+    GYN T+LAYGQTGSGKT+TMG+ F DI + S + G+IPR +  +++ +D +R              +   F+E+YNE++ DLL       +  HI+  EN    I +  +    V+  ED  KCL  G+  R   ST MN  SSRSHAIFT++I        N+   L+G  E T +E +++K H VDLAGSER  +T ATG+R KEG++IN GLL LGNVIS+L +K K +  HVPYR SKLTRLLQDSLGGN++T+M+ACISPSD +F ET  TLNYA RAR I+NK  IN+ D A  ++  +R Q+ +LQA+L
Sbjct:   13 ASVKVAVRVRPQNARERMQMNQICASVTPNEPQIYIGKDKAFTYDFVFNILSKQDEIFNTLAKPLIDGCLEGYNATILAYGQTGSGKTFTMGSGF-DISLDSVDVGIIPRGVQYLFNRIDKIRTDYKKKMLPVPDFKIVAQFLELYNEELIDLLDIQDGKDKKSHIKIHENTGGSIYLTGVSTRLVSSLEDTLKCLKDGTLCRSTASTNMNSASSRSHAIFTLHIKQQRMIDSNLDDNLNGETE-TDYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNVISTLGDKAK-RGCHVPYRNSKLTRLLQDSLGGNSQTIMIACISPSDCDFLETLNTLNYANRARNIKNKLTINQ-DKASKQLAAMRMQIESLQAEL 395          
The following BLAST results are available for this feature:
BLAST of Kinesin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF4B6.008e-11934.76kinesin family member 4B [Source:HGNC Symbol;Acc:H... [more]
KIF4A4.489e-11633.81kinesin family member 4A [Source:HGNC Symbol;Acc:H... [more]
KIF21B4.536e-8944.16kinesin family member 21B [Source:HGNC Symbol;Acc:... [more]
KIF21B4.902e-8944.16kinesin family member 21B [Source:HGNC Symbol;Acc:... [more]
KIF21B4.963e-8944.16kinesin family member 21B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-191.088e-9034.40Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
osm-31.581e-8244.13Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
klp-121.096e-7944.73Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-121.257e-7944.73Kinesin-Like Protein [Source:UniProtKB/TrEMBL;Acc... [more]
osm-32.764e-7945.64Osmotic avoidance abnormal protein 3 [Source:UniP... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Klp3A1.949e-10231.37gene:FBgn0011606 transcript:FBtr0340093[more]
Klp3A1.949e-10231.37gene:FBgn0011606 transcript:FBtr0070448[more]
Klp31E9.580e-9430.55gene:FBgn0032243 transcript:FBtr0331642[more]
Klp31E1.002e-9330.78gene:FBgn0032243 transcript:FBtr0302039[more]
Klp31E1.002e-9330.78gene:FBgn0032243 transcript:FBtr0080018[more]
back to top
BLAST of Kinesin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif43.301e-11433.30kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif43.301e-11433.30kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif21b2.164e-8743.94kinesin family member 21B [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21a2.814e-8743.39kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21b2.447e-8644.33kinesin family member 21B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyp2a6.71.398e-11932.46cytochrome P450 family 2 subfamily A member 6 gene... [more]
cyp2a6.71.869e-11734.36cytochrome P450 family 2 subfamily A member 6 gene... [more]
cyp2a6.72.454e-11733.74cytochrome P450 family 2 subfamily A member 6 gene... [more]
cyp2a6.73.006e-11734.50cytochrome P450 family 2 subfamily A member 6 gene... [more]
cyp2a6.72.941e-10650.40cytochrome P450 family 2 subfamily A member 6 gene... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kif42.521e-11533.79kinesin family member 4 [Source:MGI Symbol;Acc:MGI... [more]
Kif21b1.197e-9244.92kinesin family member 21B [Source:MGI Symbol;Acc:M... [more]
Kif21b1.582e-9244.92kinesin family member 21B [Source:MGI Symbol;Acc:M... [more]
Kif21a8.135e-9043.78kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
Kif21a8.418e-9043.78kinesin family member 21A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Kinesin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2VIQ3|KIF4B_HUMAN2.885e-11834.76Chromosome-associated kinesin KIF4B OS=Homo sapien... [more]
sp|O95239|KIF4A_HUMAN2.156e-11533.81Chromosome-associated kinesin KIF4A OS=Homo sapien... [more]
sp|P33174|KIF4_MOUSE1.763e-11433.79Chromosome-associated kinesin KIF4 OS=Mus musculus... [more]
sp|Q91784|KIF4_XENLA6.060e-11033.63Chromosome-associated kinesin KIF4 OS=Xenopus laev... [more]
sp|Q8GS71|KN4A_ARATH2.361e-10235.79Kinesin-like protein KIN-4A OS=Arabidopsis thalian... [more]
back to top
BLAST of Kinesin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4LW152.260e-12734.41Kif4a, putative OS=Schistosoma mansoni OX=6183 GN=... [more]
A0A131Y4Q26.476e-12734.46Putative kinesin-like protein (Fragment) OS=Ixodes... [more]
A0A158P2Q97.015e-12434.73Kinesin motor domain-containing protein OS=Atta ce... [more]
A0A151I0F68.361e-12435.40Chromosome-associated kinesin KIF4A OS=Atta colomb... [more]
A0A3P8SL061.078e-12331.66Kinesin family member 4 OS=Amphiprion percula OX=1... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif42.108e-10932.39kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif42.898e-10449.60kinesin family member 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
kif21a5.512e-8944.15kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21a6.252e-8943.37kinesin family member 21A [Source:ZFIN;Acc:ZDB-GEN... [more]
kif21b6.253e-8643.83kinesin family member 21B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIF271.075e-9548.63kinesin family member 27 [Source:HGNC Symbol;Acc:H... [more]
kif3ca4.959e-7240.16kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000001102.11.902e-7141.52pep scaffold:Pmarinus_7.0:GL476652:232474:299869:1... [more]
kif3a4.789e-7135.23kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000010617.18.344e-7142.54pep scaffold:Pmarinus_7.0:GL476849:1993:16233:1 ge... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIP31.751e-6340.89Kinesin-related antiparallel sliding motor protein... [more]
KIP12.947e-6037.60Kinesin-related motor protein; required for mitoti... [more]
KAR37.844e-5238.35Minus-end-directed microtubule motor; functions in... [more]
KIP23.469e-4232.56Kinesin-related motor protein involved in mitotic ... [more]
CIN81.116e-3647.25Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496295.817e-11652.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499901.758e-7946.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396101.736e-7744.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375291.497e-7642.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493522.369e-7042.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif43.335e-11934.27chromosome-associated kinesin KIF4 [Source:NCBI ge... [more]
kif21a1.371e-9144.90kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
kif21a1.542e-9144.90kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
kif21a1.682e-9144.90kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
KIF21A4.299e-9143.84kinesin-like protein KIF21A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Kinesin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063375.10.000e+099.71SMESG000063375.1[more]
SMESG000024428.11.848e-9243.81SMESG000024428.1[more]
SMESG000024428.12.404e-9243.81SMESG000024428.1[more]
SMESG000060958.14.692e-8445.48SMESG000060958.1[more]
SMESG000060958.14.803e-8445.48SMESG000060958.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006060 ID=SMED30006060|Name=Kinesin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3203bp
TTGCGACAAATATAAAAGTTATATTTTAATATATATTAATTTTCGAAATT
CTTATTATTAATGGCCCCTCTTTCATCAATTAGAGTTGGTGTGAGAACCC
GCCCTTTAGCTTATAATGAACTACGTGATGGCTGTCAATCATGTGTTGGC
TTTCCCGGAGGGAACGATATTATAATAGGTGGCACAAAACAGTTTACCTT
TGATCATGTTTTTAGTGATCAAGCCACACAGGAAGAAATTTATAAGTGCT
CTGTTCGAGATATGATAAATAATTTATTTTTGGGTTATAATGTTACAGTT
TTGGCCTATGGGCAAACTGGTAGTGGTAAAACATATACCATGGGAACAAA
TTTTTCTGATATTAAAATTTCTTCGGAATCTGGCGTTATTCCAAGAGCTA
TTAGTGATATTTATGATTATCTTGATCCATTGCGTGAAACTGCAACAGTT
TGTGTTAAAGTTTCATTTATAGAGGTATATAATGAAGATATTTTTGATTT
ATTATCAAGTACTAAAGAAATGCGACACATTAGAGAAGAAAATCAGGATA
TTAAAATTCCTAACTTGTTAGAAGAAAGTGTAAATTGCTCTGAAGATATT
TTTAAATGTCTAATGAGGGGAAGTGAAAATAGAGTAGTGGGCAGCACTGC
AATGAATGAAACATCCAGTCGGAGTCATGCAATATTCACAATTTATATAA
ATATTCTTCCTTTGTCAGGTGCCAATGAATGCACAACTTTCGAGCCGGTC
TCGTCTAAACTTCATTTAGTCGATTTAGCGGGATCAGAAAGAGCTAGTAA
AACCATGGCAACTGGCGATAGATTTAAAGAAGGAGTGAATATTAACAAAG
GATTACTAGTGCTGGGGAATGTCATAAGCTCCTTAGTTGAAAAGGATAAG
CAGAAAAATAAGCACGTACCCTATAGGGAATCTAAACTCACGAGATTACT
CCAAGATTCGTTGGGTGGTAATACGAAAACTCTGATGCTTGCTTGCATAA
GCCCTTCGGATTCTAATTTCGAAGAAACATCTACAACTTTAAATTATGCA
GCCAGGGCCCGGCAAATCCAGAATAAACCTATCATTAACAGAGTAGATTC
AGCTCAAGGGGAAATTTATCAACTCCGAGCCCAAGTGACAGCTCTTCAAG
CACAATTGAAGGGCGCAGTTGGAAATGGAATGGAGGCTTTGGTTTTAAAA
CCTCAAGTCGTATCACCGTCACATTTCTCGGAAATCTGTGAATTAAAAGC
GGAAATCGTGGCCGCTCAACGACAGAAAATCGAATTACTCGAGGAATTCG
ACGAGGAGCTTTCGAAGAAAGATGATATTTTGAGAAGAATTTGGGAGAAA
ATCAGTTGTTCAGATATGGAAAAGGATGAAATCTATTTGGAATTAGAGAA
ATTGGTTACCGACATGAATAAATCGGAACATATGGAAACATTAGAGAATG
CTGATATTGCTGACCAATCGACTGAGGAAAACAAAACCGTTAATAAGGAG
AAAGCGGATATTTTGAATTGTTTGCGAGAAGAGTTGCGCACAAAAGAGGC
TCATCTACAGCAAATCGAGCATACGGATTATGCTCTACTTCAACAGTACG
AAGAGAAAAATCGGGAATTACTGCAACGGATTAAGGAATTGGAAGAGGAA
AAGTTACGTAATAATTCTAAACATCGACAAGACGATTTAGATATTCGACT
GAAAGAGGCTAAAAGGCAGTTAAATGAATTGAATATGTTAAAAAAAGAAA
AAGAGCATTCGCATAACGAAGTGAAACAATTGAAAATGAAAATTGACGAA
TTGAAAAAATCTATTTGTAAAGTTACTAAAGAATTACAAAAGGAAAAAAA
CAATTTCCGAAAGATTGCAGCAGAAAAAGATAAACAATTCAAAAATCTGA
TGAATAAGGATAGAATATTAAAGACGCAAATGGAAAAACAGGCCGCTCAG
CACGCGAAAGAAACTGCGGTTCTTCGTCGTAAGGTTGAGAGTTGTATGGC
TGAAGGAAAGCGATTAAAGGACAAATTAGATTGTAAAAAAGATTTCTCTG
CCAAGCGAGTAAATCGAGTCAATAATAAAAATATCTGTGTGCAAGTAAAA
CACTGGATACGGCAACATCTGGAGTTGGCAGCTGAACGGAGTGAAACGAC
TCAGCGTTTCAATTTATTAATTGAAGAACGTCGAAAATTGAGTGAACAAT
TGGAAAATTTCAGTGAAGTCGACAGTGAGGAAAAGTTTCAGTTACAAATG
GAAATCAAGCGATTGAATGAGTGCATTTCACATTTGCAACAAGTCGAACT
GACAAGTGAAAAAGACGATATGCAGGTGCAGGCATGCTGGAATCAATTTC
GGAATATTACTGAATGTCGAATCGCTATTAAATTCGTGTTTCACCAACTG
GTTCAGGAACGAGTCAATAATGTCATGGCGCTATCGGAAATCCAACAGGA
AAGAGAACTCGTTGACACCCTACAGAAAGCCAATGAAAAACTCGAAGCCG
AGTTGGAAACTATTCGAACGGACAATGAAATAACATTAAATCAGAAGCTA
AAAAAGCGTCGGACCTCCTCATCATGGGAACCTGAAAAGGAAAGACAGTC
AAAACGACTGAAACACTGTTCCGATACCGAATCCATTGCCTCCTCCTCCA
ACAGTCGTAAATCAGCAAGGGGATCTCTAGGTTGTCGATGCAAAACTGGT
TGTAAACCCAGTCGTTGTGGATGCTTAAAATCATCTGCTTCCTGCAATGA
TAAATGCTCATGCAAAGGCGAATGCTCAAGACTTTCTATTTTACCTCAGA
TTGAAGAAGATTGCGTTGAAAAGTCTCATTGTGATATATATGATGATACT
GATGTTATGAATCAAACATTTTGTATGTCAAACGAAAATCAGTCACATGT
GCTAAATCAGTCTTTTACAATGAATAGAAATTCAACAACCAATTTCATTA
TTCCCAATATTGATGATGATGAAGACAAGGAAAATTTTAATGCAACTATC
ATTAACACAGATGAAACACTTACTGAATCACTACTTAAAAAGAGAACAGT
CGACTTGCCAGATTATAGTAACGGAAAAAGATCAACATCGTCAAATAAGA
ATTATTTTGAGAGTCTTAGTAATTCTAATAAATGAATTTATCAAAACTTT
AAAAGGAAATTTGTACATATGAATATATTAATGTCAGTTATTTTATATTT
CTT
back to top

protein sequence of SMED30006060-orf-1

>SMED30006060-orf-1 ID=SMED30006060-orf-1|Name=SMED30006060-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1025bp
MAPLSSIRVGVRTRPLAYNELRDGCQSCVGFPGGNDIIIGGTKQFTFDHV
FSDQATQEEIYKCSVRDMINNLFLGYNVTVLAYGQTGSGKTYTMGTNFSD
IKISSESGVIPRAISDIYDYLDPLRETATVCVKVSFIEVYNEDIFDLLSS
TKEMRHIREENQDIKIPNLLEESVNCSEDIFKCLMRGSENRVVGSTAMNE
TSSRSHAIFTIYINILPLSGANECTTFEPVSSKLHLVDLAGSERASKTMA
TGDRFKEGVNINKGLLVLGNVISSLVEKDKQKNKHVPYRESKLTRLLQDS
LGGNTKTLMLACISPSDSNFEETSTTLNYAARARQIQNKPIINRVDSAQG
EIYQLRAQVTALQAQLKGAVGNGMEALVLKPQVVSPSHFSEICELKAEIV
AAQRQKIELLEEFDEELSKKDDILRRIWEKISCSDMEKDEIYLELEKLVT
DMNKSEHMETLENADIADQSTEENKTVNKEKADILNCLREELRTKEAHLQ
QIEHTDYALLQQYEEKNRELLQRIKELEEEKLRNNSKHRQDDLDIRLKEA
KRQLNELNMLKKEKEHSHNEVKQLKMKIDELKKSICKVTKELQKEKNNFR
KIAAEKDKQFKNLMNKDRILKTQMEKQAAQHAKETAVLRRKVESCMAEGK
RLKDKLDCKKDFSAKRVNRVNNKNICVQVKHWIRQHLELAAERSETTQRF
NLLIEERRKLSEQLENFSEVDSEEKFQLQMEIKRLNECISHLQQVELTSE
KDDMQVQACWNQFRNITECRIAIKFVFHQLVQERVNNVMALSEIQQEREL
VDTLQKANEKLEAELETIRTDNEITLNQKLKKRRTSSSWEPEKERQSKRL
KHCSDTESIASSSNSRKSARGSLGCRCKTGCKPSRCGCLKSSASCNDKCS
CKGECSRLSILPQIEEDCVEKSHCDIYDDTDVMNQTFCMSNENQSHVLNQ
SFTMNRNSTTNFIIPNIDDDEDKENFNATIINTDETLTESLLKKRTVDLP
DYSNGKRSTSSNKNYFESLSNSNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003777microtubule motor activity
GO:0008017microtubule binding
GO:0000166nucleotide binding
GO:0003774motor activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 485..505
NoneNo IPR availableCOILSCoilCoilcoord: 794..828
NoneNo IPR availableCOILSCoilCoilcoord: 510..584
NoneNo IPR availableCOILSCoilCoilcoord: 345..365
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 830..865
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 830..855
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1002..1024
NoneNo IPR availablePANTHERPTHR24115:SF839KINESIN-LIKE PROTEIN KIN-4Ccoord: 5..847
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 75..96
score: 68.41
coord: 233..251
score: 63.07
coord: 286..307
score: 70.34
coord: 196..213
score: 62.04
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 4..344
e-value: 6.4E-157
score: 537.3
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 41..336
e-value: 1.6E-106
score: 356.1
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 6..336
score: 117.958
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 3..348
e-value: 3.0E-130
score: 436.0
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 5..847
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 232..243
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..367