TNF receptor-associated factor-2-like protein A

Overview
NameTNF receptor-associated factor-2-like protein A
Smed IDSMED30006046
Length (bp)1150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor-2-like protein A (SMED30006046) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor-2-like protein A (SMED30006046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor-2-like protein A (SMED30006046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor-2-like protein A (SMED30006046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30006046h1SMcG0018984 SmedASXL_064094SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30006046h1SMcG0018984 SmedASXL_064094SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30006046h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30006046h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30006046h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30006046h1SMcG0018984 dd_Smed_v4_10424_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 72.4034 bits (176), Expect = 4.076e-13
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY 717
            L +R+KC  C S+L N HQT CG   C+ CI S       P CP       D  + K  ++ +DN   +E++NL V C     C+ K+  G   +HL   C F+ + C  +KC      KD  +H    C+ R  +C YC      KD+  I+L +  +N C +Y
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPV------DKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHL-QQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCK-----KDVVVINLQNHEENLCPEY 191          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 72.4034 bits (176), Expect = 4.076e-13
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY 717
            L +R+KC  C S+L N HQT CG   C+ CI S       P CP       D  + K  ++ +DN   +E++NL V C     C+ K+  G   +HL   C F+ + C  +KC      KD  +H    C+ R  +C YC      KD+  I+L +  +N C +Y
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPV------DKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHL-QQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCK-----KDVVVINLQNHEENLCPEY 191          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 72.4034 bits (176), Expect = 4.076e-13
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY 717
            L +R+KC  C S+L N HQT CG   C+ CI S       P CP       D  + K  ++ +DN   +E++NL V C     C+ K+  G   +HL   C F+ + C  +KC      KD  +H    C+ R  +C YC      KD+  I+L +  +N C +Y
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPV------DKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHL-QQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCK-----KDVVVINLQNHEENLCPEY 191          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 68.5514 bits (166), Expect = 5.467e-12
Identity = 59/238 (24.79%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVE--------------------------HLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERI 864
            P L  +++C +C   L+ A QT CG   C+ CI   + +    CP  +    +++L  +L    DN   +EI++L V CP E C  K+    + +                          H+   C  R++SCD C      +DK+ H++N C + NV C+YC+  +  + + + H + D         T  + C F    C+ ++M +  + +HLQ    S+   L   +  L  I
Sbjct:   62 PPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDN----EILLENQL--FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQN-CPLANVICEYCNTILIREQMPN-HYDLDC-------PTAPIPCTFSTFGCH-EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVI 283          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 68.5514 bits (166), Expect = 5.467e-12
Identity = 59/238 (24.79%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVE--------------------------HLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERI 864
            P L  +++C +C   L+ A QT CG   C+ CI   + +    CP  +    +++L  +L    DN   +EI++L V CP E C  K+    + +                          H+   C  R++SCD C      +DK+ H++N C + NV C+YC+  +  + + + H + D         T  + C F    C+ ++M +  + +HLQ    S+   L   +  L  I
Sbjct:   62 PPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDN----EILLENQL--FPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQN-CPLANVICEYCNTILIREQMPN-HYDLDC-------PTAPIPCTFSTFGCH-EKMQRNHLARHLQENTQSHMRMLAQAVHSLSVI 283          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 81.6481 bits (200), Expect = 2.119e-16
Identity = 56/199 (28.14%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKE----LDIK---QDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            S+  +++C  C+ IL+   Q  CG   C  C K   ++GP PC +    C+   +++E    L+I     DNA  +EI +L   CP E CS   T           C F  + C+ C +     +KD+H + ECE R + CKYC    + K++K+       D  C K+       P    DC   ++ +E   +H ++
Sbjct:   38 SMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEA----CRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKA------HDEICQKF-------PMQCKDCGKKKIPREKFQEHTKS 219          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 81.6481 bits (200), Expect = 2.119e-16
Identity = 56/199 (28.14%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKE----LDIK---QDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            S+  +++C  C+ IL+   Q  CG   C  C K   ++GP PC +    C+   +++E    L+I     DNA  +EI +L   CP E CS   T           C F  + C+ C +     +KD+H + ECE R + CKYC    + K++K+       D  C K+       P    DC   ++ +E   +H ++
Sbjct:   38 SMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEA----CRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKA------HDEICQKF-------PMQCKDCGKKKIPREKFQEHTKS 219          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 81.6481 bits (200), Expect = 2.420e-16
Identity = 56/199 (28.14%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKE----LDIK---QDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            S+  +++C  C+ IL+   Q  CG   C  C K   ++GP PC +    C+   +++E    L+I     DNA  +EI +L   CP E CS   T           C F  + C+ C +     +KD+H + ECE R + CKYC    + K++K+       D  C K+       P    DC   ++ +E   +H ++
Sbjct:   51 SMEPKYQCQQCKDILRKPFQAQCGHRFCVFCFKQLTSSGPIPCEA----CRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKA------HDEICQKF-------PMQCKDCGKKKIPREKFQEHTKS 232          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 67.3958 bits (163), Expect = 1.102e-11
Identity = 59/215 (27.44%), Postives = 90/215 (41.86%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKS---------------------IHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            L D+  C +C  IL+   Q  CG   C  C    +++GP+ C +   +DI  +   + K+     DNA  +E+  LE  C  E CS   T      +    C FR + C  C    +A + ++H + EC  R + CKYC +    K++K+                          D    CTK+ T    C FH + C++  + KE I  H QA
Sbjct:   28 LEDKHLCNICLKILRRPFQAQCGHRFCSYCFNKAVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEECSWTGTIKEYEANHEGKCDFRILPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKLCTKFRT---PCRFHVVGCDMT-VEKEKIHDHEQA 238          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 64.3142 bits (155), Expect = 8.311e-11
Identity = 64/261 (24.52%), Postives = 112/261 (42.91%), Query Frame = 1
Query:  169 SMVESSYQIPAILELYPFE-QPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMR--------------------------NVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINN 870
            S +  S  +P   + Y  E  P L  +++C +C   L++A QT CG   C+ CI+  + +  + CP  +    +V+L ++L    DN   +EI++L V C    CS K+    + +HL   CRF    C +C         D+H+   C  R                          N  C+YC  E+  +D  ++H ++D    C K     + C F    C  ++MT+  + +H+Q E+    +  ++     + +NN
Sbjct:   42 STISVSSSMPPDQQGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDN----EVLLEEQL--FPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQ-CRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELI-RDQLALHCDTD----CLKA---PVACTFSTFGCR-EKMTRNELAQHMQ-EFTQMHMRYMAEFLRSQTLNN 285          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 76.6406 bits (187), Expect = 1.181e-14
Identity = 63/208 (30.29%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFE-LCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMS---NKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALI 837
            L DR+KC  C  +L N HQT CG   CEKCI + +     P CP   I+ +++   K  +I +DN   +E++NL V C     C +K+  G   EHL   C +    C  D C  +   K+   H ++EC++R   C YC + MS     + K I  +   D    +    +L+C F +  CN+  M K   VK  +  ++ + +  +
Sbjct:   38 LQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCP---IDMENI---KSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQ-CLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSFQLDKHLCECPEAELQCTFSNYGCNV--MVKRGKVKEHEDTFLRDHMLYV 236          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 70.4774 bits (171), Expect = 1.311e-12
Identity = 59/193 (30.57%), Postives = 89/193 (46.11%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFE-LCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMS------------NKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNL 765
            L DR+KC  C  +L N HQT CG   CEKCI + +     P CP   I+ +++   K  +I +DN   +E++NL V C     C +K+  G   EHL   C +    C  D C  +   K+   H ++EC++R   C YC + MS              + K I  +   D    +    +L+C F +  CN+
Sbjct:   38 LQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCP---IDMENI---KSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQ-CLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSLCLACLDYMFSCRNNYKKIFFSFQLDKHLCECPEAELQCTFSNYGCNV 223          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 67.781 bits (164), Expect = 9.927e-12
Identity = 53/225 (23.56%), Postives = 94/225 (41.78%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSD--------NFCTKYSTRKLKCPFHDLDCNL-------------DEMTKESIVKHLQAEYISNRLALIS 840
            P L  +++C +C   L+ A QT CG   C+ CI   + +    CP  +    +  L+       DN   +EI++L V CP + C+  +    +  HL   C F  + C +C   F      KH+  EC  R + C+ C+  M+ +D     LN D           +C     R+     + +DC +             ++M +  + +HLQ E+    + +++
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVDNESLMENQLFP------DNFAKREILSLRVKCPSQGCTETMELRHLERHLVR-CDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALED----KLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQ-EFTQAHMRMMA 276          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 59.3066 bits (142), Expect = 4.708e-9
Identity = 42/142 (29.58%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  241 DRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFEL--CSLKLTFGCMVEHLFYFCRFREISCDK--CTIKFQAKDKDKHEKNECEMRNVRCKYCSKEM 654
            +++KC  C+ +L N  QT CG   CE C+ + L++    C    + C+D +   +  + +DN   +E++ L++ C  E   C   +T G ++ HL   C+F E+SC +  C  K   KD   H +  C+ R   CK+C  ++
Sbjct:   44 EKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQC----MACEDNITKDK--VFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQV 179          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 59.3066 bits (142), Expect = 5.277e-9
Identity = 42/142 (29.58%), Postives = 73/142 (51.41%), Query Frame = 1
Query:  241 DRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFEL--CSLKLTFGCMVEHLFYFCRFREISCDK--CTIKFQAKDKDKHEKNECEMRNVRCKYCSKEM 654
            +++KC  C+ +L N  QT CG   CE C+ + L++    C    + C+D +   +  + +DN   +E++ L++ C  E   C   +T G ++ HL   C+F E+SC +  C  K   KD   H +  C+ R   CK+C  ++
Sbjct:   44 EKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQC----MACEDNITKDK--VFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQV 179          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 70.8626 bits (172), Expect = 7.530e-13
Identity = 52/173 (30.06%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCP 741
            L +R+KC  C S+L N HQT CG   C++CI+S       P CP       D  + K  ++ +DN   +E++NL V C     C+ ++  G   +HL + C F+ + C  + C      KD  +H    C  R  +C YC      +D+   +L    +N C  Y    + CP
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPV------DKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQH-CSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYC-----KRDIVVTNLQDHEENSCPAYP---VSCP 196          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 70.8626 bits (172), Expect = 7.530e-13
Identity = 52/173 (30.06%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCP 741
            L +R+KC  C S+L N HQT CG   C++CI+S       P CP       D  + K  ++ +DN   +E++NL V C     C+ ++  G   +HL + C F+ + C  + C      KD  +H    C  R  +C YC      +D+   +L    +N C  Y    + CP
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPV------DKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQH-CSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYC-----KRDIVVTNLQDHEENSCPAYP---VSCP 196          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 64.6994 bits (156), Expect = 7.065e-11
Identity = 55/210 (26.19%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIH-----LNSDSDNFCTKYSTRKLKCPFHDLDCNL-------------DEMTKESIVKHLQ 804
            P L  +++C +C   L+ A QT CG   C+ CI   + +    CP  +    +++L  +L    DN   +EI++L V CP + C  K+    + +H  + C F  ++C +C   FQ    + H   +C  R V C  C+  M+ ++ K IH     L +    +C     R+     +DLDC               ++M +  + +HLQ
Sbjct:   62 PPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDN----EILLENQL--FPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVH-CEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEE-KEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQ 263          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 63.5438 bits (153), Expect = 1.823e-10
Identity = 55/224 (24.55%), Postives = 95/224 (42.41%), Query Frame = 1
Query:  172 MVESSYQIPAILELYPFEQPS---------LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            M  +S   P  LEL    QP          L  ++ C  C++IL+   Q  CG   C  C+ S L++GP+ C +   + +  + + + +      DNA  +E+ +L   CP + C+ K T           C F    C  C    +  +K+ H + EC  R++ C++C    S+ DL+ +H        C K+       P     C   ++ +E+   H++A
Sbjct:    1 MAAASVTSPGSLELL---QPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLE-VHY-----EVCPKF-------PLTCDGCGKKKIPRETFQDHVRA 208          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 63.1586 bits (152), Expect = 2.251e-10
Identity = 52/194 (26.80%), Postives = 94/194 (48.45%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFE--LCSLKLTFGCMVEHLFYFCRFREISCDK--CTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHL 801
            ++ D++KC  C+ +L N  QT CG   CE C+ + L++    C +    C++ ++  +  + +DN   +EI+ L+V C  E   C+ +LT G ++ HL   C+F E+ C +  C  K   KD   H +  C+ R   C +C  ++    +  +  + D+D  C   S     CP     C++  + +  +  HL
Sbjct:   45 TVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIIKDK--VFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVP---MIKLQKHEDTDCPCVVVS-----CPH---KCSVQTLLRSELSAHL 221          
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.678e-12
Identity = 53/210 (25.24%), Postives = 91/210 (43.33%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHL--------------NSDSDNFCTKYS----TRKLKCPFHDLDCNLDEMTKESIVKHLQ 804
            P L  +++C +C   L+ A QT CG   C+ CI   L +    CP       D  +  E  +  DN   +EI++L+V CP + C+  +    +  HL   C+F  + C +C   F     +KH ++EC  R + C  C   M+ +D+    L              N   +   + YS       + C +++  C  ++M +  + +HLQ
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCPV------DNEILMENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQ-CQFASVECSQCQGSFPKSRLEKHMEHECGRRKIFCDNCGLAMAYEDMSGHELICPLAYVTCEYCQTNLIREQMPSHYSMDCTMAPIPCMYYEFGCT-EKMQRNDLARHLQ 265          
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 1.957e-12
Identity = 54/165 (32.73%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY 717
            L +R+KC  C S+L N HQT CG   C+ CI S       P CP       D  + K  ++ +DN   +E++NL V C     C+ K+  G   +HL   C F+ + C  +KC      KD  +H    C+ R  +C YC      KD+  I+L +  +N C +Y
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPV------DKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHL-QQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCK-----KDVVVINLQNHEENLCPEY 191          
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.720e-12
Identity = 68/251 (27.09%), Postives = 109/251 (43.43%), Query Frame = 1
Query:  160 GIFSMVESSYQIPAILELYPFE-QPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIH-----LNSDSDNFCTKYSTRKLKCPFHDLDCNL-------------DEMTKESIVKHLQAEYISNRLALISTIEFL 855
            G  S V  S      ++ Y  E  P L  +++C +C   L+ A QT CG   C+ CI   + +    CP  +    +++L  +L    DN   +EI++L V CP E C  K+    + EH  + C F  +SC +C   FQ    + H   EC  R V C+ C+  M+ +D K IH     L +    +C     R+     +DLDC               ++M +  + +HLQ    S+   +   ++ L
Sbjct:   39 GTASTVTLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDN----EILLENQL--FPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAH-CEFALMSCPQCQRPFQKCHLNIHILKECPRRQVPCENCAVSMAFED-KEIHEQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPVPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMMAQAVQTL 281          
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 5.654e-12
Identity = 52/173 (30.06%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKP-CPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCP 741
            L +R+KC  C S+L N HQT CG   C++CI+S       P CP       D  + K  ++ +DN   +E++NL V C     C+ ++  G   +HL + C F+ + C  + C      KD  +H    C  R  +C YC      +D+   +L    +N C  Y    + CP
Sbjct:   39 LEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPV------DKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQH-CSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYC-----KRDIVVTNLQDHEENSCPAYP---VSCP 196          
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.910e-12
Identity = 56/210 (26.67%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIH-----LNSDSDNFCTKYSTRKLKCPFHDLDCNL-------------DEMTKESIVKHLQ 804
            P L  +++C +C   L+ A QT CG   C+ CI   L N    CP  +    ++++ K+L    DN   +EI++L V CP   C+  +     +EH    C+F  + C +C   F     DKH ++EC  R   C  C   M+ +D KS H     +   + ++C     R+     + +DC +             ++M + ++  HLQ
Sbjct:   64 PPLESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCPVDN----EILMEKQL--FPDNFAKREILSLRVKCPNLGCTDTMELR-HLEHHLVQCQFASVECSQCQGSFLKLLLDKHMEHECGRRRTFCDNCGLAMAYED-KSGHELICPMAYVTCDYCQTNLIREQMPAHYSMDCTMAPIPCMYCEFGCREKMQRHNLAGHLQ 265          
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Match: D5JG59 (TNF receptor-associated factor-2-like protein A OS=Dugesia japonica OX=6161 GN=TRAF-2A PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.277e-26
Identity = 65/154 (42.21%), Postives = 91/154 (59.09%), Query Frame = 1
Query:  505 MVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY-----------------------STRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDR 897
            MVEH+   C  REI+C+KC IKF AK+K  H+K++CEMR V C YC   M +KDL  IHLN D D  C+KY                         +KL+CPFH  DC +D+MTKE ++KHL  EY ++  +LI+ ++ LE    D+++EL ++
Sbjct:    1 MVEHI-ESCDLREITCEKCGIKFGAKEKANHDKDKCEMRMVNCDYCGITMKSKDLNIIHLNPDRDELCSKYVGICSNNCNETRKVNLKDHLKICPNKKLECPFHQFDCKIDKMTKEKLMKHLDEEYFNHTSSLINKVKDLESKIIDLESELHNQ 153          
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.889e-25
Identity = 74/242 (30.58%), Postives = 118/242 (48.76%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYST-----------------------RKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAEL 888
            ++ D  KC++CQ IL +A QT CGC  C++CI +YL NG K C ++  +C+ V+         D A NKEI  L+V C +E C  + T   +  HL  FC +R   C  C +++  K++  H  NEC +R V C+YC   ++ K+    HL  +S + C KY                         + L+CP H  DC    + K+ + +HL      + L +++ +  LE+ N  M+  +
Sbjct:   24 TINDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVI----TSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHL-DFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCK-QLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERM 259          
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 4.613e-19
Identity = 78/265 (29.43%), Postives = 124/265 (46.79%), Query Frame = 1
Query:  214 YPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY-----------------------STRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLGNISPVMFNRF 939
            +PF   ++ D  KCI+C  +L  A QT CGC  C++C+K Y A G   C +    C D+      +I  DNA+N+EI  L V C F  C        + +HL   C  + I+C  C  +    +  +H + +C MR V C +C +EM   +L  +HLN  ++  C K                        S + + C F ++ CN   MTKE ++KH   E + +   L+  I  ++   ND+ +EL+ +    NI  + F++F
Sbjct:   20 FPF---NISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCLTDG--CGDLG-----NIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDS-CIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCN-RVMTKEDLIKHNNEESLQHSRLLMKEIITMK---NDI-SELKMKTLEFNILKIEFSKF 268          
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Match: A0A1I8G6V3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.685e-16
Identity = 56/183 (30.60%), Postives = 85/183 (46.45%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPK-PCPSKDIECK------DVVLYKELDIKQ-----DNAINKEIINLEVNCPF--ELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCP 741
            LP   +C  C   L NA QT  GC  C+ C+   L    K PCP     C       D V   E+++ Q     D A  +E+  L V CP     CS++L +  M +H+   C +  + C++C      KD  +H  +EC  R   C  CS+ +++ ++++ H N  SD  C ++S R   CP
Sbjct: 1646 LPAHLQCSSCSKPLFNARQTPHGCRLCQACVTGLLHEVEKRPCPGHTEACTLRGEGDDGV---EIEVSQATCFPDMATRREVAKLRVRCPNCDAGCSVQLEWARMDQHVQQSCDWHSLRCEQCKELILKKDMQRHTSSECRHRKETCDLCSQLVTHSEMETSHRNLQSDVCCPRFSAR---CP 1822          
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Match: A0A1I8J887 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.146e-15
Identity = 56/183 (30.60%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPK-PCPSKDIECK------DVVLYKELDIKQ-----DNAINKEIINLEVNCPF--ELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCP 741
            LP   +C  C   L NA QT  GC  C+ C+   L    K PCP     C       D V   E+++ Q     D A  +E+  L V CP     CS++L +  M +H+   C +    C++C      KD  +H  +EC  R   C  CS+ +++ ++++ H N  SD  C ++S R   CP
Sbjct: 1745 LPAHLQCSSCSKPLFNARQTPHGCRLCQACVTGLLHEVEKRPCPGHTEACTLRGEGDDGV---EIEVSQATCFPDMATRREVAKLRVRCPNCDAGCSVQLEWARMDQHVQQSCDWHSFRCEQCKELILKKDMQRHTSSECRHRKETCDLCSQLVTHSEMETSHRNLQSDVCCPRFSAR---CP 1921          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 87.4261 bits (215), Expect = 2.177e-18
Identity = 69/260 (26.54%), Postives = 108/260 (41.54%), Query Frame = 1
Query:  232 SLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQ---DNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY------------------------STRKLKCPFHDLDCNL-------DEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLG 909
            S+  +++C  C+ +L+   Q  CG   C  C K   ++GP PC +   E    + +  L I +   DNA  +EI  L   CP + CS   T           C F  + C+ C +     DKD+H + ECE R + CKYC    S KD+K+       D  C K+                        +  K  C F ++ C          E  + SI++HL+       LA++ST+    R+ +D   E ++ + LG
Sbjct:   35 SMEPKYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYCKVTFSFKDIKA------HDEICQKFPMQCKDCGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQHEHEQSSIIEHLRL-----MLAVLSTV----RVRSDGPGEWQEDSGLG 279          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 67.0106 bits (162), Expect = 1.073e-11
Identity = 49/164 (29.88%), Postives = 73/164 (44.51%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY 717
            L D+  C +CQ IL+   Q  CG   C  C    +++GP+ C +   +DI  +   + K+     DNA  +E+  LE  C  E CS   T           C F  I C  C    +A + ++H + EC  R + CKYC +    K++K+       D  C KY
Sbjct:   28 LEDKHLCNICQKILRRPFQAQCGHRFCSYCFNKTVSSGPQKCSACIKEDIFEEPTSILKQGCAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKA------HDEICPKY 185          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 66.6254 bits (161), Expect = 1.238e-11
Identity = 74/253 (29.25%), Postives = 109/253 (43.08%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANG-PKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCP-FELCSLKLTFGCMVEHLFYFCRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNS------DSDNFCTKYSTR-KLK-----CPFHDLDCNLDEMT-----KESIVK-HLQAEYISNRLALIST----IEFLERINNDM---QAELEDRNWL 906
            L D+F C  C  ++ N HQT CG + C  CI+  L N     CP       D +L K  ++ QDN   +E++NLEV C     CS  +    + +HL   C++  + C    CT     K+   H+++ C  R   C+YC K      L      S         N C     R KLK     CP  + DC   +       K   VK H Q E+  + L L+ +    I+ ++++  D    Q EL++RN L
Sbjct:   41 LDDQFVCPACGGVVFNPHQTGCGHIFCSPCIRVILENNETSKCPF------DGILIKPEEVFQDNCCKRELLNLEVFCTNSPACSQTIPLCNLQDHL-KSCQYEALQCPNSSCTDILLRKNLPDHQRSHCSYRTELCRYCQKPYPVSQLTDHEKTSCPEAEVQCPNKCIHLVKRHKLKDHADECPEQETDCIYKKYGCTVRNKRGQVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLL 286          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 58.9214 bits (141), Expect = 4.085e-9
Identity = 38/148 (25.68%), Postives = 71/148 (47.97%), Query Frame = 1
Query:  244 RFKCILCQSILKNAHQTS-CGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPF--ELCSLKLTFGCMVEHLFYFCRFREISC-DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKS 675
            RF+C LC   ++   Q S CG   C+ C++ +L+ G   CP   +      +Y + +++Q      +I+ L + C    E C        +  H F  C F  I C ++C +K   +D  +H +++C  R V+C++C  E + +  ++
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQ------QILALPIRCIHSEEGCRWTGQMKQLQGH-FSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFEN 155          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 57.3806 bits (137), Expect = 1.349e-8
Identity = 52/214 (24.30%), Postives = 92/214 (42.99%), Query Frame = 1
Query:  229 PSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINN 870
            P L  +++C +C   L++A QT CG   C  CI+  + +  + CP       D  +  E  +  DN   +EI++L V C    C  K+    +  H+ + C+F  + C +C       + ++H   EC  R + C  C++   N       L S  D  C K     + C F    C  ++M +  +  H+Q E+    +  ++ +   + IN 
Sbjct:   62 PPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPV------DNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPH-CKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAE---NIIYAEKQLASHCDTDCLKAP---VACTFSIFGCR-EKMLRNDLALHMQ-EFTQMHMRYMADVLRNQTING 260          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 70.8626 bits (172), Expect = 1.437e-13
Identity = 47/152 (30.92%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  226 QPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLA---NGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLK 672
            +P L  +++C +C   L+   QT CG   C  CI   +     GPK CP       D  +  E  +  DN   +EI++L V CP + C  +     + EH    C + ++ C +C +    +D  KHE+ EC  R V C +C ++M+ KD K
Sbjct:   56 EPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPK-CPV------DNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLR-CEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSK 199          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 65.4698 bits (158), Expect = 8.395e-12
Identity = 55/191 (28.80%), Postives = 89/191 (46.60%), Query Frame = 1
Query:  247 FKCILCQSILKNAHQ-TSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPF--ELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAE 810
            F+C +C   L++  Q T CG   C+ CIK  + N    CP       D +      I  DNA +++I+++++ CP   + C  + T   + +HL   C   E+ C K       + K +    EC  R V C +C+KE+   D+ ++HL S     C  +    + CP   L C   ++TKE++  HL  E
Sbjct:   16 FECPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRRPRCP------LDNLTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYPECSRRLVNCTHCNKEVVFADM-NVHLQS-----CASFP---ISCP---LTCGAKDLTKEALAVHLNQE 188          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 53.9138 bits (128), Expect = 5.700e-8
Identity = 45/152 (29.61%), Postives = 65/152 (42.76%), Query Frame = 1
Query:  253 CILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYF-------CRFREISC--DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIH 681
            C  C+ I+K+A QT+CG   C  CI   L+ GP  C   D+ C   +   E    +D   ++EI+ L V+C      +    GC  E            C F  ISC   +C  K       +H +NEC+ R   C YC + +    +K  H
Sbjct:   24 CAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQC---DV-CGSTITKPE--TFRDKFADREILELHVHC------VNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHH 163          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 50.447 bits (119), Expect = 7.907e-7
Identity = 40/150 (26.67%), Postives = 69/150 (46.00%), Query Frame = 1
Query:  220 FEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFE---LCSLKLTFGCMVEHLFYFCRFREISC-DKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMS 657
            F  P L  +++C +C   L++  QT CG   C  CI+  + +    CP  +    +  LY+      DN   +E+++  V C  +    C+ K     + EHL   C   + +C ++C    Q K+ DKH    C  R+V C +C  +++
Sbjct:   47 FFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYR------DNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHL-KGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVT 189          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 48.521 bits (114), Expect = 3.365e-6
Identity = 60/249 (24.10%), Postives = 104/249 (41.77%), Query Frame = 1
Query:  220 FEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS-----------KDIECKDVVL---------------YKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAEL 888
            F +P  P +++C +C + LK+  QT CG   CE C++  L  GP  CP            KD+ C+  +L                K+L   +++  N E   ++ + P   C  K+    +  HL   C F+   C  C  +  A   + H +  CE   V C +C  E   +D     L     N C +    +L C F    C+  + T+E++  H + +   +   L++  +  E+  ++M A+L
Sbjct:   11 FVEPLDP-KYRCPVCGNALKHPVQTPCGHRFCEGCLEPIL-RGPSKCPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPG--CQEKVAKRDLEAHL-ERCEFKPSDCQYCLQRIPAASMEDHLQT-CEKHPVVCPHCGAEGICRD----ELLHHQTNICEQA---ELPCSFAKHGCHF-KGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKL 245          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Match: EDO48004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK9])

HSP 1 Score: 47.7506 bits (112), Expect = 6.448e-6
Identity = 40/137 (29.20%), Postives = 67/137 (48.91%), Query Frame = 1
Query:  223 EQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRC 633
            ++PS P  F C LC+ + K+   TSCG   C+ CI   +A G + CP  D +   VV         + A+ ++I  L ++C +  C ++   G +VEH        E+    C +K +  ++ +HEKN C+    +C
Sbjct:  125 DKPS-PKLF-CPLCRRVFKDPVITSCGHTFCQACI---MARGVEKCPLDDNKLSIVV--------ANLAVAEQIGELYIHCKYG-CRIRANGGGVVEH--------EVDSSGCPMKTKIINRREHEKN-CQYAPTQC 238          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 81.6481 bits (200), Expect = 1.697e-16
Identity = 59/217 (27.19%), Postives = 93/217 (42.86%), Query Frame = 1
Query:  172 MVESSYQIPAILELYPFEQPSLP--DRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            M   S+   + L   P    S+P  D++KC  C  +L+   Q  CG   C  C +   ++GPKPC +   ++I  + + +    +   DNA  +EI +L   C  + C    +           C F +I C+ C      KDKD+H   ECE R + CKYC    + KD+K+       D  C K+       P    DC   ++ +E    H ++
Sbjct:    1 MARISWDSLSSLPGIPLSVLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIKA------HDEICQKF-------PLQCKDCGKKKIPREKFNDHAKS 204          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 81.2629 bits (199), Expect = 2.028e-16
Identity = 61/221 (27.60%), Postives = 93/221 (42.08%), Query Frame = 1
Query:  172 MVESSYQIPAILELYPFEQPSLP--DRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKE-------LDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            M   S+   + L   P    S+P  D++KC  C  +L+   Q  CG   C  C +   ++GPKPC +    C+   +Y+E        +   DNA  +EI +L   C  + C    +           C F +I C+ C      KDKD+H   ECE R + CKYC    + KD+K+       D  C K+       P    DC   ++ +E    H ++
Sbjct:    8 MARISWDSLSSLPGIPLSVLSVPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQA----CRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIKA------HDEICQKF-------PLQCKDCGKKKIPREKFNDHAKS 211          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 73.1738 bits (178), Expect = 1.141e-13
Identity = 68/239 (28.45%), Postives = 103/239 (43.10%), Query Frame = 1
Query:  169 SMVESSYQIPAILELYPFE-QPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKL---------------TFGC-----------MVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQ 804
            SM  SS Q  A L+ Y  E  P L  +++C +C   L+NA QT CG   C+ CI+  + +  + CP       D  +  E  +  DN   +EI++L V CP   C  K+               T  C           + EH    C  R +SC  C   F  ++++ HE+ +C   +V C+YC  EM   DL    + S  D  C K     + C F    C  + M + ++ +H+Q
Sbjct:   49 SMGSSSLQAAAPLQGYDVEFDPPLESKYECPICLMALRNAIQTRCGHRFCKSCIEKSIRDTGQRCPV------DNEMLSEDQLFPDNFAKREILSLTVRCPNSDCGEKMELRHLEKHLAQCQFATVPCSQCQQPVRKSYLEEHATVECPRRPMSCPDCVAVFVYEEREMHEQ-QCPFASVMCQYC--EM---DLIRDQMESHCDTDCPKA---PIACTFSIFGCK-ERMQRHNLAQHMQ 271          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 65.0846 bits (157), Expect = 4.715e-11
Identity = 51/193 (26.42%), Postives = 83/193 (43.01%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQ 804
            L D+  C  C+ IL+   Q  CG   C  C    +++GP+ C +   +D+  +   + K+     DNA  +E+  L   CP E C+   T           C F  I C  C    +A ++++H + EC  R + CKYC +    K++K+       D  C KY       P     C   ++ +E  V H++
Sbjct:   29 LEDKHLCNSCEKILRRPLQAQCGHRFCCFCFNRTVSSGPQKCSACIKEDLFEEPTSILKQGGAFHDNAARREVEALAAVCPNEGCTWTGTVKEYEASHEGSCDFTIIMCPSCKELMRANEQERHNERECPERTLNCKYCKEPFLLKNIKA------HDEICPKY-------PMMCEGCAKKKIPREKYVDHIK 208          
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 64.6994 bits (156), Expect = 5.304e-11
Identity = 56/215 (26.05%), Postives = 91/215 (42.33%), Query Frame = 1
Query:  235 LPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPS---KDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKS---------------------IHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQA 807
            L D+  C  C +IL+   Q  CG   C  C    ++NGP+ C +   ++I  +   + K+     DNA+ +E+  L  +C  E C  K T           C F  I C  C  + +  ++++H + EC  R + CKYC +    K++K+                          D   FC+K+ T    C FH + C++  + KE I  H +A
Sbjct:   28 LEDKHLCNCCHNILRRPIQAQCGHRFCSYCFNRTVSNGPQKCNACIKEEIFEEPTSILKQGCAFPDNAVRREVEGLSADCINENCPWKGTIKEYELDHEGKCEFMIIPCPSCKERIRFSEQERHSERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMICEGCAKKKIPREKYVDHIKFCSKFRT---PCRFHVVGCDMS-VEKEKIHDHERA 238          
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Match: SMESG000027151.1 (SMESG000027151.1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 271/271 (100.00%), Postives = 271/271 (100.00%), Query Frame = 1
Query:  172 MVESSYQIPAILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLGNISPVMFNRFGKSQRPNCRRSSLPM 984
            MVESSYQIPAILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLGNISPVMFNRFGKSQRPNCRRSSLPM
Sbjct:    1 MVESSYQIPAILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLGNISPVMFNRFGKSQRPNCRRSSLPM 271          
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Match: SMESG000027153.1 (SMESG000027153.1)

HSP 1 Score: 283.493 bits (724), Expect = 1.222e-91
Identity = 147/268 (54.85%), Postives = 188/268 (70.15%), Query Frame = 1
Query:  172 MVESSYQIPAILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY-----------------------STRKLKCPFHDLDCNLDEMTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWL 906
            M +S  QIP ILELY F  PSL DR KC+LCQ ILKNA QTSCGC  CE CIKSYLANGPKPCPSK I+C++V+L+ + DI  DNA NKEI +L+V CPF+LCS ++    MVEH+   C FREISC+KC  K QAKDK+ H+KN+CEMR ++C+YC +EMS +DLKSIHLNSD ++FC KY                       S +KL+CPFH L+CN+D+MTKE+++KHL  EY+S+   LIS I+ +E    ++  ELE++  L
Sbjct:    1 MSQSLSQIPTILELYEFNFPSLSDRLKCVLCQRILKNAKQTSCGCKACENCIKSYLANGPKPCPSKQIDCENVMLHMDEDINADNATNKEIASLKVKCPFKLCSSEMPLRNMVEHI-NSCEFREISCNKCQSKLQAKDKESHDKNKCEMRKLKCEYCLEEMSFRDLKSIHLNSDREDFCVKYTAICPNNCDVHTKVCLKEHLKLCSKKKLECPFHSLNCNVDKMTKENLMKHLNEEYVSHTSNLISKIKDMENTIKNLTDELENQKVL 267          
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.133e-41
Identity = 91/246 (36.99%), Postives = 141/246 (57.32%), Query Frame = 1
Query:  202 ILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY---------STRKLKCPFHDLDC-NLDEMTKESIVKHLQAEYISNRLA-LISTIEFLERINNDMQAELEDRNWL 906
            +L  Y  + P+L    KCI+C S+LKNA QT CGC  CE CI  YL+ GPK CP+K  EC + +L  + DI  DNA NKEI+NL++ CPF+ C+   T   + +H+   C +R+++CD C  +  AK+K KH   ECEMR  +C++C K M+ K L  +HLN+  +  C++Y          T++L    H   C N     +     H+Q E+ + +L+ L+  I  L + + D+  +LE+++ +
Sbjct:   10 LLTNYSLDIPNLSSSLKCIICSSLLKNAKQTKCGCKVCENCINEYLSKGPKDCPNK--ECLNELLSIDKDIYNDNATNKEILNLKIACPFKGCAQLETVFKISQHV-KSCEYRDVTCDPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKELNLKLHLETCLNRKSDDQNDTNYHIQ-EFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVI 251          
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 152.14 bits (383), Expect = 1.379e-41
Identity = 91/246 (36.99%), Postives = 141/246 (57.32%), Query Frame = 1
Query:  202 ILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKY---------STRKLKCPFHDLDC-NLDEMTKESIVKHLQAEYISNRLA-LISTIEFLERINNDMQAELEDRNWL 906
            +L  Y  + P+L    KCI+C S+LKNA QT CGC  CE CI  YL+ GPK CP+K  EC + +L  + DI  DNA NKEI+NL++ CPF+ C+   T   + +H+   C +R+++CD C  +  AK+K KH   ECEMR  +C++C K M+ K L  +HLN+  +  C++Y          T++L    H   C N     +     H+Q E+ + +L+ L+  I  L + + D+  +LE+++ +
Sbjct:   10 LLTNYSLDIPNLSSSLKCIICSSLLKNAKQTKCGCKVCENCINEYLSKGPKDCPNK--ECLNELLSIDKDIYNDNATNKEILNLKIACPFKGCAQLETVFKISQHV-KSCEYRDVTCDPCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKELNLKLHLETCLNRKSDDQNDTNYHIQ-EFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVI 251          
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Match: SMESG000027149.1 (SMESG000027149.1)

HSP 1 Score: 127.102 bits (318), Expect = 2.367e-34
Identity = 78/215 (36.28%), Postives = 113/215 (52.56%), Query Frame = 1
Query:  220 FEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEKCIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPFELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMRNVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYST-----------------------RKLKCPFHDLDCN-LDEMTKESIV 792
            FE  + PDR KC LC  +L+NA QT CGC  C +CI+ YLA+G + CPS    C + VL  E  +  D A  +EI  LEV CP +LC  +     +  H+   C +R I C KC  K  A  +  H  N CEMR V C+YC + +   ++  IHLN D++  C  Y +                       +K KCPF+ ++CN +D+++KE+++
Sbjct:    8 FEFTNAPDRCKCKLCFKVLRNAKQTECGCRVCGQCIQEYLASGSRKCPS----CDNYVLLNENKLFDDKATVREINQLEVVCPLDLCQFRSKLQSIGVHM-NSCEYRVIDCRKCKQKITAIHEQDHNINLCEMRIVTCEYCQRSIKLNEMIPIHLNPDNEEMCDDYVSICPNNCNQKQQINIKRHLLECINKKKKCPFNQINCNTIDKLSKENLL 217          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF54.076e-1332.73TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.076e-1332.73TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.076e-1332.73TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF65.467e-1224.79TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF65.467e-1224.79TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.119e-1628.14Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.119e-1628.14Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.420e-1628.14Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2a1.102e-1127.44Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf68.311e-1124.52TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc12a11.181e-1430.29solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.311e-1230.57solute carrier family 12 member 1 [Source:Xenbase;... [more]
egf9.927e-1223.56epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
ssh24.708e-929.58slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh25.277e-929.58slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf57.530e-1330.06TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf57.530e-1330.06TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf67.065e-1126.19TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf21.823e-1024.55TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf32.251e-1026.80TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJN2|TRF6B_XENLA1.678e-1225.24TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|O00463|TRAF5_HUMAN1.957e-1232.73TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q3ZCC3|TRAF6_BOVIN2.720e-1227.09TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|P70191|TRAF5_MOUSE5.654e-1230.06TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q3MV19|TRF6A_XENLA8.910e-1226.67TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG591.277e-2642.21TNF receptor-associated factor-2-like protein A OS... [more]
T1DBK63.889e-2530.58TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D5JG604.613e-1929.43TNF receptor-associated factor-2-like protein B OS... [more]
A0A1I8G6V34.685e-1630.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J8871.146e-1530.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b2.177e-1826.54TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a1.073e-1129.88TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf51.238e-1129.25TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf4a4.085e-925.68TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf61.349e-824.30TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf61.437e-1330.92TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO459158.395e-1228.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388735.700e-829.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487737.907e-726.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494643.365e-624.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480046.448e-629.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.697e-1627.19TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b2.028e-1627.60TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf61.141e-1328.45TNF receptor associated factor 6 [Source:NCBI gene... [more]
ENSORLT00000020861.24.715e-1126.42TNF receptor-associated factor 2 [Source:NCBI gene... [more]
unm_sa8085.304e-1126.05TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor-2-like protein A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027151.10.000e+0100.00SMESG000027151.1[more]
SMESG000027153.11.222e-9154.85SMESG000027153.1[more]
SMESG000027123.11.133e-4136.99SMESG000027123.1[more]
SMESG000027123.11.379e-4136.99SMESG000027123.1[more]
SMESG000027149.12.367e-3436.28SMESG000027149.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006046 ID=SMED30006046|Name=TNF receptor-associated factor-2-like protein A|organism=Schmidtea mediterranea sexual|type=transcript|length=1150bp
CTTTTCCTTAACCATTTTGAGTTTTAATATGAATATTACTAAACCCGAAT
CAACATTATTACGTCATTGTTAATTGATTTTATGAAAATATCTTAACGTT
GTTCTTAAAGAAATAATATTTACCTGACTAATTTAGGTATAACTCTGAAA
TCGAAAATTGGAATTTTCTCTATGGTTGAATCATCATATCAAATTCCAGC
AATTTTAGAGTTATATCCATTTGAGCAACCTTCGCTGCCAGATCGATTTA
AATGTATTCTGTGCCAATCAATTTTGAAAAATGCCCATCAAACCTCTTGT
GGATGTTTATGTTGTGAGAAGTGCATCAAATCCTATCTGGCAAACGGACC
AAAGCCATGCCCAAGTAAAGACATTGAATGCAAAGATGTCGTTTTGTACA
AAGAATTAGACATTAAGCAGGACAATGCAATAAATAAAGAAATTATCAAT
TTGGAAGTGAACTGTCCGTTTGAATTATGTTCGTTGAAGCTTACTTTCGG
ATGCATGGTTGAGCACCTTTTTTACTTTTGCCGATTCCGTGAGATTTCAT
GTGATAAATGTACCATCAAATTCCAAGCTAAAGATAAAGACAAACATGAG
AAAAATGAATGCGAAATGAGAAATGTGAGATGCAAATATTGCTCAAAAGA
AATGAGCAATAAAGATTTGAAGTCAATTCATTTGAATTCTGACAGCGACA
ATTTCTGCACAAAATATTCCACAAGGAAACTTAAATGTCCTTTTCATGAT
CTAGATTGTAACCTGGATGAAATGACCAAAGAAAGCATAGTAAAGCATTT
GCAAGCGGAATATATCAGCAACAGGTTAGCTTTGATATCTACTATAGAGT
TCTTGGAACGCATAAACAATGACATGCAGGCGGAATTAGAGGACAGAAAT
TGGTTGGGAAATATTTCCCCAGTAATGTTTAATCGCTTCGGGAAATCTCA
AAGGCCCAATTGCAGACGTAGTAGCCTTCCAATGTAATTCGTCTACATCC
AACCTTTCATATTTATTCCATTGTTTTTAATACCTTAGTCCGTTAAATTT
TTTGATATTTGTTTTATGATTTTTGATAAAAATTATCGAATTTTGAGTCA
TTTTTAATCGTTTTATTGCAACAATGTTTTACCAAACATTATGACCAAAG
back to top

protein sequence of SMED30006046-orf-1

>SMED30006046-orf-1 ID=SMED30006046-orf-1|Name=SMED30006046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=272bp
MVESSYQIPAILELYPFEQPSLPDRFKCILCQSILKNAHQTSCGCLCCEK
CIKSYLANGPKPCPSKDIECKDVVLYKELDIKQDNAINKEIINLEVNCPF
ELCSLKLTFGCMVEHLFYFCRFREISCDKCTIKFQAKDKDKHEKNECEMR
NVRCKYCSKEMSNKDLKSIHLNSDSDNFCTKYSTRKLKCPFHDLDCNLDE
MTKESIVKHLQAEYISNRLALISTIEFLERINNDMQAELEDRNWLGNISP
VMFNRFGKSQRPNCRRSSLPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001293Znf_TRAF
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 129..199
e-value: 4.7E-7
score: 31.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 15..128
e-value: 1.9E-13
score: 52.4
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 16..233
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 16..233
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 17..65
IPR001293Zinc finger, TRAF-typePROSITEPS50145ZF_TRAFcoord: 115..167
score: 9.778