Tektin-1

Overview
NameTektin-1
Smed IDSMED30006033
Length (bp)1453
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin-1 (SMED30006033) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin-1 (SMED30006033) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin-1 (SMED30006033) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin-1 (SMED30006033) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006033

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30006033SMESG000065257.1 DN309082.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30006033SMESG000065257.1 DN309082.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
reproductive organSMED30006033SMESG000065257.1 Contig21688newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006033SMESG000065257.1 Contig21688uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006033SMESG000065257.1 Contig54410newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30006033SMESG000065257.1 Contig54410uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30006033SMESG000065257.1 PL08010A1B05ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30006033SMESG000065257.1 Contig3817_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin-1 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 220.32 bits (560), Expect = 3.755e-66
Identity = 138/409 (33.74%), Postives = 236/409 (57.70%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPN---------SDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVK 1317
            MA+++ PP  F+  EW    + ++  A+ +R  +ERL+ ++ R  DE ++ T K+  DVNKKL QR+++V++W  E + K ++L   TD L     R++KA   +K+ LH T+ C   RE R GIDL  D V   L KE E  + ++ LL ++ EEA EQ+R+NR A + L +D  +K  +L ID+ C         +N   PN          +PN   + L+DW+  ++ N+   +K+R NS  +++++D IL Q AND+ +  +  + +F+  + + KD + K  +H+ +V++EI + E ++  L+K +  +     +A  RL  R  R   E C D    RL +E+ EI  ++ +LK+ +   + +LKGL R+QL L+E+IQ K N+I+IDEV+C  +R+++ ++
Sbjct:    1 MAKLLQPPPKFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICF-------SLNNNSPNIRYSENAVRIEPNS--VSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPLR 400          
BLAST of Tektin-1 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 163.31 bits (412), Expect = 4.284e-44
Identity = 113/382 (29.58%), Postives = 193/382 (50.52%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRET 1305
            +W +     ++ +   R ++E+L  D  R   +  ++T KT  D  + L +R++D+ +W  E   + DE+  ET+ L     R+++A    +  L   + C  +RE R GIDL  D+V   L  E++T     + +    ++A  QL  NR + H L +D  +K+ +  ID+ C   +     +         +  +   + W   T+DNI   + ER  S  +R  I+ +L   AN+M     + N+SF  RI+E  D K K + H+ + LQEI  TE ++E +KK +  K A+L +A+ RL +R  R   E C D   +RL  E+ E+   I  L++R+ D E  L+ L   +  LE D+  K+NS++ID+  C  +R++
Sbjct:   98 DWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKS 479          
BLAST of Tektin-1 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 163.31 bits (412), Expect = 4.284e-44
Identity = 113/382 (29.58%), Postives = 193/382 (50.52%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRET 1305
            +W +     ++ +   R ++E+L  D  R   +  ++T KT  D  + L +R++D+ +W  E   + DE+  ET+ L     R+++A    +  L   + C  +RE R GIDL  D+V   L  E++T     + +    ++A  QL  NR + H L +D  +K+ +  ID+ C   +     +         +  +   + W   T+DNI   + ER  S  +R  I+ +L   AN+M     + N+SF  RI+E  D K K + H+ + LQEI  TE ++E +KK +  K A+L +A+ RL +R  R   E C D   +RL  E+ E+   I  L++R+ D E  L+ L   +  LE D+  K+NS++ID+  C  +R++
Sbjct:   98 DWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKS 479          
BLAST of Tektin-1 vs. Ensembl Human
Match: TEKT5 (tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554])

HSP 1 Score: 147.517 bits (371), Expect = 2.102e-38
Identity = 111/383 (28.98%), Postives = 191/383 (49.87%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            +W Q  +++ R AE  R  A RL +D+ R   + D+ T++  +   + L QR+ D+ +W  E   + D L  E   L T   R++ A   V   L     C  +RE R GIDL  D+V  NL +E++  +   + + K  +    Q+R NR A H L +D  +K ++  ID  C + +     I+        +  +   + W   +NDNI + +  R NS  +R   + + + +++ M R   +TN++F  RISE+ D K K +  + + LQEI   E ++  L++ + +K   L +A+ RL  R  R   E C D P ++L  E+  I   +  LK R+ + +  L+ L   +  LE ++  K+N++ ID+  C G+R+T 
Sbjct:   93 DWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTF 475          
BLAST of Tektin-1 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 144.436 bits (363), Expect = 1.444e-37
Identity = 105/384 (27.34%), Postives = 190/384 (49.48%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIR 1299
            ++  EW Q+   R+  A  +R  +ER  +++ +   ET     +T  D  + + +R+ D   W  E +++ + L  ET++L     R+++A  A +     T      RE R   +L  D V   L KE E   N+ +LL ++  +A  Q+RLNR+       D  +K  +  ID  C       +++   P ++   +     +     T DN+   ++ER+ S N+R ++D IL+  + D+    +  N++F +R  EL+D + K   H+++ L+EI + E ++  LK+ +  K A L +A+ RL  R+ R   E C D    RL  E+ E+ + +  L++++++ E  L+ L    + LE+DI   +NS+FID   C   R
Sbjct:   39 YLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHR 422          
BLAST of Tektin-1 vs. Ensembl Celegans
Match: R02E12.4 (pep chromosome:WBcel235:X:4005314:4007634:1 gene:WBGene00019828.1 transcript:R02E12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02E12.4)

HSP 1 Score: 68.5514 bits (166), Expect = 3.307e-12
Identity = 66/318 (20.75%), Postives = 141/318 (44.34%), Query Frame = 1
Query:  256 ETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGI-DLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSD--------PNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRI 1182
            E + R  +      ++L QR+ D+KYW+ E +++  ++ +E D L     R+              ++C   R  +  + D  +D V   L+KE E   + +K + +  E    QL +N+ A   L +D   K+ ++++D+  +      +      P+ D        P + + +  +W+  T +N++   + R++S  +   +   ++++A+ +           +  +   ++ K      +N   +EIKN + ++E++   L  K   L +A  R  QR LR   E C D+    LH+E+  +K   + L+ ++
Sbjct:   23 EANMRAARMQGQTTQQLMQRVKDLKYWSGEIDRELADVKEEHDDLLRCYRRLQLCLDITGRSSRCNESCLAVRRKKVQVGDHTSDRVDMELHKEKELMTDTMKQMKEIGERVERQLEVNQSARKNLLRDLTLKQEAISLDHKSVAIGADGTKTVIRTPDGDRLDFREGAPLQRMSEYSEWIENTGNNLNYAARARVHSRKIGQKLCQSIREMAHQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGAIEEISFSLRQKSGPLQVALSRQNQRGLRPGIELCNDKAQHALHQELMMLKGTFLSLENQL 340          
BLAST of Tektin-1 vs. Ensembl Fly
Match: Tektin-C (gene:FBgn0035638 transcript:FBtr0331521)

HSP 1 Score: 136.346 bits (342), Expect = 3.525e-35
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = 1
Query:  133 APPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKD-YLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQ--LDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
             PP+ +   +W  + +++FR    + + AER++ ++ R  DET   T     +V   + +R  ++++  DE  ++      E + L T   R+      +KD  L   K C + RE R G+DLC D+V  +L +E++  +    L D + +EA EQ+R  R A + L QD   K  SLAID   L  K    D+       D +K   Q  L +W   T +N+    K  +++  +R+ ID +L+QV  DM+   + TN +F +RISE K  K   E      +  I   + +M +L+K +  K   +TL + RL  R  R   E   D     L+ E+  +K  + +L +++ +++  ++ L   Q+  EE+I  K+N+  IDEV C  +R+ L  ++F
Sbjct:   26 CPPR-YSEEDWDYNNKIKFRITCDQEKLAERIVEESRRVVDETKDTTKNWQREVEHHMRERTSEIRFLVDELNRQKKTAALEDEALNTYRNRVLNCIEFLKDKSLAICKQCLILREGRIGVDLCDDEVDRSLRRELKVIKGCQGLADAALKEAEEQIRKLRAAIYLLDQDLAAKDKSLAIDEKNLKLKEFQHDL---AKGQDLSKQHCQFSLTEWQAQTYENLEANAKALVSAGQLRAYIDLLLKQVCEDMQNQTDRTNEAFERRISETKHVKQCLENKHKDTMDHIHQVQRNMTELEKEMMDKQRAITLCQTRLSNRAHRPGLELTCDMVQDALYNELQALKASVCKLNQKLNENKASMRYLMHVQVMQEEEINIKANTCKIDEVDCMTLRQALKYQTF 421          
BLAST of Tektin-1 vs. Ensembl Fly
Match: Tektin-C (gene:FBgn0035638 transcript:FBtr0331522)

HSP 1 Score: 136.346 bits (342), Expect = 3.525e-35
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = 1
Query:  133 APPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKD-YLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQ--LDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
             PP+ +   +W  + +++FR    + + AER++ ++ R  DET   T     +V   + +R  ++++  DE  ++      E + L T   R+      +KD  L   K C + RE R G+DLC D+V  +L +E++  +    L D + +EA EQ+R  R A + L QD   K  SLAID   L  K    D+       D +K   Q  L +W   T +N+    K  +++  +R+ ID +L+QV  DM+   + TN +F +RISE K  K   E      +  I   + +M +L+K +  K   +TL + RL  R  R   E   D     L+ E+  +K  + +L +++ +++  ++ L   Q+  EE+I  K+N+  IDEV C  +R+ L  ++F
Sbjct:   26 CPPR-YSEEDWDYNNKIKFRITCDQEKLAERIVEESRRVVDETKDTTKNWQREVEHHMRERTSEIRFLVDELNRQKKTAALEDEALNTYRNRVLNCIEFLKDKSLAICKQCLILREGRIGVDLCDDEVDRSLRRELKVIKGCQGLADAALKEAEEQIRKLRAAIYLLDQDLAAKDKSLAIDEKNLKLKEFQHDL---AKGQDLSKQHCQFSLTEWQAQTYENLEANAKALVSAGQLRAYIDLLLKQVCEDMQNQTDRTNEAFERRISETKHVKQCLENKHKDTMDHIHQVQRNMTELEKEMMDKQRAITLCQTRLSNRAHRPGLELTCDMVQDALYNELQALKASVCKLNQKLNENKASMRYLMHVQVMQEEEINIKANTCKIDEVDCMTLRQALKYQTF 421          
BLAST of Tektin-1 vs. Ensembl Fly
Match: Tektin-C (gene:FBgn0035638 transcript:FBtr0077115)

HSP 1 Score: 136.346 bits (342), Expect = 3.525e-35
Identity = 116/400 (29.00%), Postives = 198/400 (49.50%), Query Frame = 1
Query:  133 APPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKD-YLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQ--LDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
             PP+ +   +W  + +++FR    + + AER++ ++ R  DET   T     +V   + +R  ++++  DE  ++      E + L T   R+      +KD  L   K C + RE R G+DLC D+V  +L +E++  +    L D + +EA EQ+R  R A + L QD   K  SLAID   L  K    D+       D +K   Q  L +W   T +N+    K  +++  +R+ ID +L+QV  DM+   + TN +F +RISE K  K   E      +  I   + +M +L+K +  K   +TL + RL  R  R   E   D     L+ E+  +K  + +L +++ +++  ++ L   Q+  EE+I  K+N+  IDEV C  +R+ L  ++F
Sbjct:   26 CPPR-YSEEDWDYNNKIKFRITCDQEKLAERIVEESRRVVDETKDTTKNWQREVEHHMRERTSEIRFLVDELNRQKKTAALEDEALNTYRNRVLNCIEFLKDKSLAICKQCLILREGRIGVDLCDDEVDRSLRRELKVIKGCQGLADAALKEAEEQIRKLRAAIYLLDQDLAAKDKSLAIDEKNLKLKEFQHDL---AKGQDLSKQHCQFSLTEWQAQTYENLEANAKALVSAGQLRAYIDLLLKQVCEDMQNQTDRTNEAFERRISETKHVKQCLENKHKDTMDHIHQVQRNMTELEKEMMDKQRAITLCQTRLSNRAHRPGLELTCDMVQDALYNELQALKASVCKLNQKLNENKASMRYLMHVQVMQEEEINIKANTCKIDEVDCMTLRQALKYQTF 421          
BLAST of Tektin-1 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070051)

HSP 1 Score: 125.561 bits (314), Expect = 8.669e-31
Identity = 101/388 (26.03%), Postives = 179/388 (46.13%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            EW  +   ++  + + R  +ER+ NDA R   ETD +      D  ++L +RI D+ +W +E   + ++L  E   +     +  KA   ++  LH  + C  +RE R G +   D V   L  EI    N    L    E+  +Q    R A H L  D  +K++SL ID+ C     H   I         +  +   + W   +++++   + ER     +RS    ++  VA  +      TN +F +R  E+ + K + + H+ +V QE+ + E  +  L+K +  K   L +A+ RL  R+ R   E C D    RL +E+ +I+  +  L  ++++ E   +GL + +  LE D++ K N++FID   C  +R +  V + 
Sbjct:  130 EWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNL 517          
BLAST of Tektin-1 vs. Ensembl Fly
Match: CG32820 (gene:FBgn0052820 transcript:FBtr0070054)

HSP 1 Score: 125.561 bits (314), Expect = 8.669e-31
Identity = 101/388 (26.03%), Postives = 179/388 (46.13%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            EW  +   ++  + + R  +ER+ NDA R   ETD +      D  ++L +RI D+ +W +E   + ++L  E   +     +  KA   ++  LH  + C  +RE R G +   D V   L  EI    N    L    E+  +Q    R A H L  D  +K++SL ID+ C     H   I         +  +   + W   +++++   + ER     +RS    ++  VA  +      TN +F +R  E+ + K + + H+ +V QE+ + E  +  L+K +  K   L +A+ RL  R+ R   E C D    RL +E+ +I+  +  L  ++++ E   +GL + +  LE D++ K N++FID   C  +R +  V + 
Sbjct:  130 EWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNL 517          
BLAST of Tektin-1 vs. Ensembl Zebrafish
Match: tekt1 (tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99])

HSP 1 Score: 196.823 bits (499), Expect = 1.391e-57
Identity = 133/402 (33.08%), Postives = 222/402 (55.22%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            M++++ PP  F+  EW    +  +R++E  R+ +E+L  + +R  +E ++   +   D  K+L +RI D+K+W  E  +K +++ +E + L    +R++KA  +  +    T  C   R+ R  IDL  D+V   L KE E  E V+ LL ++ E+  EQ+RL R   + L +D  +K  +  ID++C        D+N+   +   +   +  ++W  L N NI   EKE+ NS ++R+++D +L+Q A DM R  E T  +F  RI E K  K + E  +N +L EI N E + + L+  +  K A L +A+ RL  R+ R   E C D P I+L  +I E+   + +L + +   E +LK L   QL LEE+IQ K+NS++IDEVIC  +R+ + ++SF
Sbjct:    1 MSRLMGPPDRFLPSEWKHANQEHYRSSEAGRKHSEKLTAECERLIEECNKSNKRMQHDTQKRLERRIQDIKFWRQELVQKFEQMVQEIETLIIYKSRVEKALESCSEPFQVTLQCLAERQKRVAIDLVHDEVEEELLKEKEVVEGVMVLLQRTLEQINEQIRLIRSVKYYLEKDLQDKFQAEHIDDFCSLLTNTSPDLNEGNSSFKYSGAAVTPEEWESLCNLNISKAEKEKNNSLSLRALVDSLLEQTARDMRRQYETTGRAFDLRIEETKTAKEQLENQLNELLAEIANQEKNQDALRLAVAEKEAPLKVAQTRLSTRSQRPNVELCHDPPQIQLLAQIKELTNHVQRLSEALELSESELKALAYNQLRLEEEIQVKTNSLYIDEVICHQLRQHITIQSF 402          
BLAST of Tektin-1 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 182.185 bits (461), Expect = 2.486e-51
Identity = 128/388 (32.99%), Postives = 203/388 (52.32%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQL-DDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            ++  +W +  +  +R +E  R SAERL  D  R   + ++ T +T D  +K + +R++D+ +W  E   + D +  E   L     R+++A A  +  L   + C  +RE R  IDL  DDV  +L KE++  ++  + + +  E A  QL  NR A H L +D  +K  +  ID+ C   + + SD        D   P I L D W   T+DNI + + ER  S  +R  I+ +L   +N+M       NVSF  RISE  DTK   + H+ + LQEI  TE  +E LKK +  K   L +A+ RL +R  R   E C D PH RL  E+ EI+  I +L+ R+++ E  L+ L + ++ LE D+  K+NS+F+D+  C  +R++ 
Sbjct:   77 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLR-NTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 463          
BLAST of Tektin-1 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 182.185 bits (461), Expect = 2.816e-51
Identity = 128/388 (32.99%), Postives = 203/388 (52.32%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQL-DDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            ++  +W +  +  +R +E  R SAERL  D  R   + ++ T +T D  +K + +R++D+ +W  E   + D +  E   L     R+++A A  +  L   + C  +RE R  IDL  DDV  +L KE++  ++  + + +  E A  QL  NR A H L +D  +K  +  ID+ C   + + SD        D   P I L D W   T+DNI + + ER  S  +R  I+ +L   +N+M       NVSF  RISE  DTK   + H+ + LQEI  TE  +E LKK +  K   L +A+ RL +R  R   E C D PH RL  E+ EI+  I +L+ R+++ E  L+ L + ++ LE D+  K+NS+F+D+  C  +R++ 
Sbjct:   92 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLR-NTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 478          
BLAST of Tektin-1 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 182.185 bits (461), Expect = 2.816e-51
Identity = 128/388 (32.99%), Postives = 203/388 (52.32%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQL-DDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            ++  +W +  +  +R +E  R SAERL  D  R   + ++ T +T D  +K + +R++D+ +W  E   + D +  E   L     R+++A A  +  L   + C  +RE R  IDL  DDV  +L KE++  ++  + + +  E A  QL  NR A H L +D  +K  +  ID+ C   + + SD        D   P I L D W   T+DNI + + ER  S  +R  I+ +L   +N+M       NVSF  RISE  DTK   + H+ + LQEI  TE  +E LKK +  K   L +A+ RL +R  R   E C D PH RL  E+ EI+  I +L+ R+++ E  L+ L + ++ LE D+  K+NS+F+D+  C  +R++ 
Sbjct:   92 YMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLR-NTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 478          
BLAST of Tektin-1 vs. Ensembl Zebrafish
Match: tekt4 (tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98])

HSP 1 Score: 137.887 bits (346), Expect = 2.716e-35
Identity = 105/376 (27.93%), Postives = 187/376 (49.73%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVIC 1287
            EW  +       A  +R  AE + +++   + ETD  T +T  +    L  R+ D+  W  E E+  + L  ETD+  +S  R++KA  A +            RE R+G DL  D V   L KE+E   ++  LL K+ ++   Q+RLNR+  H L  D  +K+ + ++D++C       +D  + P ++     +   + W   T DN+   E+E   S+ +R + + +LQ+   D+    +  + +F +R  E+   K + E H+ ++L++I   E ++  L++ +  K A L +A+ RL  R LR   E C D+P + L  E  ++   +  L++++ + +  L  L   +L LE+DI CK+NS+ ID   C
Sbjct:   60 EWFDNNSALLNRAAADRNQAENICHESRALKAETDAATLRTQTEGTTHLGARLQDIHLWRSELERLIERLSAETDLQISSRRRLEKALDATEIPFAIATDNLTCRERRFGPDLVKDAVEEELLKEVELIRSIQTLLKKTLDQTINQIRLNREVKHTLELDWSDKQQAYSLDDHCGRFSNRSTDTQRHPSSAVLQDQVCDEEVWRKFTVDNLRLAEREETASQALRRLTERVLQETTEDLRAQCDAVDRAFTQRCVEMSQAKTQLELHLAQILEQIGAQERNISQLQEAVHDKEAPLRVAQSRLHYRTLRPNMEQCRDQPQLSLLGEASKLSNTVSALQQQLYEAQKSLSDLEESRLNLEKDIACKTNSLLIDREKC 435          
BLAST of Tektin-1 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 228.794 bits (582), Expect = 1.083e-69
Identity = 144/402 (35.82%), Postives = 229/402 (56.97%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            MA++V  P  F+  EW    +  +  AE +R  +ERL+ ++ R  DE ++ T  +  DVNKKL QR++++++W  E + K ++   +   L     R++KA  + K+ L   + C + RE R GIDL  D+    L KE+E  + V+ LL+++ E+  EQ+R++R A + L +D  +K  +L IDN+C     +  DI+ +          +   +W + TN NI   EK+R N+  +RS+IDGIL + A+D+ +  +    + + RI E KD K K EEH+ +V+ EI + E ++E LKK L  K   + +A+ RL  R LR   E C D    RL  E+ EI  ++ +L++ +   E +LK L R QL LEE+IQ K NSI+IDEVIC  +RE + + +F
Sbjct:    1 MAKLVQLPPKFLPKEWNIANKTCYARAESQRSRSERLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSVTPIEWENYTNTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDEVICMQMREAISINAF 402          
BLAST of Tektin-1 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 180.259 bits (456), Expect = 1.914e-50
Identity = 121/383 (31.59%), Postives = 202/383 (52.74%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            +W +  ++ +R++E  R+SAERL  D  R   E D++T K   D NK L +R++D+ +W  E   + D++  ET+ L     R+++A    +  L  ++ C  +RE R  IDL  DDV   L +E++  ++  + + +  ++   QL  NR A H L +D  +K+ +L ID+ C + +     I         +  +   + W   ++DNI   + +R+ S  +R   + IL   +NDM       NV+F  RISE  D K K + H+ + LQEI  TE ++E +KK +  K A L +A+ RL +R  R   E C D   +RL +E+ +I   I  L+ R+ + E  L+ L   +  LE D+  K+NS+FID+  C G+R++ 
Sbjct:   98 DWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSF 480          
BLAST of Tektin-1 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 164.081 bits (414), Expect = 1.249e-44
Identity = 121/388 (31.19%), Postives = 196/388 (50.52%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDI----NQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIR 1299
            ++H EW Q     F  A  +R  +E   ++A +   ET+ R  ++  D  K L +R+ D+ +W  E  ++  ++  ET +L     R+++A  A              R+ R G +L  D+V   L KE++   NV +LL ++ ++  +Q+R NR A   L  D  +K  +   D+ C       +DI    N +    + + P    + W   T++NI+  E+ERM S N+RS+ID ILQ ++ D+E       V F KR  E++D K K E H+ + L+EI   E ++  LK+ ++ K   L +A+ RL  R+ R   E C D   IRL  E+ E+   +  LK ++ D E  L+ L   ++ LE+DI  K+NSIFID   C  +R
Sbjct:   64 YLHEEWQQGNLATFYRAFSDRDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTP----ESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTLR 447          
BLAST of Tektin-1 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 118.627 bits (296), Expect = 2.315e-29
Identity = 90/306 (29.41%), Postives = 148/306 (48.37%), Query Frame = 1
Query:  223 RLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEI 1140
            RL+ ++ R  DE+++ T K+  D NKKL QR++++++W + + K  D +     +L     R++K+    K+ L   + C + +E R GIDL  D+    L K ++  + V+ LL+ +        R N K  + L +D  +K  +L IDN+C     +  DI  +          +   +W   TN NI   EK R N+  +RS+IDGIL + A+D+                     K K EEH+ +V+ EI + E ++E LKK L  K   + + + RL  R LR         P++ L +EI
Sbjct:   18 RLVAESQRLVDESEKTTQKSQKDFNKKLDQRLEEIQFWKELDSKLEDTVNDIAQLLACK-FRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLLEYN--------RTNSK--YSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDIY-------------------AKNKLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLR---------PNVELFQEI 284          
BLAST of Tektin-1 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 108.997 bits (271), Expect = 4.357e-26
Identity = 83/290 (28.62%), Postives = 136/290 (46.90%), Query Frame = 1
Query:  271 TNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEI 1140
            T K+  D NKKL QR++++++W + + K  D +     +L     R++K+    K+ L   + C + +E R GIDL  D+    L K ++  + V+ LL+           ++  A + L +D  +K  +L IDN+C     +  DI  +          +   +W   TN NI   EK R N+  +RS+IDGIL + A+D+                     K K EEH+ +V+ EI + E ++E LKK L  K   + + + RL  R LR         P++ L +EI
Sbjct:    1 TQKSQKDFNKKLDQRLEEIQFWKELDSKLEDTVNDIAQLLACKF-RLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLLE-----------MSLSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSVTPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDIY-------------------AKNKLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLR---------PNVELFQEI 250          
BLAST of Tektin-1 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 214.542 bits (545), Expect = 3.912e-64
Identity = 137/403 (34.00%), Postives = 231/403 (57.32%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDIN------QTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  +E ++ T K+  DVNKKL QR+++V++W  E + K ++L  +TD L T   R++++  + K+ LH T+ C   RE R GIDL  D V   L KE +    V+ LL ++ EE+ EQ+RLNR A + L +D  +K  ++ ID+ C     +  +IN      +  PNS      + L+DW+  +N N+   +K+  NS  +++++D IL Q AND+ R  E  + +F   + E KD + K  +H+ +V++EI + E ++  L+  +  +     +A  RL  R  R   E C D    RL +EI EI  ++ +LK+ +   + QLK L R+QL L+E+IQ K N+I+ID+V+C  +R+++
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNS------VSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSI 397          
BLAST of Tektin-1 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 214.542 bits (545), Expect = 3.912e-64
Identity = 137/403 (34.00%), Postives = 231/403 (57.32%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDIN------QTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  +E ++ T K+  DVNKKL QR+++V++W  E + K ++L  +TD L T   R++++  + K+ LH T+ C   RE R GIDL  D V   L KE +    V+ LL ++ EE+ EQ+RLNR A + L +D  +K  ++ ID+ C     +  +IN      +  PNS      + L+DW+  +N N+   +K+  NS  +++++D IL Q AND+ R  E  + +F   + E KD + K  +H+ +V++EI + E ++  L+  +  +     +A  RL  R  R   E C D    RL +EI EI  ++ +LK+ +   + QLK L R+QL L+E+IQ K N+I+ID+V+C  +R+++
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNS------VSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSI 397          
BLAST of Tektin-1 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 214.542 bits (545), Expect = 3.912e-64
Identity = 137/403 (34.00%), Postives = 231/403 (57.32%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDIN------QTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  +E ++ T K+  DVNKKL QR+++V++W  E + K ++L  +TD L T   R++++  + K+ LH T+ C   RE R GIDL  D V   L KE +    V+ LL ++ EE+ EQ+RLNR A + L +D  +K  ++ ID+ C     +  +IN      +  PNS      + L+DW+  +N N+   +K+  NS  +++++D IL Q AND+ R  E  + +F   + E KD + K  +H+ +V++EI + E ++  L+  +  +     +A  RL  R  R   E C D    RL +EI EI  ++ +LK+ +   + QLK L R+QL L+E+IQ K N+I+ID+V+C  +R+++
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNS------VSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSI 397          
BLAST of Tektin-1 vs. Ensembl Mouse
Match: Tekt3 (tektin 3 [Source:MGI Symbol;Acc:MGI:1918312])

HSP 1 Score: 155.606 bits (392), Expect = 2.000e-41
Identity = 108/380 (28.42%), Postives = 190/380 (50.00%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIR 1299
            +W +   + F+ +   R ++ERL  D  R   +  ++  KT     + L +R++D+ +W  E   + DE+  ET+ L     R+++     +  L  ++ C  +RE R GIDL  D+    L  E++T     + + +  ++A  QL  +R A H L +D  +K+A+L ID+ C   +     ++        +  +   + W   T+DN+   + ER  S  +R   + +L   AN+M     + N++F  RI+E  D K K   H+ + LQEI   E ++E +KK +  K A+L +A+ RL +R  R   E C D   +RL  E+ E+   I  L++R+ D E  L+ L   +  LE D+  K+N+++ID+  C  +R
Sbjct:   98 DWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMR 477          
BLAST of Tektin-1 vs. Ensembl Mouse
Match: Tekt4 (tektin 4 [Source:MGI Symbol;Acc:MGI:1919090])

HSP 1 Score: 154.451 bits (389), Expect = 2.738e-41
Identity = 117/385 (30.39%), Postives = 193/385 (50.13%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKA-----CKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVIC 1287
            ++  EW Q+   R+  A  +R  +ER  +++ +   ET     +T  D  +K+ +R++D+  W  E +++ DEL  ETD++     R+ +A  A    + Y+ A     C   RE R   DL  D V   L KE E   N+ +LL ++  +A +Q+RLNR+       +  +K     ID+ C       + +   P +S   +     + W    +DN+   E+ER+ S N+R +ID IL+  A D+    +  N +F  R  EL D+  K + H+ + L EI + E  +  LK+ +  K A L +A+ RL QR+ R   E C D    RL  E+ E+ + +  LK+++ D E  L+ L   ++ LE+DI  K+NS+FID   C
Sbjct:   51 YLRDEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATS--VPYSIATDNLQC---RERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKC 430          
BLAST of Tektin-1 vs. UniProt/SwissProt
Match: sp|Q969V4|TEKT1_HUMAN (Tektin-1 OS=Homo sapiens OX=9606 GN=TEKT1 PE=1 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.803e-65
Identity = 138/409 (33.74%), Postives = 236/409 (57.70%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPN---------SDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVK 1317
            MA+++ PP  F+  EW    + ++  A+ +R  +ERL+ ++ R  DE ++ T K+  DVNKKL QR+++V++W  E + K ++L   TD L     R++KA   +K+ LH T+ C   RE R GIDL  D V   L KE E  + ++ LL ++ EEA EQ+R+NR A + L +D  +K  +L ID+ C         +N   PN          +PN   + L+DW+  ++ N+   +K+R NS  +++++D IL Q AND+ +  +  + +F+  + + KD + K  +H+ +V++EI + E ++  L+K +  +     +A  RL  R  R   E C D    RL +E+ EI  ++ +LK+ +   + +LKGL R+QL L+E+IQ K N+I+IDEV+C  +R+++ ++
Sbjct:    1 MAKLLQPPPKFLPSEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICF-------SLNNNSPNIRYSENAVRIEPNS--VSLEDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPLR 400          
BLAST of Tektin-1 vs. UniProt/SwissProt
Match: sp|Q99JD2|TEKT1_RAT (Tektin-1 OS=Rattus norvegicus OX=10116 GN=Tekt1 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 3.476e-65
Identity = 138/399 (34.59%), Postives = 230/399 (57.64%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDI--NQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  +E ++ T K+  DVNKKL QR+++VK+W  E + K + L  ET+ L T   R++++  + K+ LH T+ C   RE R GIDL  D V   L KE +    V+ LL ++ EEA EQ+RLNR A + L +D  +K  ++ ID+ C     +  DI  ++     +PN   + L+DW+  +N N+   +K+  NS  +++++D IL Q AND+ R  E  + +F   + E KD + K  +H+ +V+ EI + E ++E L+  +  +     +A  RL  R  R   E C D    RL  E+ EIK ++ +L++ +   + QLK L R+QL L+E+IQ K N+I+ID+V+C  +R+++
Sbjct:    1 MAKLLQSPPKFLPAEWYIANKSQYHRAEAQRSRSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVKFWKKELDDKLEHLVNETEDLLTYKIRLERSLESYKEPLHITEKCLAYREKRVGIDLVHDVVDQELQKEADIIHGVMNLLTRTVEEATEQIRLNRSAKYNLEKDLKDKFTAITIDDICFSLNNNSPDIKYSENVVRIEPNS--VSLEDWLDFSNTNMQKADKQLNNSMALKTLVDQILSQTANDLRRQCEVVDTAFVNGLKETKDARNKLADHLAKVMDEIASQEKNIEVLENAITQQEGPAKVAHTRLENRTYRPNVELCRDVAQYRLIREVQEIKHNVARLEETLAQAQIQLKALFRRQLALQEEIQVKENTIYIDQVLCMEMRKSI 397          
BLAST of Tektin-1 vs. UniProt/SwissProt
Match: sp|Q9DAJ2|TEKT1_MOUSE (Tektin-1 OS=Mus musculus OX=10090 GN=Tekt1 PE=1 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 2.736e-63
Identity = 137/403 (34.00%), Postives = 231/403 (57.32%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDIN------QTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  +E ++ T K+  DVNKKL QR+++V++W  E + K ++L  +TD L T   R++++  + K+ LH T+ C   RE R GIDL  D V   L KE +    V+ LL ++ EE+ EQ+RLNR A + L +D  +K  ++ ID+ C     +  +IN      +  PNS      + L+DW+  +N N+   +K+  NS  +++++D IL Q AND+ R  E  + +F   + E KD + K  +H+ +V++EI + E ++  L+  +  +     +A  RL  R  R   E C D    RL +EI EI  ++ +LK+ +   + QLK L R+QL L+E+IQ K N+I+ID+V+C  +R+++
Sbjct:    1 MAKLLQSPPRFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNS------VSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKSI 397          
BLAST of Tektin-1 vs. UniProt/SwissProt
Match: sp|Q32KZ9|TEKT1_BOVIN (Tektin-1 OS=Bos taurus OX=9913 GN=TEKT1 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.213e-62
Identity = 138/403 (34.24%), Postives = 234/403 (58.06%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCL---DSKPHLS---DINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            MA+++  P  F+  EW    + ++  AE +R  +ERL+ ++ R  DE ++ T K+  DVNKKL QR+++V++W  E + K ++L   T+ L     R+ KA  + K+ LH T+ C   RE R GIDL  D+V   L KE E    V+ LL ++ EE  EQ+RLNR A + L +D  +K  ++ ID+ C    ++ P++    ++ +  PNS      + L+DW+  +N N+   +K+R NS  +++++D IL Q A+D+ R  +  + +F+  + E KD + K   H+++V++EI + E ++  L+K +  +     +A  RL  R  R   E C D    RL +E+ EI  ++ +LK+ +     +LKGL R+QL L+E+IQ K N+I+IDEV+C  +R+++
Sbjct:    1 MAKLLQQPPKFLRAEWQIANKNQYHRAEAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVYATEDLLLYQTRLQKALESFKEPLHITEKCLEYREKRVGIDLVHDEVEQELIKEHEIIRGVMTLLTRTLEETCEQIRLNRSAKYNLEKDLRDKFTAITIDDICFSLNNNSPNIKYSENVVRVEPNS------VSLEDWLDFSNTNVEKADKQRNNSLTLKALVDRILFQTASDLRRQCDVVDTAFKNGLKETKDARDKLALHLDKVMEEIASQEKNIVVLEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLIKEVDEITHNVARLKETLAQAHVELKGLNRRQLALQEEIQIKENTIYIDEVLCVPMRKSI 397          
BLAST of Tektin-1 vs. UniProt/SwissProt
Match: sp|Q9TTW3|TEKT1_CANLF (Tektin-1 OS=Canis lupus familiaris OX=9615 GN=TEKT1 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 3.167e-59
Identity = 134/402 (33.33%), Postives = 230/402 (57.21%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCL---DSKP--HLSD-INQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRET 1305
            MA+++ P   F+  EW    + ++  AE +R  +ERL+ ++ R  DE ++ T K+  DVNKKL QR+++V++W  E + K ++L   T+ L T   R+  A  ++K+ LH T+ C   R+ R GIDL  D+V   L KE E    V+ LL ++ +E  EQ+RLNR A + L +D  +K  +L ID+ C    ++ P  + SD + +  P+S      + L+DW+  +N N+    ++R NS  +++++D IL Q A+D+ R  +  + +F+  + E K  + +   H+ +V++EI   E +M  L+K +  +     +A  RL  R  R   E C D    RL +E+ EI  ++ +LK+ +   + +LKGL R+QL L+E++Q K N+I+ID V+C  +R++
Sbjct:    1 MAKLLQPSPKFLPEEWHIANKNQYHRAEAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVCTTEDLLTYQTRLQNALESLKEPLHITQMCLEYRDKRIGIDLVHDEVEQELLKEAEVIHGVMALLTRTMDEVTEQIRLNRSAKYNLEKDLKDKFVALTIDDVCFSLNNNSPGIYYSDSVVRVEPHS------VSLEDWLDFSNTNVEKANRQRNNSLALKALVDRILSQTADDLRRQCDMVDTAFQMGLKETKAARDQLAAHLAKVMEEIACQEKNMTVLEKAILDQEGPAKVAHTRLETRTRRPNVELCRDVAQYRLVKEVGEIAQNVGRLKEALAQAQVELKGLNRRQLALQEEVQVKENTIYIDRVLCTHMRKS 396          
BLAST of Tektin-1 vs. TrEMBL
Match: K1RFP6 (Tektin-1 OS=Crassostrea gigas OX=29159 GN=CGI_10027835 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 3.474e-92
Identity = 177/405 (43.70%), Postives = 249/405 (61.48%), Query Frame = 1
Query:  115 KMAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYC--LDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            KMA++V  P  F HPEW       + NAE ER +AERL+ ++ R  +ET +RT KT  DV+KKL QRIDD+KYW  E + K   L  E D L    AR++KA  A  + LH  K C +NRE R  IDL  DDV   L KE+ET E V  LL+++ E+  EQ+RLNRK+ ++L +D  +K ++L+ID YC  L +  H           + N   +  +DW   ++ NI   E+ER +S  +R++IDGILQQ +NDM +   + NV+F KRISE KDTK K E+H+N+++ +IK  E ++  LKK +D K+  + LA+ RL  R  R   E C D    RL EE+ EI+  + QL+ R+   E  LKGL R QL LEEDI  K+N++FIDEV C G+R+++ +++F
Sbjct:   19 KMAKLVQGPTRFTHPEWTTSNLTHYANAESERAAAERLVEESKRLSEETAKRTEKTQRDVSKKLEQRIDDIKYWKKELDDKLANLVTEIDSLIAFKARVEKALEATAEPLHIAKQCLLNREKRTSIDLVHDDVQKQLIKEVETIEGVQALLNRTLEQTTEQIRLNRKSKYQLEKDLKDKFSALSIDEYCAELRNNSHGLKFKDGAAKIEANS--VCPEDWQDFSDANILKAERERQSSVELRTLIDGILQQTSNDMRKQCSDVNVAFNKRISETKDTKSKLEDHLNKIVGQIKEAEENISRLKKAIDDKVLPMQLAQTRLDTRTNRPNVELCRDPVQYRLIEEVGEIESSVAQLQARLKQTEDSLKGLIRNQLALEEDIGVKANTLFIDEVECMGMRKSINIQNF 421          
BLAST of Tektin-1 vs. TrEMBL
Match: A0A2T7PH59 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08182 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 6.982e-92
Identity = 178/413 (43.10%), Postives = 253/413 (61.26%), Query Frame = 1
Query:   85 EYYIFK*ILQKMAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            +Y +     + MA++V PP  F H EW +    ++ NA++ERQSAERL+ ++ R  DET +R+ ++  DV+KKL QR+DD++YW  E + K D L  E D L     R++KA  A ++ LH  K C  NRE R  IDL  DDV   L KE+ET E V  LL ++ +EA EQLRLNRKA + + +D  +K  +  ID YC   + + ++I+               ++W   +N NI N E+ERMNS N+RS IDGILQQ  ND+ +  + TN++F KRI+E KDTKGK E+H+N+VL +I   E ++  L+K +  K   L LAE RL  R  R   E C D    RL EE+ E++  I QLK+R+ D    LKGL R QL LE+DI+ K+N++FID+V C G+R++L ++ F
Sbjct:   51 DYTVMPPSTRVMAKLVRPPPRFNHEEWTRSNLTKYANADVERQSAERLVEESKRLSDETQKRSERSQADVHKKLQQRLDDIRYWKKELDDKLDRLVTEIDSLIAYKTRVEKALQASEEPLHIAKQCLANRERRTSIDLVHDDVQKELLKEVETLEGVQALLQRTLDEATEQLRLNRKAKYLIEKDLKDKFHAQDIDEYCEHLRNNSAEIHYKDGAVKIETNSTSPEEWKDFSNANIENAERERMNSTNLRSAIDGILQQTTNDIRKQTDATNLAFAKRIAETKDTKGKLEDHLNKVLAQIIENEENVARLRKAIADKQPPLMLAETRLDTRKNRPNVELCRDPVQYRLIEEVTELECSIAQLKQRLADTLDSLKGLARNQLSLEDDIKVKTNTLFIDDVECMGMRKSLNIQYF 463          
BLAST of Tektin-1 vs. TrEMBL
Match: A0A210PWY8 (Tektin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16029 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.165e-91
Identity = 172/402 (42.79%), Postives = 250/402 (62.19%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            MA++V PP  F H EW      ++ NAE+ER +AERL+ ++ R  DET++RT KT  DVNKK  QR+DD+KYW +E + K D +  E D L     R++KA  A  + LH  + C  NRE R  IDL  DDV   L KE+E+ E V  LL ++ E+A EQ+RLNRKA ++L +D  +K ++L+ID YC + + + + +      +         +DW   +N+NI   E+ER +S ++RS+IDGILQQ +NDM +   + N++F KRI+E KDTK K E+H+N VL +IK  E ++  L+K +  K   + L++ RL  R  R   E C D    RL EE+ EI+  + QL++R+   E  LKGL R QL LEEDI  KSN++FIDEV C G+R+++ +++F
Sbjct:    1 MAKLVQPPPRFTHSEWTTSNLTKYANAEVERAAAERLVEESKRLSDETEKRTEKTQRDVNKKFDQRLDDIKYWKNELDDKLDGITTEIDNLLAFKTRVEKALEATAEPLHIARQCLGNREKRVSIDLVHDDVQKQLMKEVESIEGVQALLQRTLEQATEQIRLNRKAKYQLEKDLKDKFSALSIDEYCGNLQNNSAGLGFKAGAAKIEANSACPEDWRDFSNENILKAERERQSSVDLRSLIDGILQQTSNDMRKQCADVNLAFNKRIAESKDTKNKLEDHLNHVLAQIKEIEENISRLQKSIQDKAQPMQLSQTRLDTRTNRPNVELCRDPVQYRLIEEVGEIESSVAQLQERLRQTEDSLKGLIRNQLSLEEDISVKSNTLFIDEVECMGMRKSINIQNF 402          
BLAST of Tektin-1 vs. TrEMBL
Match: A0A267GEH6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028559g4 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 2.631e-91
Identity = 166/404 (41.09%), Postives = 257/404 (63.61%), Query Frame = 1
Query:  112 QKMAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            Q MA++V PP  + HPEW      ++RNAELER +AERL  ++DR  +ET ++T     DV+KKL QR++DVKYW +E ++K   +  E D LG   +R+DKA  + ++ LH ++ C +NRE R GIDL  DDV   L KE+E  +    LL K+ E+A+EQLRLNRKA ++L +D  +K+++  +D++C+  K + + + ++P     +   +  ++W  L+N NI   EK+R NS +M SI+DGILQ VAND+E+     +++ ++R++E +D+K K EEH+ +VL E+K+ E +++ L+  +  K   L +AE RL  R  R   E C D    RL EE+  I+  +  L +R+      LKGL R+QL LEE+IQ K+N+++IDEV CGG+R ++ + SF
Sbjct:    7 QAMAKVVNPPPRYTHPEWTFSNNQKYRNAELERAAAERLKAESDRIIEETAKKTAAAQADVDKKLNQRLNDVKYWREEVDEKLAGVSGEIDRLGAFISRVDKALESYQEPLHISQQCLINREGRIGIDLVHDDVQKELLKEVEVNQGAQALLLKTLEQAKEQLRLNRKAKYQLEKDIADKRSAEQLDSHCVALKANSAGLGRSPCAVGIDSKSVSPEEWQELSNRNILEAEKQRQNSAHMCSIVDGILQAVANDLEKQKSCVDIAVKRRVAETRDSKAKLEEHLAQVLAEVKDMEVNIDKLESAIAEKEQPLKVAETRLKVRGARPNVEQCRDPAQFRLVEEVGGIQASVEALSQRLAASRDSLKGLLRRQLDLEEEIQIKANTLYIDEVQCGGLRGSIQIHSF 410          
BLAST of Tektin-1 vs. TrEMBL
Match: A0A267E7Z9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028559g1 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 3.234e-91
Identity = 166/404 (41.09%), Postives = 257/404 (63.61%), Query Frame = 1
Query:  112 QKMAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            Q MA++V PP  + HPEW      ++RNAELER +AERL  ++DR  +ET ++T     DV+KKL QR++DVKYW +E ++K   +  E D LG   +R+DKA  + ++ LH ++ C +NRE R GIDL  DDV   L KE+E  +    LL K+ E+A+EQLRLNRKA ++L +D  +K+++  +D++C+  K + + + ++P     +   +  ++W  L+N NI   EK+R NS +M SI+DGILQ VAND+E+     +++ ++R++E +D+K K EEH+ +VL E+K+ E +++ L+  +  K   L +AE RL  R  R   E C D    RL EE+  I+  +  L +R+      LKGL R+QL LEE+IQ K+N+++IDEV CGG+R ++ + SF
Sbjct:    6 QAMAKVVNPPPRYTHPEWTFSNNQKYRNAELERAAAERLKAESDRIIEETAKKTAAAQADVDKKLNQRLNDVKYWREEVDEKLAGVSGEIDRLGAFISRVDKALESYQEPLHISQQCLINREGRIGIDLVHDDVQKELLKEVEVNQGAQALLLKTLEQAKEQLRLNRKAKYQLEKDIADKRSAEQLDSHCVALKGNSAGLGRSPCAVGIDSKSVSPEEWQELSNRNILEAEKQRQNSAHMCSIVDGILQAVANDLEKQKSCVDIAVKRRVAETRDSKAKLEEHLAQVLAEVKDMEVNIDKLESAIAEKEQPLKVAETRLKVRGARPNVEQCRDPAQFRLVEEVGGIQASVEALSQRLAASRDSLKGLLRRQLDLEEEIQIKANTLYIDEVQCGGLRGSIQIHSF 409          
BLAST of Tektin-1 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 176.407 bits (446), Expect = 3.629e-49
Identity = 127/393 (32.32%), Postives = 201/393 (51.15%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYC------LDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            ++  +W +     +R +E  R SAERL  D  R   + D+ T  T +  +K L +R++D+ +W  E   + D +  E   L     R+++A A  +  L  ++ C  +RE R  IDL  D V  +L KE+E  ++  + + +S ++A  QL  NR A H L +D  +K  +  ID+ C       D   +   I++  P+      L   D W   T+DNI   + ER  S  +R  I+ +L   AN+M       NVSF  RISE+ + K   + H+ + LQEI  TE  +E LKK +  K   L +A+ RL +R  R   E C D PH RL  E+ EI+  I +L++R+ + E  L+ L + ++ LE DI  K+NS+F+D+  C  +R + 
Sbjct:   93 YMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPS------LSLPDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSF 479          
BLAST of Tektin-1 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 123.635 bits (309), Expect = 1.676e-30
Identity = 107/376 (28.46%), Postives = 179/376 (47.61%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVIC 1287
            EW ++     + A  + Q A+R++  +     E    T          L  R+ DV     E ++ ++ L  ET++L     R++KA       L  +      RE+R+G DL  D V   L KE+E   NV  LL K+ ++A +Q+RLNR+A   L  D  +K  +  +D+ C       +D    P ++  +  +     W+  T  N+   E++   S ++R + D +LQ+ A D+       + SF +R  EL   K + E  + RVL EI + E ++  L++ +  K   L +A+ RL  R  R   E C D+P I L  E+ +I   +  L++++ +    L  L   +L LE++I CK+NS+FID   C
Sbjct:   42 EWQENNSATLQRALTDHQHAQRVLRASRALSAEAAAGTQDAQSRGTLLLGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKC 417          
BLAST of Tektin-1 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 105.145 bits (261), Expect = 3.772e-24
Identity = 95/364 (26.10%), Postives = 161/364 (44.23%), Query Frame = 1
Query:  118 MAQMVAPPKLFIH-PEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLD---SKPHLS----DINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIV 1185
            MA M   P L    P+W    ++    AE  R  +  +  +     +ET  +T+    D +++L  RI DV  W    E    ++  E D L  +    ++A AA    L  T  C+  RE R G +L +D V   L KE++  +   ++L +  +++ EQL L ++A+H+L  D  +K  +L +D  CL    + P +S     I   P ++ P +       W   ++ N+   ++E   S  +R  I     QV N++E     T  + RKR   ++    + +  +     EI   E  +  L++ + +KMA L L   RL  R  R   + C DE    L EE  ++   I  LK+++ 
Sbjct:    1 MATMSMKPGLRCRVPDWENSNKLISDTAEHRRHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQ-------WEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLA 357          
BLAST of Tektin-1 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 62.3882 bits (150), Expect = 2.035e-11
Identity = 55/185 (29.73%), Postives = 83/185 (44.86%), Query Frame = 1
Query:  766 WMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKS 1320
            W   +  N+     E   S  +R  I   + Q  N++E     T+ +FRKR  EL   K + E       QEI   E  +  L+  + +KM  L +A  RL  R  R   E C DEP   +  E+ +I+  I  LKK++ D    L GLR     +E D+  K+ ++ + E  C  +R  L V +
Sbjct:    7 WDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGL-ERRCVDVRRKLTVSA 190          
BLAST of Tektin-1 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 216.853 bits (551), Expect = 1.056e-65
Identity = 143/398 (35.93%), Postives = 224/398 (56.28%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLV 1311
            MA++V PP  ++  EW     +++  AE ER +AERL ++++R   E + RT +T +DVNKKL QRI D+ +W  E ++   E  +E +M+    AR+++A A  +  L   + C +NRE R  IDL  D+V   L KE+E  E V  LL ++ E+A EQ+RL R A + L +D  +K  +  IDN C   K     +          K  +  D+W   +N N+   E+E+ +S ++RSIIDG+L Q  ND+       N++F KRI E    K K E+H+ +V +EI   E ++  L++ +  K+A + +A+ R+  R  R   E C D    RL +E+ EI  +I +L++++ + E  LK L R+QL LEEDI+ K NS+FID   C  +R+ + 
Sbjct:    1 MARLVQPPPKYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSVTPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMNQCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRKQIT 398          
BLAST of Tektin-1 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 196.438 bits (498), Expect = 4.216e-58
Identity = 132/372 (35.48%), Postives = 201/372 (54.03%), Query Frame = 1
Query:  193 NAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            + E ER +AERL ++  R   ET   T++T  DVNKKL  R+ D+ YW  E EK+  E   E   L     R++KA AA +  L+ ++ C   RE R  IDL  D+V  +L+KE+E  ENV  LL K+ ++A EQL L R A  +L +D  +K  +L ID  C     H  DI+  P      +     D+W   +++NI   E+ER  S  +RS I+GIL Q   D+  + E  N  F KRI +    K   E+ ++RV+ E+ + + ++  L + +  K A L +A  RL +R++R   E C D    RL  E+ EI   I +L+ R+ + +  ++ L R +  LE+DI+ K+NS+FID   C  +R+ +
Sbjct:    6 SGEKERATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDRDQCMVVRQQV 377          
BLAST of Tektin-1 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 157.147 bits (396), Expect = 3.789e-43
Identity = 123/391 (31.46%), Postives = 195/391 (49.87%), Query Frame = 1
Query:  136 PPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            PP+ F   +W    ++   NAE +R+++ R+  ++    +ETD  T  T  D N KL +RIDD+  W    E+   E   E  +L     R ++A  A K  L  T  C + RE+R  IDL  D+V   L+KE+E  E    LL +  +E+ EQL L ++A H+L+ D  +K  +L ID  C       ++I      +   K  +  + W   +N N    E E   S+++R  I   LQQ AND+E   + +  SFRKRI E    K + E      ++EI   E  ++ LK+ +D+K A + +A+ RL  R  R   E C D+P  +L  E+ EI   +  L +++ + +  L+ LR     + ED+  K+NS+ +D   C  +RE +
Sbjct:    9 PPR-FAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSVTPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALDNR-CMSVREKM 397          
BLAST of Tektin-1 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 161.384 bits (407), Expect = 1.237e-43
Identity = 118/383 (30.81%), Postives = 195/383 (50.91%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            +W +  +  +  +E  R+SAERL  D  R   + D+ T +T ++ +K +++R++D+++W  E   + D +  E   L     R+++A A  +  L   + C  +RE R  IDL  D V  +L K IE  ++  + +    + A  QL  NR A H L +D  +K  +  ID+ C   +     I         +  +   D W   T+DNI   + ER  S  +R  I+ +L   +N+M       NV+F  RISE  D K   + H+ + +QEI  TE  +E LKK +  K   L +A+ RL +R  R   E C D P+ RL  E+ EI+  I +L +R+++ E  L+ L + ++ LE D+  K+NS+F+D+  C  +R+T 
Sbjct:   95 DWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLIK-IEVIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTF 476          
BLAST of Tektin-1 vs. Ensembl Medaka
Match: tekt1 (tektin-1 [Source:NCBI gene;Acc:101161072])

HSP 1 Score: 137.117 bits (344), Expect = 1.650e-35
Identity = 103/371 (27.76%), Postives = 192/371 (51.75%), Query Frame = 1
Query:  217 AERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYC-LDSKPHLSDINQTPPNSDPN-KPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            +ER   +      ET +   +  +D N++  Q++  +++   E E K DE+  E D L    +R+ KA  A K+ L  T  C   R  R   +   D+V   L KE E  + V  LL +  E+  EQLRLNR A + + +D   K  +  +DN+C L +   +S  ++   +S P    ++ LD W +++  N+   E+++ NS +++ ++  +L Q A DM++ V+ T  + +  + ++K+ K + E+ + ++  EI +   + EDL+  +     +L+L + RL  R+ R   E   D    +L  ++ +I   I QL++ +   E + + L   +L L+E I  K+N ++IDEV+C   RE +++++F
Sbjct:   23 SERFRAECKELIKETKQICKRMQEDENQQFDQKLRRIQFLKKELELKLDEVNLEIDDLVVLQSRVTKALDACKEPLEVTDLCMKERLKRPNSERFHDEVDGELLKESEGLKRVESLLQRVTEQISEQLRLNRSAKYGIEKDLKEKSEAQNVDNFCTLMATLSMSHRHRPKTHSTPEPSSVLTLDQWENISYANMAKAEQQKTNSRSLQVLVQSVLDQTAADMQKQVQATTTAIQLNVQKMKNAKNQMEDELVKIQSEISSQRKTREDLRVAVAENEEFLSLTQARLALRHERPGKEQWRDPAQRKLLADVQKITEHIKQLQQEVDRSEDEERRLLNWKLRLQESIDSKANCLYIDEVVCMQRREAVIIQNF 393          
BLAST of Tektin-1 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 107.071 bits (266), Expect = 8.033e-25
Identity = 95/344 (27.62%), Postives = 164/344 (47.67%), Query Frame = 1
Query:  163 WVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLD---SKPHLS-DINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRI 1182
            W + ++ R  ++E+ RQ  + L N       ET  +T     + +++L +R+ DV  W D  +  + ++ +E D L  S    ++A AA    L  +  C + RE R G +L  D V   L KE+E  E V + L +  +EA +QL + ++A H+L  D  NK  +L ID  CL    + P++S   N T   S  + P     +W+ L+N N+   E+    S+ MR  +     Q+ N++E     T  + RKR    +  + + +  +  +  EI   E+ + +L   L +K A L LA  RL  R  R   + C DE    L  E+ +++  ++ L+ ++
Sbjct:   23 WAEAQQQRLVSSEI-RQECKSLRN-------ETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTP----QEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKL 354          
BLAST of Tektin-1 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 102.064 bits (253), Expect = 4.608e-23
Identity = 90/377 (23.87%), Postives = 173/377 (45.89%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVN-REDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVIC 1287
            EW  + +     A  +   AE +   +     +++  T +T  +  + L +R+ ++ +W  E  +  ++L  + + L  +  R+++A  A  D  +      +N R  R G DL  D V   L KE+    N+  LL ++  +   Q+R N  A   L  D  +K+ +  +D           D    P ++  ++ +     W   T DN+    +E   S  +R++++ +L++   D+       + +F +R  EL + K + +  + +VLQ+I   E ++  L+K +  K A L + + RL  R+LR   E C D   + L  E  +I+  +  LK+++ +    L  L   ++ L++DI CKS S+FI+   C
Sbjct:   53 EWFSNYQTILVRAGADNLEAESIQQLSRTLNRDSEGVTLQTQAEGTRLLGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEAT-DTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLKQKLNEARISLSNLEESRMELQKDISCKSQSLFIEGEKC 428          
BLAST of Tektin-1 vs. Planmine SMEST
Match: SMESG000065257.1 (SMESG000065257.1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 343/343 (100.00%), Postives = 343/343 (100.00%), Query Frame = 1
Query:  295 NKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            NKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFQLKGLRRQQLGLEEDIQCKSNSIFIDEVICGGIRETLVVKSF
Sbjct:    4 NKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFQLKGLRRQQLGLEEDIQCKSNSIFIDEVICGGIRETLVVKSF 346          
BLAST of Tektin-1 vs. Planmine SMEST
Match: SMESG000081245.1 (SMESG000081245.1)

HSP 1 Score: 328.176 bits (840), Expect = 1.537e-108
Identity = 186/402 (46.27%), Postives = 269/402 (66.92%), Query Frame = 1
Query:  118 MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKSF 1323
            MA +V PP  + HPEW      ++RNAE+ERQ+AERL N+ DR  DETD+RT K+L+DVNKK+ QRIDD+KYW +E +KK  ++  E   L     R+ KAR A+ + LH +K C  NRE R  IDL  DDV   L KE+E +  V +LLD++ E+A EQLRLNRKA +RL +D  +K  +  ID +  + KP+  DI  T   ++ +   +  +DW   TN+NI N +++ +NS +MRSIIDG+LQQ A+D +R     + +FR+RI+E++D+KGK EEH+ RVL+EI N E ++++L+  +++K+  L LA+ RL  R  R   ENC D P  RL EE+ E++ DI  L++R+ D   + K L+R+QL LEE+IQ K NS+FIDEV C GIRE++ ++++
Sbjct:    1 MAHLVKPPMRYTHPEWTYSNNTKYRNAEIERQTAERLQNECDRLIDETDKRTVKSLNDVNKKIDQRIDDIKYWKNELDKKLADVAVENYKLDEHIKRVGKAREALLEPLHISKQCMANREGRVAIDLVHDDVQKELIKEVEVHNGVKELLDRTIEQAVEQLRLNRKAEYRLKRDMDDKLTAQGIDEFVRELKPNSKDIGYTNAAAEIDPKAVTPEDWQSFTNENILNMDRQLLNSSDMRSIIDGVLQQTADDQKRQKIAVDTAFRRRINEVRDSKGKLEEHLARVLKEISNVEDTIKNLEMAIEAKIQPLKLAQTRLQVRKGRPNVENCRDNPQYRLLEEVEELEKDIAHLQRRLADANSEKKALKRRQLDLEEEIQVKQNSLFIDEVECMGIRESIKIEAY 402          
BLAST of Tektin-1 vs. Planmine SMEST
Match: SMESG000020792.1 (SMESG000020792.1)

HSP 1 Score: 170.244 bits (430), Expect = 4.854e-47
Identity = 120/386 (31.09%), Postives = 200/386 (51.81%), Query Frame = 1
Query:  160 EWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCL---DSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETL 1308
            +W++  E+ +  ++  R +AE++  D  R   E D RT +  +D  KKL  R+ D+ +  +E   + D++  E++ L  +    +K+ +  ++ LH T+ C  NRE R GIDL  D V  NL  E++  +     + +   +A  QL LNR + H L +DS +K  +  ID+Y     +S P ++  N      + +  +   + W+  TN+N+     ER  S  +R  I+ +L +   DM +   E N +  +R  E  D + K + H+N+VLQEI + E ++E +KK +  K A L +A+ RL  R  R   E C D+P  RL EE+ EI+  I  L +++   E  ++ L   +  LE D+  K+NS+FID   C G R+T 
Sbjct:   96 DWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGV---ENVDNCISTPETWLKFTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACRDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTF 478          
BLAST of Tektin-1 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.988e-44
Identity = 118/391 (30.18%), Postives = 196/391 (50.13%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKS 1320
            +   +W+      F++A+  R   ER+  D +R   ETD +T +  +DV KK+  R+ D  +W  E + + D++  E + L       +K     ++ LH  + C   RE R GIDL  D+V  +L  EI+T +     +     +A  Q+ LNR A H    DS +K  +  ID      K   + IN        +  +   + W   ++DN+   + ER NS  +R  I+  L + ANDM +     N +  +RI E  D + K + H+ ++LQEI + E ++E LKKC+  K  Y+ +A+ RL  R  R   E C D+P+ RL EE+ EI+  +  L + + + E  L+ L   +  LE+D+  K+N++F+D   C G+R+T  ++ 
Sbjct:  102 YTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPIQP 492          
BLAST of Tektin-1 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 163.31 bits (412), Expect = 2.678e-44
Identity = 118/391 (30.18%), Postives = 196/391 (50.13%), Query Frame = 1
Query:  148 FIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDRRTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDKARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLLDKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQTPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVANDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLKKCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQLKKRIVDHEFXXXXXXXXXXXXEEDIQCKSNSIFIDEVICGGIRETLVVKS 1320
            +   +W+      F++A+  R   ER+  D +R   ETD +T +  +DV KK+  R+ D  +W  E + + D++  E + L       +K     ++ LH  + C   RE R GIDL  D+V  +L  EI+T +     +     +A  Q+ LNR A H    DS +K  +  ID      K   + IN        +  +   + W   ++DN+   + ER NS  +R  I+  L + ANDM +     N +  +RI E  D + K + H+ ++LQEI + E ++E LKKC+  K  Y+ +A+ RL  R  R   E C D+P+ RL EE+ EI+  +  L + + + E  L+ L   +  LE+D+  K+N++F+D   C G+R+T  ++ 
Sbjct:  114 YTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPIQP 504          
The following BLAST results are available for this feature:
BLAST of Tektin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT13.755e-6633.74tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT34.284e-4429.58tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT34.284e-4429.58tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT52.102e-3828.98tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554][more]
TEKT41.444e-3727.34tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
back to top
BLAST of Tektin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02E12.43.307e-1220.75pep chromosome:WBcel235:X:4005314:4007634:1 gene:W... [more]
back to top
BLAST of Tektin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tektin-C3.525e-3529.00gene:FBgn0035638 transcript:FBtr0331521[more]
Tektin-C3.525e-3529.00gene:FBgn0035638 transcript:FBtr0331522[more]
Tektin-C3.525e-3529.00gene:FBgn0035638 transcript:FBtr0077115[more]
CG328198.669e-3126.03gene:FBgn0052819 transcript:FBtr0070051[more]
CG328208.669e-3126.03gene:FBgn0052820 transcript:FBtr0070054[more]
back to top
BLAST of Tektin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt11.391e-5733.08tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99][more]
tekt32.486e-5132.99tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.816e-5132.99tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt32.816e-5132.99tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt42.716e-3527.93tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98][more]
back to top
BLAST of Tektin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gdf101.083e-6935.82growth differentiation factor 10 [Source:Xenbase;A... [more]
tekt31.914e-5031.59tektin 3 [Source:NCBI gene;Acc:549229][more]
plcd11.249e-4431.19phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
fam168a2.315e-2929.41family with sequence similarity 168 member A [Sour... [more]
fam168a4.357e-2628.62family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt13.912e-6434.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt13.912e-6434.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt13.912e-6434.00tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
Tekt32.000e-4128.42tektin 3 [Source:MGI Symbol;Acc:MGI:1918312][more]
Tekt42.738e-4130.39tektin 4 [Source:MGI Symbol;Acc:MGI:1919090][more]
back to top
BLAST of Tektin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q969V4|TEKT1_HUMAN1.803e-6533.74Tektin-1 OS=Homo sapiens OX=9606 GN=TEKT1 PE=1 SV=... [more]
sp|Q99JD2|TEKT1_RAT3.476e-6534.59Tektin-1 OS=Rattus norvegicus OX=10116 GN=Tekt1 PE... [more]
sp|Q9DAJ2|TEKT1_MOUSE2.736e-6334.00Tektin-1 OS=Mus musculus OX=10090 GN=Tekt1 PE=1 SV... [more]
sp|Q32KZ9|TEKT1_BOVIN2.213e-6234.24Tektin-1 OS=Bos taurus OX=9913 GN=TEKT1 PE=2 SV=1[more]
sp|Q9TTW3|TEKT1_CANLF3.167e-5933.33Tektin-1 OS=Canis lupus familiaris OX=9615 GN=TEKT... [more]
back to top
BLAST of Tektin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RFP63.474e-9243.70Tektin-1 OS=Crassostrea gigas OX=29159 GN=CGI_1002... [more]
A0A2T7PH596.982e-9243.10Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A210PWY81.165e-9142.79Tektin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP7... [more]
A0A267GEH62.631e-9141.09Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267E7Z93.234e-9141.09Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Tektin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt33.629e-4932.32tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt41.676e-3028.46tektin 4 [Source:NCBI gene;Acc:103034475][more]
tekt23.772e-2426.10tektin 2 [Source:NCBI gene;Acc:103026688][more]
back to top
BLAST of Tektin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TEKT22.035e-1129.73tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO392921.056e-6535.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406814.216e-5835.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373573.789e-4331.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tekt31.237e-4330.81tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt11.650e-3527.76tektin-1 [Source:NCBI gene;Acc:101161072][more]
tekt28.033e-2527.62tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt44.608e-2323.87tektin 4 [Source:NCBI gene;Acc:101173527][more]
back to top
BLAST of Tektin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065257.10.000e+0100.00SMESG000065257.1[more]
SMESG000081245.11.537e-10846.27SMESG000081245.1[more]
SMESG000020792.14.854e-4731.09SMESG000020792.1[more]
SMESG000021346.11.988e-4430.18SMESG000021346.1[more]
SMESG000021346.12.678e-4430.18SMESG000021346.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006033 ID=SMED30006033|Name=Tektin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1453bp
AAAGTAATTTAGCTTTAAGAATTGTAATCAATTAATTAATTATTTTAATC
AATTTAATTAAATCTCAAATTTAAATTAAGTCAGGAATATTATATTTTTA
AATAAATTTTACAAAAAATGGCTCAAATGGTTGCCCCTCCGAAATTATTT
ATTCATCCCGAGTGGGTGCAAGACAAGGAAATGCGATTCAGAAACGCCGA
ATTGGAAAGACAATCAGCTGAAAGACTGATGAACGACGCAGATCGTTTTG
AGGATGAAACTGATCGTCGAACAAACAAAACTCTTGATGACGTCAACAAG
AAATTGGCTCAAAGAATTGATGATGTAAAATATTGGAATGACGAAAATGA
AAAGAAATCAGATGAACTTTTCAAAGAAACTGACATGCTTGGCACTTCTG
CAGCAAGAATTGACAAAGCAAGAGCGGCAGTTAAAGACTATCTGCACTAT
ACGAAAGCATGCAAAGTGAATAGGGAAGACCGCTACGGCATTGATCTATG
CGCTGATGACGTTCATTTTAATTTAAATAAAGAAATCGAGACGTATGAAA
ATGTTCTCAAGTTACTTGACAAAAGTGAAGAAGAAGCACGAGAACAGTTA
CGTCTCAATCGAAAAGCCAATCATCGACTTTATCAAGATTCTTTGAATAA
AAAAGCTTCGTTGGCAATAGATAATTATTGCTTGGACTCTAAACCTCACT
TATCTGACATCAATCAAACCCCACCAAACTCAGATCCAAACAAACCACTG
ATTCAACTGGATGATTGGATGCACTTAACAAACGACAATATTCACAATGG
AGAAAAGGAACGGATGAACTCAGAAAATATGCGATCAATTATAGATGGAA
TTCTACAACAAGTTGCAAATGACATGGAGCGAGTTGTTGAAGAAACAAAT
GTTTCTTTCAGAAAAAGGATATCAGAGCTGAAAGATACAAAAGGCAAGGA
CGAAGAGCATATGAATAGAGTTTTGCAAGAAATAAAGAACACTGAAACCT
CAATGGAAGATTTGAAGAAGTGTCTAGATAGTAAGATGGCGTATCTCACT
CTAGCAGAGCACCGACTTGGCCAAAGAAACTTGCGAATTGCCAACGAAAA
TTGTTTAGATGAACCCCACATTAGGCTGCATGAGGAGATTTGTGAAATCA
AATTAGACATTATTCAATTAAAAAAGAGAATAGTTGACCATGAATTCCAA
CTGAAGGGTCTGAGGCGCCAACAGTTGGGATTAGAAGAAGACATTCAGTG
CAAGAGCAACAGCATATTTATTGACGAAGTTATTTGCGGAGGGATACGGG
AAACATTGGTCGTGAAGTCTTTTTAAATTGTTTACAATCTTTTTTTATTT
AGACTAAGAACTAGATAAAAATCAAGAATATTTGATTCTTTTAAGATTGA
ATAGCTTGGATTTGTGTAAGACTTCTTTTCAATACAATAAACTGGAATTG
AAA
back to top

protein sequence of SMED30006033-orf-1

>SMED30006033-orf-1 ID=SMED30006033-orf-1|Name=SMED30006033-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MAQMVAPPKLFIHPEWVQDKEMRFRNAELERQSAERLMNDADRFEDETDR
RTNKTLDDVNKKLAQRIDDVKYWNDENEKKSDELFKETDMLGTSAARIDK
ARAAVKDYLHYTKACKVNREDRYGIDLCADDVHFNLNKEIETYENVLKLL
DKSEEEAREQLRLNRKANHRLYQDSLNKKASLAIDNYCLDSKPHLSDINQ
TPPNSDPNKPLIQLDDWMHLTNDNIHNGEKERMNSENMRSIIDGILQQVA
NDMERVVEETNVSFRKRISELKDTKGKDEEHMNRVLQEIKNTETSMEDLK
KCLDSKMAYLTLAEHRLGQRNLRIANENCLDEPHIRLHEEICEIKLDIIQ
LKKRIVDHEFQLKGLRRQQLGLEEDIQCKSNSIFIDEVICGGIRETLVVK
SF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000221spermatocyte
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0015630microtubule cytoskeleton
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0030317flagellated sperm motility
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility