Epidermal growth factor-8

Overview
NameEpidermal growth factor-8
Smed IDSMED30006022
Length (bp)1692
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal growth factor-8 (SMED30006022) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal growth factor-8 (SMED30006022) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006022

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30006022SMESG000077703.1 PL05002B2D11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30006022SMESG000077703.1 dd_Smed_v4_5019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30006022SMESG000077703.1 dd_Smed_v4_5019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30006022SMESG000077703.1 SMESG000006883.1 OX_Smed_1.0.22588ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A161HX36 (Epidermal growth factor-8 OS=Schmidtea mediterranea OX=79327 GN=egf-8 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 6.660e-49
Identity = 83/188 (44.15%), Postives = 127/188 (67.55%), Query Frame = 1
Query:  259 AKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKKRTQ--CKQSCIHGKCSFNIEKNQETCECFSGWDLPNC 816
             KA+L ++I NY+N+ ++KHD  KCETF WAND+CDP+F+IC+T K+ CD+     + + N+KK+Y V +Q  +  +    +S+ V+VDD D     DHIA F TSF I+   +  ++ M ++P N+ +SLQ SV +KCA +YYG+ CE++  +  C  SCI+GKC+FN +K+   C+C++GWD  NC
Sbjct:   25 TKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFKRDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 212          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A4S2LB56 (EGF-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008611 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.251e-8
Identity = 52/208 (25.00%), Postives = 85/208 (40.87%), Query Frame = 1
Query:  256 KAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCD----ILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCE---------------KKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSL 822
            +A+  L + + NY+N  NL     KCE   +  DNCDP+FQ+ V   N  +    +L ++   + N K L  VL      +     + + + + D+D  D    IA F    +I  L    +  +Q+     D+ ++  + ++CA +YYG+ CE                    C + CI G C          C C  GW    C +
Sbjct:   14 RAEVNLLLTVRNYENKNNLDSRLRKCEALSFLGDNCDPIFQLTVHVTNSRNERHLLLRREAGPFANKKVLKEVLQTSSTQREFPSVIEIALDIYDNDA-DEDQLIARFR---RIIPLLRTGQLDLQM---GSDVKVKVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFCRM 212          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A419QGW3 (EGF-like domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CSKR_5660s PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.326e-8
Identity = 52/208 (25.00%), Postives = 85/208 (40.87%), Query Frame = 1
Query:  256 KAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCD----ILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCE---------------KKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSL 822
            +A+  L + + NY+N  NL     KCE   +  DNCDP+FQ+ V   N  +    +L ++   + N K L  VL      +     + + + + D+D  D    IA F    +I  L    +  +Q+     D+ ++  + ++CA +YYG+ CE                    C + CI G C          C C  GW    C +
Sbjct:   14 RAEVNLLLTVRNYENKNNLDSRLRKCEALSFLGDNCDPIFQLTVHVTNSRNERHLLLRREAGPFTNKKVLKEVLQTSSTQREFPNVIEIALDIYDNDA-DEDQLIARFR---RIIPLLKTGQLDLQM---GSDVKVKVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFCRM 212          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A1S8WXP4 (EGF-like domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05002 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.050e-7
Identity = 53/212 (25.00%), Postives = 88/212 (41.51%), Query Frame = 1
Query:  244 NHQTKAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCD----ILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCE---------------KKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSL 822
            ++Q + K +LT+   +Y+N  NL     KCE   +  DNCDP+FQ+ V   N  +    +L ++   + N K L  VL      +     + + + + D+D  D    IA F    +I  L    +  +Q+     D+ ++  + ++CA +YYG+ CE                    C + CI G C          C C  GW    C +
Sbjct:    7 HNQAEVKLLLTVR--DYENKNNLDSRLRKCEALSFFGDNCDPVFQLTVHVTNSRNERHLLLRREAGPFTNKKILKEVLQTSSTQREFPSVIEIALDIHDND-ADEDQLIARFR---RIIPLLRTGQLDLQM---GSDVKVKVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFCRM 207          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A074ZCZ5 (EGF-like domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_08602 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.106e-7
Identity = 51/208 (24.52%), Postives = 85/208 (40.87%), Query Frame = 1
Query:  256 KAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCD----ILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCE---------------KKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSL 822
            +A+  L + + +Y+N  NL     KCE   +  DNCDP+FQ+ V   N  +    +L ++   + N K L  VL      +     + + + + D+D  D    IA F    +I  L    +  +Q+     D+ ++  + ++CA +YYG+ CE                    C + CI G C          C C  GW    C +
Sbjct:   14 RAEVKLLLTVRDYENKNNLDSRLRKCEALSFFGDNCDPVFQLTVHVTNSRNERHLLLRREAGPFTNKKILKEVLQTSSTQREFPSVIEIALDIHDNDA-DEDQLIARFR---RIIPLLRTGQLDLQM---GSDVKVKVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFCRM 212          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077703.1 (SMESG000077703.1)

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 440/446 (98.65%), Postives = 442/446 (99.10%), Query Frame = 1
Query:  244 NHQTKAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSLFRSRNCTLLNCKKICSIFHYTQLCTCNDAKGGRMMCFEHIKPNYFFTKMXXXXXXXXXXXXXXXXXXXMTTWNNDIYVESSTKISPKSQKFSDNNENYKMDRKIQIQTATVSHLPSTXXXXXXXXXXXXXXXXXXXFIRKWQNKRQFNFSTSPQPQRPLPPILFSRSPQSIQKFNYDAEGNPSINKTNIYKETCKIPYTYSKRDDNKFTRKKFDNEIVDIYEEPIIDNMESLTCETDIYESDQSDAYEIPNKH 1581
            NHQTKAKAVLTIHILNYKN ANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAK LYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYG+NCEKKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSLFRSRNCTLLNCKKICSIFHY+QLCTCNDAKGGRMMCFEHIKPNYFFTKMLTTTESIISTTLKSIETKIMTTWNNDIYVESSTKISPKSQKFSD NENYKMDRKIQIQTATVSHLPSTVIIVCLLVLLCVCLISLLVFIRKWQNKRQFNFSTS QPQRPLPPILFSRSPQSIQKFNYDAEGNPSINKTNIYKETCKIPYTYSKRDDNKFTRKKFDNEIVDIYEEPIIDNMESLTCETDIYESDQSDAYEIPNKH
Sbjct:   20 NHQTKAKAVLTIHILNYKNYANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKTLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGNNCEKKRTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNCSLFRSRNCTLLNCKKICSIFHYSQLCTCNDAKGGRMMCFEHIKPNYFFTKMLTTTESIISTTLKSIETKIMTTWNNDIYVESSTKISPKSQKFSD-NENYKMDRKIQIQTATVSHLPSTVIIVCLLVLLCVCLISLLVFIRKWQNKRQFNFSTSLQPQRPLPPILFSRSPQSIQKFNYDAEGNPSINKTNIYKETCKIPYTYSKRDDNKFTRKKFDNEIVDIYEEPIIDNMESLTCETDIYESDQSDAYEIPNKH 464          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 188.734 bits (478), Expect = 3.879e-54
Identity = 85/188 (45.21%), Postives = 128/188 (68.09%), Query Frame = 1
Query:  259 AKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKK--RTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNC 816
             KA+L ++I NY+N+ ++KHD NKCETF WAND+CDP+F+IC+T K+ CD+     + + N+KK+Y V +Q  E  +    +S+ V+VDD D     DHIA F TSF I+   +  ++ M ++P N+ +SLQ SV +KCA +YYG+ CE++  +  C  SCI+GKC+FN +K+   C+C++GWD  NC
Sbjct:   25 TKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFERDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 212          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 188.734 bits (478), Expect = 3.970e-54
Identity = 85/188 (45.21%), Postives = 128/188 (68.09%), Query Frame = 1
Query:  259 AKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKK--RTQCKQSCIHGKCSFNIEKNQETCECFSGWDLPNC 816
             KA+L ++I NY+N+ ++KHD NKCETF WAND+CDP+F+IC+T K+ CD+     + + N+KK+Y V +Q  E  +    +S+ V+VDD D     DHIA F TSF I+   +  ++ M ++P N+ +SLQ SV +KCA +YYG+ CE++  +  C  SCI+GKC+FN +K+   C+C++GWD  NC
Sbjct:   23 TKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQTFERDKFINSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINC 210          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 125.946 bits (315), Expect = 7.034e-33
Identity = 66/171 (38.60%), Postives = 97/171 (56.73%), Query Frame = 1
Query:  256 KAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKKRTQCKQSCIHGKCSFNIEK 768
            +AK  + + I +Y N+ NL H+G KCE F WA D+CDPMF ICV  K  CD+       W N + ++ + S  I  +     L + V  DDHDR+DA DHI +F  +F            MQ  P++L+I L+  V IKC+++YYG+ C+K    C  S ++ KCS++ +K
Sbjct:    5 EAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDK---YCYPSSMY-KCSYSGDK 171          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000012543.1 (SMESG000012543.1)

HSP 1 Score: 125.946 bits (315), Expect = 8.334e-33
Identity = 66/171 (38.60%), Postives = 97/171 (56.73%), Query Frame = 1
Query:  256 KAKAVLTIHILNYKNNANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELKRMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGDNCEKKRTQCKQSCIHGKCSFNIEK 768
            +AK  + + I +Y N+ NL H+G KCE F WA D+CDPMF ICV  K  CD+       W N + ++ + S  I  +     L + V  DDHDR+DA DHI +F  +F            MQ  P++L+I L+  V IKC+++YYG+ C+K    C  S ++ KCS++ +K
Sbjct:   18 EAKIKIEVTIYDYSNHYNLMHNGKKCENFHWAGDHCDPMFIICVYDKYECDLKYVTTKFWANDRYVWNIYSGTIFSENFITSLKIKVTADDHDRYDAHDHIGVFRANFYPHGGKFDSWSHMQYGPRDLNIKLKARVRIKCSENYYGNLCDK---YCYPSSMY-KCSYSGDK 184          
The following BLAST results are available for this feature:
BLAST of Epidermal growth factor-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A161HX366.660e-4944.15Epidermal growth factor-8 OS=Schmidtea mediterrane... [more]
A0A4S2LB563.251e-825.00EGF-like domain-containing protein OS=Opisthorchis... [more]
A0A419QGW36.326e-825.00EGF-like domain-containing protein OS=Clonorchis s... [more]
A0A1S8WXP41.050e-725.00EGF-like domain protein (Fragment) OS=Opisthorchis... [more]
A0A074ZCZ51.106e-724.52EGF-like domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077703.10.000e+098.65SMESG000077703.1[more]
SMESG000077702.13.879e-5445.21SMESG000077702.1[more]
SMESG000077702.13.970e-5445.21SMESG000077702.1[more]
SMESG000012543.17.034e-3338.60SMESG000012543.1[more]
SMESG000012543.18.334e-3338.60SMESG000012543.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006022 ID=SMED30006022|Name=Epidermal growth factor-8|organism=Schmidtea mediterranea sexual|type=transcript|length=1692bp
AAAGGAACTAACGTGGGTAAAACTTGTTGTAAAATAACTTTTTTATGTAA
CTTTTACTTTTTTGTTTAAAATAAAAGTCAAATAATAAAAAAAGGATAAC
CAGTTTTTTTTATTAGTAAATTGTTTATTTACATCAATAATTGTTTATAT
ACGACAATCGAAATTTGTAAATTAACAACTACTCTGATGAAAATGAAATT
AAAAATATTTTTACAAATTTTTTTGTATATTCTCATTCAAATTAATCATC
AAACAAAAGCTAAAGCTGTTTTAACAATACATATCTTGAATTACAAAAAT
AATGCCAATCTCAAACATGACGGAAACAAATGTGAAACATTTGATTGGGC
TAACGATAATTGTGATCCGATGTTTCAGATCTGTGTCACTGCAAAGAATC
CATGTGATATTTTAAACAAAAAAATTGATCATTGGCCTAATGCCAAAAAA
CTTTATACTGTTTTATCGCAGAAAATTGAATTAAAAAGAATGGAGAGAAA
ACTGTCTGTAATAGTTCAAGTAGACGATCATGATCGATTTGATGCACCTG
ATCACATAGCCATTTTTACTACTTCATTCCAAATAAAGGATTTAAATGTT
TTTTACAAACAAAAAATGCAGATTAAGCCTAAAAATCTTGATATTAGCTT
GCAAACAAGCGTAATGATAAAATGTGCTGATTCTTATTATGGTGACAATT
GTGAAAAAAAACGTACTCAGTGTAAACAAAGCTGTATTCATGGAAAATGT
TCATTCAATATCGAAAAAAATCAAGAAACATGCGAGTGTTTTAGTGGTTG
GGATCTACCAAATTGTAGTTTGTTTCGTTCAAGGAATTGCACATTATTAA
ATTGTAAAAAAATATGCTCAATATTTCATTATACGCAGTTGTGCACCTGT
AATGACGCGAAAGGGGGACGTATGATGTGTTTTGAGCATATTAAACCGAA
TTACTTTTTTACAAAAATGTTAACTACTACAGAGTCAATTATTTCTACGA
CTTTGAAAAGTATTGAAACCAAAATAATGACTACTTGGAATAATGATATC
TACGTAGAATCTTCAACAAAAATATCTCCAAAAAGTCAAAAGTTTTCAGA
TAATAATGAGAATTATAAAATGGACAGAAAAATCCAAATCCAAACGGCTA
CGGTGTCACATTTACCATCTACAGTAATAATAGTATGCTTATTAGTGTTA
TTATGTGTCTGCTTGATTTCTTTACTGGTTTTCATTCGCAAATGGCAAAA
CAAACGTCAATTCAATTTTTCAACATCCCCTCAACCTCAAAGACCCTTAC
CACCGATTTTATTTTCTCGAAGTCCTCAATCTATACAAAAGTTCAATTAC
GATGCCGAAGGAAACCCCTCAATTAATAAAACGAACATCTACAAAGAGAC
ATGCAAAATTCCTTATACATATTCAAAACGAGATGACAATAAATTTACAA
GGAAGAAGTTTGACAATGAAATTGTTGATATTTATGAAGAACCAATAATT
GACAACATGGAAAGTTTAACATGTGAAACTGATATTTATGAGAGTGATCA
AAGCGATGCCTATGAAATTCCAAATAAGCATTAAAATATAGTTGACAATT
CACTCATTCAATCGTGATTTATATTTCATTTAAAGTTTCTTCTCATAATT
TAATTATCGGTTTATTTAAATATTTTTAATAAAATTAAAAAA
back to top

protein sequence of SMED30006022-orf-1

>SMED30006022-orf-1 ID=SMED30006022-orf-1|Name=SMED30006022-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=466bp
MKMKLKIFLQIFLYILIQINHQTKAKAVLTIHILNYKNNANLKHDGNKCE
TFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKKLYTVLSQKIELK
RMERKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKN
LDISLQTSVMIKCADSYYGDNCEKKRTQCKQSCIHGKCSFNIEKNQETCE
CFSGWDLPNCSLFRSRNCTLLNCKKICSIFHYTQLCTCNDAKGGRMMCFE
HIKPNYFFTKMLTTTESIISTTLKSIETKIMTTWNNDIYVESSTKISPKS
QKFSDNNENYKMDRKIQIQTATVSHLPSTVIIVCLLVLLCVCLISLLVFI
RKWQNKRQFNFSTSPQPQRPLPPILFSRSPQSIQKFNYDAEGNPSINKTN
IYKETCKIPYTYSKRDDNKFTRKKFDNEIVDIYEEPIIDNMESLTCETDI
YESDQSDAYEIPNKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013032EGF-like_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 199..210
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.665
NoneNo IPR availableTMHMMTMhelixcoord: 327..349